Query         psy15248
Match_columns 75
No_of_seqs    101 out of 250
Neff          4.0 
Searched_HMMs 46136
Date          Sat Aug 17 01:09:31 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15248.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15248hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1479|consensus               99.5 1.7E-14 3.7E-19  113.6   4.1   64    1-64      2-82  (406)
  2 TIGR00939 2a57 Equilibrative N  98.5 3.9E-08 8.6E-13   76.6   1.4   23   22-44      1-23  (437)
  3 PF04195 Transposase_28:  Putat  64.2      11 0.00024   27.2   3.6   51    5-57     45-103 (181)
  4 PF13817 DDE_Tnp_IS66_C:  IS66   50.5     5.2 0.00011   22.3  -0.0    8   27-34     32-39  (39)
  5 PF02932 Neur_chan_memb:  Neuro  41.5      40 0.00086   20.9   3.0   27   20-46     37-63  (237)
  6 PF10597 U5_2-snRNA_bdg:  U5-sn  40.6      43 0.00092   23.7   3.3   42   32-73     54-109 (135)
  7 PHA01474 nonstructural protein  38.6      14  0.0003   22.0   0.5   19   20-38     17-35  (52)
  8 cd00929 Cyt_c_Oxidase_VIIc Cyt  32.1      34 0.00073   19.8   1.5   25   10-34     14-38  (46)
  9 PRK10591 hypothetical protein;  30.6      25 0.00054   23.4   0.8   17   16-32     42-58  (92)
 10 PHA02706 hypothetical protein;  29.6      26 0.00057   21.3   0.8   16   16-31      8-23  (58)
 11 PF05787 DUF839:  Bacterial pro  28.7      16 0.00036   29.9  -0.3   19   27-45    167-185 (524)
 12 PF14654 Epiglycanin_C:  Mucin,  26.0 1.1E+02  0.0023   20.9   3.2   11   28-38     13-23  (106)
 13 PRK12887 ubiA tocopherol phyty  24.8 1.3E+02  0.0027   22.8   3.8   45   17-66    237-281 (308)
 14 TIGR03782 Bac_Flav_CT_J Bacter  24.5      45 0.00098   26.5   1.4   19   12-30    260-278 (322)
 15 PF02935 COX7C:  Cytochrome c o  23.6      34 0.00074   20.8   0.5   24   10-33     32-55  (65)
 16 PF07214 DUF1418:  Protein of u  22.2      39 0.00085   22.6   0.6   18   17-34     43-60  (96)

No 1  
>KOG1479|consensus
Probab=99.49  E-value=1.7e-14  Score=113.59  Aligned_cols=64  Identities=39%  Similarity=0.704  Sum_probs=52.8

Q ss_pred             CCccCCCCCCCCcccchhhhHHHHHhhhcccchhhhhhhhhhh-----------------hhhHHHHHHHHHHHhhhccc
Q psy15248          1 MENADLETNPPRDRWKLVYLTLLLHGVGTLMPWNMFITAKAQR-----------------LSANIIIIIIVLIYTARLGL   63 (75)
Q Consensus         1 ~~~~~~~~~~P~Dr~~~vyiif~llGiG~LlPWN~FITA~dY~-----------------~~~~~~~i~i~~~~~~r~~l   63 (75)
                      +|+++.+..+|+|+++.+|++|+++|+|+|+|||+||||.|||                 +..+.+..+++...+++++.
T Consensus         2 ~~~~~~~~~~p~d~~~~v~~i~~llGiG~LlpWN~fiTa~~y~~~~~~~~~~~~~F~~~~~~~a~i~~ll~~~~n~~~~~   81 (406)
T KOG1479|consen    2 QDEVELDSPEPEDGYNLVYLIFLLLGIGTLLPWNMFITASDYYYYRFPGYHNSKNFTSSYTLAAQIPLLLFNLLNAFLNT   81 (406)
T ss_pred             CccccccCCCcccccccHHHHHHHHhcccccchHhhhccHHHHHhhcCCCchHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4678899999999999999999999999999999999999973                 44455555666677776655


Q ss_pred             c
Q psy15248         64 K   64 (75)
Q Consensus        64 ~   64 (75)
                      +
T Consensus        82 ~   82 (406)
T KOG1479|consen   82 R   82 (406)
T ss_pred             H
Confidence            4


