Query         psy15257
Match_columns 65
No_of_seqs    176 out of 1116
Neff          8.3 
Searched_HMMs 46136
Date          Fri Aug 16 16:22:53 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15257.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15257hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0084|consensus               99.6 2.3E-15 4.9E-20   91.0   5.9   50    6-62      3-52  (205)
  2 KOG0094|consensus               99.5 4.5E-14 9.8E-19   85.7   5.5   50    9-65     19-68  (221)
  3 KOG0078|consensus               99.5 1.9E-13 4.1E-18   83.2   6.7   52    5-63      5-56  (207)
  4 KOG0394|consensus               99.4 4.8E-13   1E-17   80.6   3.7   49    8-63      5-53  (210)
  5 KOG0080|consensus               99.4 2.7E-12 5.8E-17   76.5   6.4   49    7-62      6-54  (209)
  6 KOG0098|consensus               99.3 2.5E-12 5.4E-17   77.8   5.5   50    9-65      3-61  (216)
  7 KOG0087|consensus               99.3 5.7E-12 1.2E-16   77.1   5.8   51    4-61      6-56  (222)
  8 KOG0092|consensus               99.3 6.5E-12 1.4E-16   75.9   4.9   46   10-62      3-48  (200)
  9 KOG0393|consensus               99.3 1.9E-12 4.2E-17   78.5   2.5   45   11-63      3-47  (198)
 10 cd04172 Rnd3_RhoE_Rho8 Rnd3/Rh  99.3   1E-11 2.2E-16   73.9   5.6   44   10-61      3-46  (182)
 11 cd01875 RhoG RhoG subfamily.    99.3 9.6E-12 2.1E-16   74.0   5.2   40   12-59      3-42  (191)
 12 cd01874 Cdc42 Cdc42 subfamily.  99.3 1.1E-11 2.4E-16   72.9   5.0   39   13-59      2-40  (175)
 13 cd01873 RhoBTB RhoBTB subfamil  99.2 1.9E-11 4.2E-16   73.4   5.7   47   12-58      2-48  (195)
 14 KOG0079|consensus               99.2 3.9E-12 8.6E-17   75.0   1.9   49    8-63      4-52  (198)
 15 cd04131 Rnd Rnd subfamily.  Th  99.2 2.3E-11 5.1E-16   71.9   5.3   40   13-60      2-41  (178)
 16 cd04174 Rnd1_Rho6 Rnd1/Rho6 su  99.2 3.1E-11 6.8E-16   74.5   6.0   45    8-60      9-53  (232)
 17 cd04133 Rop_like Rop subfamily  99.2 3.8E-11 8.3E-16   71.1   5.0   40   13-60      2-41  (176)
 18 cd04128 Spg1 Spg1p.  Spg1p (se  99.2   4E-11 8.6E-16   71.1   4.8   40   13-59      1-40  (182)
 19 KOG0095|consensus               99.2 5.5E-11 1.2E-15   70.4   5.3   49    8-63      3-51  (213)
 20 cd04173 Rnd2_Rho7 Rnd2/Rho7 su  99.2 3.3E-11 7.2E-16   73.9   4.5   39   13-59      2-40  (222)
 21 PLN03110 Rab GTPase; Provision  99.2 1.7E-10 3.7E-15   70.0   6.8   52    1-59      1-52  (216)
 22 PLN03071 GTP-binding nuclear p  99.1 1.3E-10 2.8E-15   70.7   5.8   43   10-59     11-53  (219)
 23 cd01892 Miro2 Miro2 subfamily.  99.1 9.9E-11 2.1E-15   68.4   5.0   37   10-52      2-39  (169)
 24 cd04121 Rab40 Rab40 subfamily.  99.1 2.2E-10 4.7E-15   68.6   5.9   44    9-59      3-46  (189)
 25 cd04141 Rit_Rin_Ric Rit/Rin/Ri  99.1 1.8E-10 3.9E-15   67.5   4.7   41   12-60      2-42  (172)
 26 KOG0086|consensus               99.1 9.7E-11 2.1E-15   69.5   3.4   48    5-59      2-49  (214)
