BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy15185
         (611 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4AV3|A Chain A, Crystal Structure Of Thermotoga Maritima Sodium Pumping
           Membrane Integral Pyrophosphatase With Metal Ions In
           Active Site
 pdb|4AV3|B Chain B, Crystal Structure Of Thermotoga Maritima Sodium Pumping
           Membrane Integral Pyrophosphatase With Metal Ions In
           Active Site
 pdb|4AV6|A Chain A, Crystal Structure Of Thermotoga Maritima Sodium Pumping
           Membrane Integral Pyrophosphatase At 4 A In Complex With
           Phosphate And Magnesium
 pdb|4AV6|B Chain B, Crystal Structure Of Thermotoga Maritima Sodium Pumping
           Membrane Integral Pyrophosphatase At 4 A In Complex With
           Phosphate And Magnesium
          Length = 735

 Score = 29.3 bits (64), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 43/100 (43%), Gaps = 4/100 (4%)

Query: 61  PPCLRFAANASAIIVDMFLIVYQLGICCVYIM-FVATNIKPVSIYYFSSNKQPLDDSTPY 119
           PP L        +  D F  +Y + I  + ++ FVAT++   S    + N   + +    
Sbjct: 428 PPTLTLVLGI--LFADYFAGLYGVAIAALGMLSFVATSVSVDSYGPIADNAGGISEMCEL 485

Query: 120 DPHKHRVLEHATTNNETLIHLLKG-SLGTGILAMPNAFVN 158
           DP   ++ +H      T   + KG ++G+ I A  + F +
Sbjct: 486 DPEVRKITDHLDAVGNTTAAIGKGFAIGSAIFAALSLFAS 525


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.328    0.143    0.435 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 15,875,796
Number of Sequences: 62578
Number of extensions: 595939
Number of successful extensions: 1254
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1253
Number of HSP's gapped (non-prelim): 2
length of query: 611
length of database: 14,973,337
effective HSP length: 105
effective length of query: 506
effective length of database: 8,402,647
effective search space: 4251739382
effective search space used: 4251739382
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 54 (25.4 bits)