No 2  
>TIGR00939 2a57 Equilibrative Nucleoside Transporter (ENT).
Probab=98.50  E-value=3.9e-08  Score=76.65  Aligned_cols=23  Identities=48%  Similarity=0.959  Sum_probs=21.0

Q ss_pred             HHHHhhhcccchhhhhhhhhhhh
Q psy15248         22 LLLHGVGTLMPWNMFITAKAQRL   44 (75)
Q Consensus        22 f~llGiG~LlPWN~FITA~dY~~   44 (75)
                      |+++|+|+|+|||+||||.|||+
T Consensus         1 f~llG~~~L~pWN~fitA~~Yf~   23 (437)
T TIGR00939         1 FFMLGVGVLLPWNAFITAPQYFI   23 (437)
T ss_pred             CEEEeeeccchhHHHhhHHHHHH
Confidence            67899999999999999999854


No 3  
>PF04195 Transposase_28:  Putative gypsy type transposon;  InterPro: IPR007321 This domain is found in a family of plant gene products and is thought to be related to gypsy type transposons. There is a domain of unknown function, (IPR007228 from INTERPRO), at the C terminus of the proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=64.19  E-value=11  Score=27.19  Aligned_cols=51  Identities=16%  Similarity=0.207  Sum_probs=37.8

Q ss_pred             CCCCCCCCcccchhhhHHHHHhhhcccchhhhhhh-hhhh-------hhhHHHHHHHHHHH
Q psy15248          5 DLETNPPRDRWKLVYLTLLLHGVGTLMPWNMFITA-KAQR-------LSANIIIIIIVLIY   57 (75)
Q Consensus         5 ~~~~~~P~Dr~~~vyiif~llGiG~LlPWN~FITA-~dY~-------~~~~~~~i~i~~~~   57 (75)
                      |..+.|+.++.-.+|..|+..|++  +|-|-|+-. .++|       .++++..|+|+.+-
T Consensus        45 e~~P~P~~~g~~vvf~~f~~~Gl~--~P~~~f~~~vL~~y~v~l~~L~Pnai~~laiF~~l  103 (181)
T PF04195_consen   45 EAVPSPPYPGRIVVFADFFEAGLR--PPCSPFLREVLRFYGVELPQLNPNAIARLAIFAWL  103 (181)
T ss_pred             ccccCCCCCCcEEEEhHHhhcCcc--CCchHHHHHHHHHhCccccccChHHHHHHHHHHHH
Confidence            444445556789999999997766  899999984 4654       56788888888764


No 4  
>PF13817 DDE_Tnp_IS66_C:  IS66 C-terminal element
Probab=50.53  E-value=5.2  Score=22.28  Aligned_cols=8  Identities=50%  Similarity=1.477  Sum_probs=6.4

Q ss_pred             hhcccchh
Q psy15248         27 VGTLMPWN   34 (75)
Q Consensus        27 iG~LlPWN   34 (75)
                      +.-|||||
T Consensus        32 ~~~LLPwn   39 (39)
T PF13817_consen   32 IDELLPWN   39 (39)
T ss_pred             HHHhCCCC
Confidence            56689998


No 5  
>PF02932 Neur_chan_memb:  Neurotransmitter-gated ion-channel transmembrane region ion channel family signature gamma-aminobutyric acid (GABA) receptor signature nicotinic acetylcholine receptor signature;  InterPro: IPR006029 Neurotransmitter ligand-gated ion channels are transmembrane receptor-ion channel complexes that open transiently upon binding of specific ligands, allowing rapid transmission of signals at chemical synapses [, ]. Five of these ion channel receptor families have been shown to form a sequence-related superfamily:   Nicotinic acetylcholine receptor (AchR), an excitatory cation channel in vertebrates and invertebrates; in vertebrate motor endplates it is composed of alpha, beta, gamma and delta/epsilon subunits; in neurons it is composed of alpha and non-alpha (or beta) subunits []. Glycine receptor, an inhibitory chloride ion channel composed of alpha and beta subunits []. Gamma-aminobutyric acid (GABA) receptor, an inhibitory chloride ion channel; at least four types of subunits (alpha, beta, gamma and delta) are known []. Serotonin 5HT3 receptor, of which there are seven major types (5HT3-5HT7) []. Glutamate receptor, an excitatory cation channel of which at least three types have been described (kainate, N-methyl-D-aspartate (NMDA) and quisqualate) [].   These receptors possess a pentameric structure (made up of varying subunits), surrounding a central pore. All known sequences of subunits from neurotransmitter-gated ion-channels are structurally related. They are composed of a large extracellular glycosylated N-terminal ligand-binding domain, followed by three hydrophobic transmembrane regions which form the ionic channel, followed by an intracellular region of variable length. A fourth hydrophobic region is found at the C-terminal of the sequence [, ]. This domain represents four transmembrane helices of a variety of neurotransmitter-gated ion-channels.; GO: 0006811 ion transport, 0016020 membrane; PDB: 1DXZ_A 3MRA_A 1EQ8_C 1OED_C 2PR9_P 1A11_A 1CEK_A 2BG9_E 2KSR_A 2K59_B ....
Probab=41.52  E-value=40  Score=20.95  Aligned_cols=27  Identities=15%  Similarity=0.114  Sum_probs=21.3