 27 cd04120 Rab12 Rab12 subfamily.  99.1 2.2E-10 4.8E-15   69.3   5.0   41   14-61      2-42  (202)
 28 cd04108 Rab36_Rab34 Rab34/Rab3  99.1 3.4E-10 7.4E-15   66.2   5.6   39   14-59      2-40  (170)
 29 cd01871 Rac1_like Rac1-like su  99.1 2.5E-10 5.5E-15   67.0   4.9   39   13-59      2-40  (174)
 30 cd04138 H_N_K_Ras_like H-Ras/N  99.1 2.3E-10   5E-15   65.0   4.5   39   13-59      2-40  (162)
 31 cd04109 Rab28 Rab28 subfamily.  99.1 3.3E-10 7.2E-15   68.4   5.3   42   13-61      1-42  (215)
 32 cd04127 Rab27A Rab27a subfamil  99.1 4.5E-10 9.9E-15   65.4   5.6   41   11-58      3-43  (180)
 33 cd04107 Rab32_Rab38 Rab38/Rab3  99.1 4.2E-10   9E-15   67.2   5.4   39   13-58      1-39  (201)
 34 KOG0093|consensus               99.1 2.9E-10 6.3E-15   67.1   4.5   47    6-59     15-61  (193)
 35 KOG0091|consensus               99.1 2.1E-10 4.5E-15   68.6   3.8   43    9-58      5-47  (213)
 36 PF00071 Ras:  Ras family;  Int  99.1 1.8E-10 3.8E-15   66.0   3.4   42   14-62      1-42  (162)
 37 cd04136 Rap_like Rap-like subf  99.1 2.6E-10 5.7E-15   65.1   4.1   40   13-60      2-41  (163)
 38 cd04102 RabL3 RabL3 (Rab-like3  99.0 4.6E-10   1E-14   68.0   5.2   34   13-52      1-34  (202)
 39 cd04117 Rab15 Rab15 subfamily.  99.0   6E-10 1.3E-14   64.4   5.2   38   13-57      1-38  (161)
 40 PLN00023 GTP-binding protein;   99.0 6.9E-10 1.5E-14   71.8   5.9   45    8-59     17-61  (334)
 41 cd04111 Rab39 Rab39 subfamily.  99.0 6.9E-10 1.5E-14   67.1   5.6   43   12-61      2-44  (211)
 42 cd00877 Ran Ran (Ras-related n  99.0 6.1E-10 1.3E-14   64.8   5.0   39   13-58      1-39  (166)
 43 cd04110 Rab35 Rab35 subfamily.  99.0 8.3E-10 1.8E-14   66.0   5.5   41   10-57      4-44  (199)
 44 PTZ00369 Ras-like protein; Pro  99.0 5.7E-10 1.2E-14   66.1   4.6   40   12-59      5-44  (189)
 45 cd04119 RJL RJL (RabJ-Like) su  99.0 7.9E-10 1.7E-14   63.1   4.9   38   13-57      1-38  (168)
 46 cd04122 Rab14 Rab14 subfamily.  99.0 8.9E-10 1.9E-14   63.6   5.1   35   12-52      2-36  (166)
 47 cd04134 Rho3 Rho3 subfamily.    99.0 7.6E-10 1.6E-14   65.6   4.8   38   13-58      1-38  (189)
 48 cd04176 Rap2 Rap2 subgroup.  T  99.0 5.7E-10 1.2E-14   64.0   4.2   40   13-60      2-41  (163)
 49 KOG0395|consensus               99.0 2.6E-10 5.5E-15   69.0   2.8   45   11-63      2-46  (196)
 50 PTZ00132 GTP-binding nuclear p  99.0 1.1E-09 2.5E-14   65.9   5.5   44    8-58      5-48  (215)
 51 cd01867 Rab8_Rab10_Rab13_like   99.0   1E-09 2.3E-14   63.4   4.8   36   11-52      2-37  (167)
 52 cd04175 Rap1 Rap1 subgroup.  T  99.0 8.2E-10 1.8E-14   63.5   4.2   38   13-58      2-39  (164)
 53 cd04130 Wrch_1 Wrch-1 subfamil  99.0 1.3E-09 2.7E-14   63.5   4.8   39   13-59      1-39  (173)
 54 cd01865 Rab3 Rab3 subfamily.    99.0 1.9E-09 4.2E-14   62.2   5.5   37   13-56      2-38  (165)
 55 cd01870 RhoA_like RhoA-like su  99.0 1.2E-09 2.5E-14   63.3   4.4   34   13-52      2-35  (175)
