Diaphorina citri psyllid: psy1522

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34

MMHVEIQVALNFVISYLYNKLPRRRVNIFGEELEKALKEKFSGHWYPGKPLKDSSTNNKALKEKFSGHWYPGKPLKGSAFRCLKTGDPIDPVLEIAARESGVAIQDVLENLPSELAVWVDPGEVTGDPIDPVLEIAARESGVAIQDVLENLPSELAVWVDPGEVRGEREIATADPSLHAAAMDREVHKTFNPEARVFRPVEVCLASLSLNGEERSASPSPTKGSPTFLPRSTAPLTFTTASFAQTKFGSTKLKTNSKRTNRMSPTEFSNYIKQRALLQQQHNNHPQPSLPPTLSNFLHSPGAQSPHYSPNTPSGNTARSLSPSYYFSQKRNRKLKQGLF

ccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHccccccccccccccccEEEccccccHHHHHHHHHHcccHHHHHHccccccEEEEccccEEEcccccccEEEcccccccHHHHcccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccc

*MHVEIQVALNFVISYLYNKLPRRRVNIFGEELEKALKEKFSGHWYPGKPLKDSSTNNKALKEKFSGHWYPGKPLKGSAFRCLKTGDPIDPVLEIAARESGVAIQDVLENLPSELAVWVDPGEVTGDPIDPVLEIAARESGVAIQDVLENLPSELAVWVD*****************************F*P*********************************************TTASFA***************************************************************************************NRKLKQGLF

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein Tob2	Anti-proliferative protein inhibits cell cycle progression from the G0/G1 to S phases.	confident	Q9JM55
Protein Tob2	Anti-proliferative protein inhibits cell cycle progression from the G0/G1 to S phases.	confident	Q14106

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044763 [BP]	single-organism cellular process	probable	GO:0009987, GO:0008150, GO:0044699
GO:0048523 [BP]	negative regulation of cellular process	probable	GO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0051252 [BP]	regulation of RNA metabolic process	probable	GO:0080090, GO:0019222, GO:0060255, GO:0031323, GO:0050794, GO:0019219, GO:0065007, GO:0051171, GO:0008150, GO:0050789
GO:0010468 [BP]	regulation of gene expression	probable	GO:0060255, GO:0008150, GO:0065007, GO:0050789, GO:0019222

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Z15, chain A
Confidence level:very confident
Coverage over the Query: 1-43,68-127
View the alignment between query and template
View the model in PyMOL

Template: 2Z15, chain A
Confidence level:very confident
Coverage over the Query: 127-178
View the alignment between query and template
View the model in PyMOL