Q ss_pred             hHHHHHhhhcccchhhhhhhhhhhhhh
Q psy15248         20 LTLLLHGVGTLMPWNMFITAKAQRLSA   46 (75)
Q Consensus        20 iif~llGiG~LlPWN~FITA~dY~~~~   46 (75)
                      ++.+++++...+|.-+..+|.|-|...
T Consensus        37 ~~~~~~~~~~~lP~~s~~~pl~~~~~~   63 (237)
T PF02932_consen   37 MTVFLLMVAENLPPTSYAKPLDGWYFI   63 (237)
T ss_dssp             HHHHHHHHHHHHHHHHHHSHHHHHHHH
T ss_pred             HHHHHhhhhhhhcccccccchhhhhcc
Confidence            456777888899999999999955443


No 6  
>PF10597 U5_2-snRNA_bdg:  U5-snRNA binding site 2 of PrP8;  InterPro: IPR019581  The essential spliceosomal protein Prp8 interacts with U5 and U6 snRNAs and with specific pre-mRNA sequences that participate in catalysis []. This close association with crucial RNA sequences, together with extensive genetic evidence, suggests that Prp8 could directly affect the function of the catalytic core, perhaps acting as a splicing cofactor []. 
Probab=40.61  E-value=43  Score=23.69  Aligned_cols=42  Identities=24%  Similarity=0.509  Sum_probs=26.3

Q ss_pred             chhhhhhhhhhhhhhHHH----HHHHHHHHhhhc------c----ccccCcccccc
Q psy15248         32 PWNMFITAKAQRLSANII----IIIIVLIYTARL------G----LKSPFTPAVGY   73 (75)
Q Consensus        32 PWN~FITA~dY~~~~~~~----~i~i~~~~~~r~------~----l~~~f~~~~~~   73 (75)
                      =||..+++.-=|.+.+++    .+-++..+|.|+      +    ..+||-|+|=|
T Consensus        54 KWNt~li~l~~YfREA~~~T~~lldil~k~E~kIq~RIK~gLNSkmPsRFPpvvFY  109 (135)
T PF10597_consen   54 KWNTALIGLMTYFREAIVNTEELLDILVKCENKIQNRIKIGLNSKMPSRFPPVVFY  109 (135)
T ss_pred             HHHHHHHHHHHHHHHHHhccHHHHHHHHHHHHHHHHHHHHHhcccCCCCCCCeeec
Confidence            499999975544555554    335566777654      2    34688887744


No 7  
>PHA01474 nonstructural protein
Probab=38.60  E-value=14  Score=22.04  Aligned_cols=19  Identities=26%  Similarity=0.415  Sum_probs=13.1

Q ss_pred             hHHHHHhhhcccchhhhhh
Q psy15248         20 LTLLLHGVGTLMPWNMFIT   38 (75)
Q Consensus        20 iif~llGiG~LlPWN~FIT   38 (75)
                      -.||--.--.|-|||+|-.
T Consensus        17 ssfwscariilspwnsfrs   35 (52)
T PHA01474         17 SSFWSCARIILSPWNSFRS   35 (52)
T ss_pred             hhhhhhhheeeCcccccee
Confidence            3455555667889999854