 56 KOG0081|consensus               99.0 3.2E-11 6.9E-16   71.9  -2.2   48    7-61      4-51  (219)
 57 cd04143 Rhes_like Rhes_like su  99.0 7.8E-10 1.7E-14   68.7   3.7   40   13-60      1-40  (247)
 58 cd04103 Centaurin_gamma Centau  98.9 1.3E-09 2.9E-14   63.3   4.4   32   13-50      1-32  (158)
 59 cd04135 Tc10 TC10 subfamily.    98.9 1.8E-09   4E-14   62.4   4.9   39   13-59      1-39  (174)
 60 cd04101 RabL4 RabL4 (Rab-like4  98.9 2.5E-09 5.3E-14   61.3   5.4   40   13-59      1-42  (164)
 61 cd04116 Rab9 Rab9 subfamily.    98.9 4.1E-09 8.9E-14   60.8   6.2   41   10-57      3-43  (170)
 62 cd01864 Rab19 Rab19 subfamily.  98.9 2.7E-09 5.8E-14   61.4   5.4   36   11-52      2-37  (165)
 63 cd04140 ARHI_like ARHI subfami  98.9 1.9E-09   4E-14   62.3   4.5   38   13-58      2-39  (165)
 64 cd04115 Rab33B_Rab33A Rab33B/R  98.9 3.3E-09   7E-14   61.6   5.5   40   12-58      2-41  (170)
 65 cd01869 Rab1_Ypt1 Rab1/Ypt1 su  98.9   3E-09 6.5E-14   61.2   5.2   39   12-57      2-40  (166)
 66 cd04106 Rab23_lke Rab23-like s  98.9 3.7E-09 7.9E-14   60.4   5.5   38   13-57      1-38  (162)
 67 smart00173 RAS Ras subfamily o  98.9 1.6E-09 3.5E-14   62.0   3.9   38   13-58      1-38  (164)
 68 cd04132 Rho4_like Rho4-like su  98.9 3.2E-09   7E-14   62.3   5.1   38   13-58      1-38  (187)
 69 cd04125 RabA_like RabA-like su  98.9 3.9E-09 8.5E-14   62.2   5.4   34   13-52      1-34  (188)
 70 cd04142 RRP22 RRP22 subfamily.  98.9   2E-09 4.3E-14   64.7   4.0   38   13-57      1-38  (198)
 71 COG1100 GTPase SAR1 and relate  98.9 4.3E-09 9.4E-14   63.0   5.2   34   13-52      6-39  (219)
 72 PLN03108 Rab family protein; P  98.9 4.3E-09 9.3E-14   63.5   5.1   40   10-56      4-43  (210)
 73 cd04145 M_R_Ras_like M-Ras/R-R  98.9 4.3E-09 9.4E-14   60.1   4.6   40   12-59      2-41  (164)
 74 cd04124 RabL2 RabL2 subfamily.  98.9 6.6E-09 1.4E-13   59.9   5.3   34   13-52      1-34  (161)
 75 KOG0088|consensus               98.9 1.3E-09 2.7E-14   65.1   2.3   55    5-65      6-68  (218)
 76 cd01866 Rab2 Rab2 subfamily.    98.9 6.9E-09 1.5E-13   60.1   5.4   37   10-52      2-38  (168)
 77 cd01868 Rab11_like Rab11-like.  98.9 7.1E-09 1.5E-13   59.5   5.3   36   11-52      2-37  (165)
 78 cd04144 Ras2 Ras2 subfamily.    98.9 2.4E-09 5.2E-14   63.4   3.3   37   14-58      1-37  (190)
 79 KOG0097|consensus               98.8 4.9E-09 1.1E-13   61.8   4.3   47    6-59      5-51  (215)
 80 cd04177 RSR1 RSR1 subgroup.  R  98.8 6.1E-09 1.3E-13   60.3   4.5   39   13-59      2-40  (168)
 81 cd04113 Rab4 Rab4 subfamily.    98.8 9.6E-09 2.1E-13   58.8   5.2   34   13-52      1-34  (161)
 82 cd04118 Rab24 Rab24 subfamily.  98.8 9.1E-09   2E-13   60.7   5.2   34   13-52      1-35  (193)
 83 cd04126 Rab20 Rab20 subfamily.  98.8 7.7E-09 1.7E-13   63.4   4.8   45   13-65      1-50  (220)
 84 cd04148 RGK RGK subfamily.  Th  98.8 6.4E-09 1.4E-13   63.4   4.2   34   13-52      1-35  (221)
