BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy15185
(611 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4AV3|A Chain A, Crystal Structure Of Thermotoga Maritima Sodium Pumping
Membrane Integral Pyrophosphatase With Metal Ions In
Active Site
pdb|4AV3|B Chain B, Crystal Structure Of Thermotoga Maritima Sodium Pumping
Membrane Integral Pyrophosphatase With Metal Ions In
Active Site
pdb|4AV6|A Chain A, Crystal Structure Of Thermotoga Maritima Sodium Pumping
Membrane Integral Pyrophosphatase At 4 A In Complex With
Phosphate And Magnesium
pdb|4AV6|B Chain B, Crystal Structure Of Thermotoga Maritima Sodium Pumping
Membrane Integral Pyrophosphatase At 4 A In Complex With
Phosphate And Magnesium
Length = 735
Score = 29.3 bits (64), Expect = 7.1, Method: Compositional matrix adjust.
Identities = 23/100 (23%), Positives = 43/100 (43%), Gaps = 4/100 (4%)
Query: 61 PPCLRFAANASAIIVDMFLIVYQLGICCVYIM-FVATNIKPVSIYYFSSNKQPLDDSTPY 119
PP L + D F +Y + I + ++ FVAT++ S + N + +
Sbjct: 428 PPTLTLVLGI--LFADYFAGLYGVAIAALGMLSFVATSVSVDSYGPIADNAGGISEMCEL 485
Query: 120 DPHKHRVLEHATTNNETLIHLLKG-SLGTGILAMPNAFVN 158
DP ++ +H T + KG ++G+ I A + F +
Sbjct: 486 DPEVRKITDHLDAVGNTTAAIGKGFAIGSAIFAALSLFAS 525
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.328 0.143 0.435
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 15,875,796
Number of Sequences: 62578
Number of extensions: 595939
Number of successful extensions: 1254
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1253
Number of HSP's gapped (non-prelim): 2
length of query: 611
length of database: 14,973,337
effective HSP length: 105
effective length of query: 506
effective length of database: 8,402,647
effective search space: 4251739382
effective search space used: 4251739382
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 54 (25.4 bits)