No 8  
>cd00929 Cyt_c_Oxidase_VIIc Cytochrome c oxidase subunit VIIc. Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. The VIIc subunit is found only in eukaryotes and its specific function remains unclear. Peroxide inactivation of bovine CcO coincides with the direct oxidation of tryptophan (W19) within subunit VIIc, along with other structural changes in other subunits.
Probab=32.06  E-value=34  Score=19.81  Aligned_cols=25  Identities=28%  Similarity=0.579  Sum_probs=17.2

Q ss_pred             CCCcccchhhhHHHHHhhhcccchh
Q psy15248         10 PPRDRWKLVYLTLLLHGVGTLMPWN   34 (75)
Q Consensus        10 ~P~Dr~~~vyiif~llGiG~LlPWN   34 (75)
                      .++.|+.+.-...+..|.|..+||=
T Consensus        14 ~~~nk~~~~~~~~~ffg~GF~~PF~   38 (46)
T cd00929          14 SVTNKWRLTALFHLFFGSGFSAPFI   38 (46)
T ss_pred             ccCccchHHHHHHHHHHHHHhhhHH
Confidence            3556665655566688888888873


No 9  
>PRK10591 hypothetical protein; Provisional
Probab=30.59  E-value=25  Score=23.36  Aligned_cols=17  Identities=18%  Similarity=0.407  Sum_probs=14.5

Q ss_pred             chhhhHHHHHhhhcccc
Q psy15248         16 KLVYLTLLLHGVGTLMP   32 (75)
Q Consensus        16 ~~vyiif~llGiG~LlP   32 (75)
                      .-+-++.+++|+|+++|
T Consensus        42 ~~aai~mif~Gi~lmiP   58 (92)
T PRK10591         42 PTAAILMIFLGVLLMLP   58 (92)
T ss_pred             chHHHHHHHHHHHHhhH
Confidence            35668889999999999


No 10 
>PHA02706 hypothetical protein; Provisional
Probab=29.58  E-value=26  Score=21.33  Aligned_cols=16  Identities=13%  Similarity=0.573  Sum_probs=12.5

Q ss_pred             chhhhHHHHHhhhccc
Q psy15248         16 KLVYLTLLLHGVGTLM   31 (75)
Q Consensus        16 ~~vyiif~llGiG~Ll   31 (75)
                      -.+-||++++|+|++.
T Consensus         8 lviaiimmllgi~sii   23 (58)
T PHA02706          8 LVIAIIMMLLGIASII   23 (58)
T ss_pred             HHHHHHHHHHhhHHHh
Confidence            3456889999999864


No 11 
>PF05787 DUF839:  Bacterial protein of unknown function (DUF839);  InterPro: IPR008557 This family consists of bacterial proteins of unknown function.
Probab=28.74  E-value=16  Score=29.85  Aligned_cols=19  Identities=21%  Similarity=0.635  Sum_probs=16.1

Q ss_pred             hhcccchhhhhhhhhhhhh
Q psy15248         27 VGTLMPWNMFITAKAQRLS   45 (75)
Q Consensus        27 iG~LlPWN~FITA~dY~~~   45 (75)
                      .|..-|||.+||.++++..
T Consensus       167 aGg~TPWGT~Lt~EEn~~~  185 (524)
T PF05787_consen  167 AGGVTPWGTYLTCEENFPD  185 (524)
T ss_pred             CCCCCCCcceEecccccCC
Confidence            4678899999999998665


No 12 
>PF14654 Epiglycanin_C:  Mucin, catalytic, TM and cytoplasmic tail region
Probab=25.97  E-value=1.1e+02  Score=20.92  Aligned_cols=11  Identities=45%  Similarity=1.364  Sum_probs=9.4

Q ss_pred             hcccchhhhhh
Q psy15248         28 GTLMPWNMFIT   38 (75)
Q Consensus        28 G~LlPWN~FIT   38 (75)
                      |+|-||-.|+.
T Consensus        13 GsL~PWeIfLI   23 (106)
T PF14654_consen   13 GSLKPWEIFLI   23 (106)
T ss_pred             CCccchHHHHH
Confidence            78999998865


No 13 
>PRK12887 ubiA tocopherol phytyltransferase; Reviewed
Probab=24.79  E-value=1.3e+02  Score=22.85  Aligned_cols=45  Identities=18%  Similarity=0.305  Sum_probs=28.5