 85 smart00174 RHO Rho (Ras homolo  98.8 8.2E-09 1.8E-13   59.7   4.4   38   15-60      1-38  (174)
 86 cd04150 Arf1_5_like Arf1-Arf5-  98.8 7.3E-09 1.6E-13   59.8   3.8   33   13-52      1-33  (159)
 87 cd04162 Arl9_Arfrp2_like Arl9/  98.8 6.2E-09 1.4E-13   60.5   3.0   32   15-52      2-33  (164)
 88 cd01862 Rab7 Rab7 subfamily.    98.8 1.9E-08 4.1E-13   57.8   5.0   34   13-52      1-34  (172)
 89 cd01860 Rab5_related Rab5-rela  98.8   2E-08 4.4E-13   57.3   5.1   35   12-52      1-35  (163)
 90 PTZ00133 ADP-ribosylation fact  98.8 9.2E-09   2E-13   60.8   3.7   35   11-52     16-50  (182)
 91 cd04146 RERG_RasL11_like RERG/  98.8 5.4E-09 1.2E-13   60.2   2.6   33   14-52      1-33  (165)
 92 cd04112 Rab26 Rab26 subfamily.  98.8 1.4E-08   3E-13   60.2   4.4   34   13-52      1-35  (191)
 93 smart00177 ARF ARF-like small   98.8 1.4E-08 3.1E-13   59.5   4.3   35   11-52     12-46  (175)
 94 cd04139 RalA_RalB RalA/RalB su  98.8 1.4E-08 2.9E-13   57.8   4.0   34   13-52      1-34  (164)
 95 KOG4252|consensus               98.7 2.3E-09 5.1E-14   65.0   0.6   50    8-64     16-65  (246)
 96 cd04129 Rho2 Rho2 subfamily.    98.7 2.1E-08 4.6E-13   59.2   4.6   38   13-58      2-39  (187)
 97 cd00157 Rho Rho (Ras homology)  98.7 2.7E-08   6E-13   57.1   5.0   40   13-60      1-40  (171)
 98 cd04114 Rab30 Rab30 subfamily.  98.7 5.2E-08 1.1E-12   56.0   6.1   41   10-57      5-45  (169)
 99 cd01861 Rab6 Rab6 subfamily.    98.7 3.1E-08 6.8E-13   56.4   5.1   34   13-52      1-34  (161)
100 PLN03118 Rab family protein; P  98.7 3.9E-08 8.6E-13   59.1   5.7   40    6-52      8-47  (211)
101 smart00175 RAB Rab subfamily o  98.7   4E-08 8.7E-13   56.0   5.3   34   13-52      1-34  (164)
102 TIGR02528 EutP ethanolamine ut  98.7 1.9E-08 4.2E-13   56.6   3.8   36   14-58      2-37  (142)
103 smart00010 small_GTPase Small   98.7 9.4E-09   2E-13   56.3   2.4   34   13-52      1-35  (124)
104 cd04147 Ras_dva Ras-dva subfam  98.7 1.4E-08 2.9E-13   60.6   3.3   33   14-52      1-33  (198)
105 cd04149 Arf6 Arf6 subfamily.    98.7 2.5E-08 5.4E-13   58.2   4.0   35   11-52      8-42  (168)
106 PLN00223 ADP-ribosylation fact  98.7 2.8E-08   6E-13   58.8   3.9   35   11-52     16-50  (181)
107 cd04137 RheB Rheb (Ras Homolog  98.6 4.3E-08 9.3E-13   57.1   4.1   34   13-52      2-35  (180)
108 cd00154 Rab Rab family.  Rab G  98.6   1E-07 2.2E-12   53.4   5.1   34   13-52      1-34  (159)
109 cd04158 ARD1 ARD1 subfamily.    98.6 5.2E-08 1.1E-12   56.6   4.1   32   14-52      1-32  (169)
110 cd04152 Arl4_Arl7 Arl4/Arl7 su  98.6 5.9E-08 1.3E-12   57.2   4.2   34   12-52      3-36  (183)
111 cd01863 Rab18 Rab18 subfamily.  98.6 8.1E-08 1.8E-12   54.8   4.6   34   13-52      1-34  (161)
112 cd04159 Arl10_like Arl10-like   98.6 5.4E-08 1.2E-12   54.6   3.7   32   15-52      2-33  (159)
113 cd01893 Miro1 Miro1 subfamily.  98.6 6.2E-08 1.4E-12   56.0   4.0   28   14-47      2-29  (166)
114 cd04157 Arl6 Arl6 subfamily.    98.6 7.4E-08 1.6E-12   54.8   3.7   33   14-52      1-34  (162)
