Diaphorina citri psyllid: psy15249

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-----

MLFAAFEKHQYYNIKDLVKITKQPIVNLDLTQASRGVWLVKVPKYVANKWEKVPGNIEAGKLKIVRNPGQKPVVSLSLSEATMCVDPNEEKIPKDHRLDVQIVNRQTLGVFSHYIPPVNPDAIVPESEKLMLEGKIVQKLECRPYADSCYMKLKLDSIIKASQPLRQVKHLDKIVQNYKPVSNHKHLTYLKEILKEVCNYNLKNPHKNMWELKPEYRCYKEEEKKEEATADDDDD

cHHHHHHHcccccHHHHHHHccccccccccccccccEEEEEccHHHHHHHcccccccccEEEEEEccccccccEEEEccccccccccccccccccCEEEEEECccEEEEEEEccccccccccccccccccEEEEEEEEEEEEcccccHHHHHHHHHHHHHHcccccEEEEHHHHHccccccccccHHHHHHHHHHHHHHHcccccccccccccHHHHcccHHHHHHHcccccccc

MLFAAFEKHQYYNIKDLVKITKQPIVNLDLTQASRGVWLVKVPKYVANKWEKVPGNIEAGKLKIVRNPG**PVVSLSLSEATMCV*********DHRLDVQIVNRQTLGVFSHYIP**********SEKLMLEGKIVQKLECRPYADSCYMKLKLDSIIKASQPLRQVKHLDKIVQNYKPVSNHKHLTYLKEILKEVCNYNLKNPHKNMWELKPEYRCY****************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
General transcription factor IIF subunit 2	TFIIF is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation. This subunit shows ATP-dependent DNA-helicase activity.	confident	P41900
General transcription factor IIF subunit 2	TFIIF is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation. This subunit shows ATP-dependent DNA-helicase activity.	confident	Q8R0A0
General transcription factor IIF subunit 2	TFIIF is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation. This subunit shows ATP-dependent DNA-helicase activity.	confident	P13984

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0060261 [BP]	positive regulation of transcription initiation from RNA polymerase II promoter	probable	GO:0060260, GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0051173, GO:0031323, GO:0051128, GO:0010628, GO:0045935, GO:0050789, GO:0080090, GO:0010604, GO:0006355, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0006357, GO:0065007, GO:0048518, GO:0010468, GO:0051130, GO:2000142, GO:0060255, GO:0009889, GO:0031334, GO:0050794, GO:0008150, GO:0045893, GO:2001141, GO:0043254, GO:0051252, GO:0051254, GO:0044087, GO:0010557, GO:0010556, GO:2000144, GO:0048522
GO:0032968 [BP]	positive regulation of transcription elongation from RNA polymerase II promoter	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0045935, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0034243, GO:0060255, GO:0032784, GO:0009889, GO:0032786, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0045944 [BP]	positive regulation of transcription from RNA polymerase II promoter	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
3.-.-.-	Hydrolases.	probable
3.6.-.-	Acting on acid anhydrides.	probable
3.6.4.-	Acting on acid anhydrides; involved in cellular and subcellular movement.	probable
3.6.4.12	DNA helicase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1F3U, chain A
Confidence level:very confident
Coverage over the Query: 22-116,128-145
View the alignment between query and template
View the model in PyMOL

Template: 1BBY, chain A
Confidence level:very confident
Coverage over the Query: 187-220
View the alignment between query and template
View the model in PyMOL

Template: 1BBY, chain A
Confidence level:very confident
Coverage over the Query: 1-53
View the alignment between query and template
View the model in PyMOL