Q ss_pred             hhhhHHHHHhhhcccchhhhhhhhhhhhhhHHHHHHHHHHHhhhcccccc
Q psy15248         17 LVYLTLLLHGVGTLMPWNMFITAKAQRLSANIIIIIIVLIYTARLGLKSP   66 (75)
Q Consensus        17 ~vyiif~llGiG~LlPWN~FITA~dY~~~~~~~~i~i~~~~~~r~~l~~~   66 (75)
                      ..|+...+.|++.+.+||...+.     -.-.+...++.+...++|++++
T Consensus       237 ~~y~~~i~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~  281 (308)
T PRK12887        237 ACYLGMIAVGLLSLPTVNPAFLI-----VSHLILLALLWWRSQRVDLQDK  281 (308)
T ss_pred             HHHHHHHHHHHHHhhhHHHHHHH-----HHHHHHHHHHHHHHhhcCcccc
Confidence            34677777788888888876543     1122344555567778888753


No 14 
>TIGR03782 Bac_Flav_CT_J Bacteroides conjugative transposon TraJ protein. Members of this protein family are designated TraM and are found in a proposed transfer region of a class of conjugative transposon found in the Bacteroides lineage. This family is related conjugation system proteins in the Proteobacteria, including TrbL of Agrobacterium Ti plasmids and VirB6.
Probab=24.54  E-value=45  Score=26.54  Aligned_cols=19  Identities=21%  Similarity=0.385  Sum_probs=16.5

Q ss_pred             CcccchhhhHHHHHhhhcc
Q psy15248         12 RDRWKLVYLTLLLHGVGTL   30 (75)
Q Consensus        12 ~Dr~~~vyiif~llGiG~L   30 (75)
                      .|..+.+|++|++.|+...
T Consensus       260 ~d~sn~~yiiFmlIGi~gy  278 (322)
T TIGR03782       260 PDSSNSVYIIFMIIGIIGY  278 (322)
T ss_pred             CCCccHHHHHHHHHHHHHh
Confidence            5788999999999998654


No 15 
>PF02935 COX7C:  Cytochrome c oxidase subunit VIIc;  InterPro: IPR004202 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  This entry represents cytochrome C subunit 7C. The yeast member of this family is called cytochrome C subunit 8P.; GO: 0004129 cytochrome-c oxidase activity; PDB: 3ABL_Y 3ABM_L 2EIM_L 3ASO_L 3AG3_Y 3AG1_Y 1OCC_Y 2DYS_Y 2OCC_L 1V54_L ....
Probab=23.63  E-value=34  Score=20.77  Aligned_cols=24  Identities=17%  Similarity=0.436  Sum_probs=17.3

Q ss_pred             CCCcccchhhhHHHHHhhhcccch
Q psy15248         10 PPRDRWKLVYLTLLLHGVGTLMPW   33 (75)
Q Consensus        10 ~P~Dr~~~vyiif~llGiG~LlPW   33 (75)
                      .++.|+.++...+..+|+|..+|+
T Consensus        32 ~~~nK~~~~~~~~~f~g~GF~~PF   55 (65)
T PF02935_consen   32 NVKNKWPFAVKFWGFFGSGFAAPF   55 (65)
T ss_dssp             --SSHHHHHHHHHHHHHHHHHHHH
T ss_pred             cCcchhHHHHHHHHHHHHHHHhHH
Confidence            356677777777778899988886


No 16 
>PF07214 DUF1418:  Protein of unknown function (DUF1418);  InterPro: IPR010815 This family consists of several hypothetical Enterobacterial proteins of around 100 residues in length. Members of this family are often described as YbjC. In Escherichia coli the ybjC gene is located downstream of nfsA (which encodes the major oxygen-insensitive nitroreductase). It is thought that nfsA and ybjC form an operon an its promoter is a class I SoxS-dependent promoter []. The function of this family is unknown.
Probab=22.18  E-value=39  Score=22.55  Aligned_cols=18  Identities=17%  Similarity=0.554  Sum_probs=14.6

Q ss_pred             hhhhHHHHHhhhcccchh
Q psy15248         17 LVYLTLLLHGVGTLMPWN   34 (75)
Q Consensus        17 ~vyiif~llGiG~LlPWN   34 (75)
                      .+-++.+++|+|+++|==
T Consensus        43 ~aai~MIf~Gi~lMlPAa   60 (96)
T PF07214_consen   43 TAAIAMIFVGIGLMLPAA   60 (96)
T ss_pred             hHHHHHHHHHHHHHHHHH
Confidence            456788899999999943


Done!