115 smart00176 RAN Ran (Ras-relate  98.6 9.2E-08   2E-12   57.8   4.1   35   18-59      1-35  (200)
116 cd00876 Ras Ras family.  The R  98.6 8.8E-08 1.9E-12   54.2   3.6   33   14-52      1-33  (160)
117 cd04123 Rab21 Rab21 subfamily.  98.5 1.9E-07 4.2E-12   52.8   4.8   34   13-52      1-34  (162)
118 PF08477 Miro:  Miro-like prote  98.5 2.6E-07 5.6E-12   50.6   4.6   18   14-31      1-18  (119)
119 cd04154 Arl2 Arl2 subfamily.    98.5 2.1E-07 4.6E-12   54.1   4.2   37    9-52     11-47  (173)
120 cd04155 Arl3 Arl3 subfamily.    98.5 1.1E-07 2.3E-12   55.0   2.8   22   10-31     12-33  (173)
121 cd04161 Arl2l1_Arl13_like Arl2  98.5 1.6E-07 3.5E-12   54.6   3.3   32   14-52      1-32  (167)
122 TIGR00231 small_GTP small GTP-  98.5 4.7E-07   1E-11   50.2   5.1   34   13-52      2-35  (161)
123 cd04151 Arl1 Arl1 subfamily.    98.5 2.2E-07 4.8E-12   53.2   3.5   32   14-52      1-32  (158)
124 smart00178 SAR Sar1p-like memb  98.4 4.8E-07   1E-11   53.5   4.6   22   10-31     15-36  (184)
125 PRK04213 GTP-binding protein;   98.4 1.1E-06 2.5E-11   52.1   5.5   34   10-49      7-40  (201)
126 cd04160 Arfrp1 Arfrp1 subfamil  98.4 5.7E-07 1.2E-11   51.6   3.9   38   14-52      1-39  (167)
127 cd04156 ARLTS1 ARLTS1 subfamil  98.4 4.9E-07 1.1E-11   51.5   3.7   32   14-52      1-32  (160)
128 PRK00454 engB GTP-binding prot  98.4 7.3E-07 1.6E-11   52.4   4.2   24    8-31     20-43  (196)
129 cd04153 Arl5_Arl8 Arl5/Arl8 su  98.3 6.4E-07 1.4E-11   52.3   3.7   34   12-52     15-48  (174)
130 cd00879 Sar1 Sar1 subfamily.    98.3 4.2E-07 9.1E-12   53.4   2.7   36   10-52     17-52  (190)
131 KOG0096|consensus               98.3 8.3E-07 1.8E-11   54.1   3.7   42   10-58      8-49  (216)
132 cd00878 Arf_Arl Arf (ADP-ribos  98.3 9.3E-07   2E-11   50.3   3.5   32   14-52      1-32  (158)
133 cd01878 HflX HflX subfamily.    98.2 2.8E-06 6.2E-11   50.5   4.6   21   11-31     40-60  (204)
134 TIGR03598 GTPase_YsxC ribosome  98.2 2.6E-06 5.7E-11   50.0   4.2   23    9-31     15-37  (179)
135 cd04105 SR_beta Signal recogni  98.2 3.8E-06 8.2E-11   50.7   4.7   31   14-50      2-32  (203)
136 KOG0083|consensus               98.1 3.6E-07 7.8E-12   53.5  -0.4   33   17-56      2-35  (192)
137 PF00025 Arf:  ADP-ribosylation  98.1 3.2E-06 6.9E-11   49.8   3.5   36   10-52     12-47  (175)
138 cd01897 NOG NOG1 is a nucleola  98.1 9.2E-06   2E-10   46.5   5.1   18   14-31      2-19  (168)
139 KOG1673|consensus               98.1 1.9E-06   4E-11   51.5   1.8   49    8-63     16-64  (205)
140 cd01850 CDC_Septin CDC/Septin.  98.1 1.2E-05 2.7E-10   50.7   5.6   21   11-31      3-23  (276)
141 cd01876 YihA_EngB The YihA (En  98.0 6.5E-06 1.4E-10   46.4   3.3   18   14-31      1-18  (170)
142 cd01898 Obg Obg subfamily.  Th  98.0 9.5E-06 2.1E-10   46.5   4.0   18   14-31      2-19  (170)
143 KOG4423|consensus               98.0 3.8E-07 8.1E-12   55.7  -2.7   41    9-56     22-62  (229)
144 COG1419 FlhF Flagellar GTP-bin  97.9   7E-07 1.5E-11   59.2  -2.0   20   12-31    203-222 (407)
145 cd04104 p47_IIGP_like p47 (47-  97.9 1.3E-05 2.8E-10   48.0   2.9   19   13-31      2-20  (197)
146 cd01896 DRG The developmentall  97.9 4.9E-05 1.1E-09   46.9   5.2   18   14-31      2-19  (233)
147 KOG1707|consensus               97.8 2.1E-05 4.6E-10   54.3   3.5   31   10-46      7-37  (625)
148 cd04171 SelB SelB subfamily.    97.8 4.3E-05 9.2E-10   43.3   4.2   18   14-31      2-19  (164)
149 cd01891 TypA_BipA TypA (tyrosi  97.8 3.7E-05 8.1E-10   45.6   4.0   19   13-31      3-21  (194)
150 cd04164 trmE TrmE (MnmE, ThdF,  97.8 7.9E-05 1.7E-09   41.7   4.7   19   13-31      2-20  (157)
151 cd01887 IF2_eIF5B IF2/eIF5B (i  97.7 7.2E-05 1.6E-09   42.6   4.2   18   14-31      2-19  (168)
152 TIGR00450 mnmE_trmE_thdF tRNA   97.7 9.6E-05 2.1E-09   49.5   5.3   21   11-31    202-222 (442)
153 TIGR03156 GTP_HflX GTP-binding  97.7 9.6E-05 2.1E-09   48.2   4.8   21   11-31    188-208 (351)
154 PRK15494 era GTPase Era; Provi  97.7 9.9E-05 2.1E-09   47.8   4.9   21   11-31     51-71  (339)
155 PF00448 SRP54:  SRP54-type pro  97.7 2.2E-05 4.8E-10   47.5   1.6   19   13-31      2-20  (196)
156 TIGR00991 3a0901s02IAP34 GTP-b  97.7 0.00016 3.4E-09   46.9   5.5   22   10-31     36-57  (313)
157 cd01881 Obg_like The Obg-like   97.7 4.4E-05 9.6E-10   43.7   2.7   15   17-31      1-15  (176)
158 cd01853 Toc34_like Toc34-like   97.6 0.00014 3.1E-09   45.5   5.0   22   10-31     29-50  (249)
159 PRK11058 GTPase HflX; Provisio  97.6 0.00012 2.6E-09   48.9   4.6   19   13-31    198-216 (426)
160 PF10662 PduV-EutP:  Ethanolami  97.6 0.00013 2.8E-09   42.6   4.0   19   13-31      2-20  (143)
161 cd04163 Era Era subfamily.  Er  97.6 7.8E-05 1.7E-09   41.8   3.0   20   12-31      3-22  (168)
162 cd01879 FeoB Ferrous iron tran  97.6 5.6E-05 1.2E-09   42.6   2.2   15   17-31      1-15  (158)
163 KOG3883|consensus               97.5 0.00018 3.9E-09   43.0   4.0   46   11-62      8-53  (198)
164 cd01895 EngA2 EngA2 subfamily.  97.5 9.9E-05 2.1E-09   41.8   2.5   20   12-31      2-21  (174)
165 TIGR02729 Obg_CgtA Obg family   97.5 0.00032   7E-09   45.4   5.0   52   13-65    158-211 (329)
166 PF03193 DUF258:  Protein of un  97.5 0.00011 2.4E-09   43.5   2.6   18   14-31     37-54  (161)
167 COG3839 MalK ABC-type sugar tr  97.4  0.0001 2.2E-09   48.2   2.3   17   15-31     32-48  (338)
168 cd01889 SelB_euk SelB subfamil  97.4 0.00024 5.2E-09   42.0   3.7   19   13-31      1-19  (192)
169 PF02421 FeoB_N:  Ferrous iron   97.4 0.00027 5.9E-09   41.6   3.8   31   13-44      1-31  (156)
170 PF01926 MMR_HSR1:  50S ribosom  97.4 0.00013 2.9E-09   39.9   2.3   18   14-31      1-18  (116)
171 cd01899 Ygr210 Ygr210 subfamil  97.4 0.00027 5.9E-09   45.7   4.0   37   15-52      1-38  (318)
172 COG1116 TauB ABC-type nitrate/  97.4 0.00013 2.7E-09   46.0   2.3   18   14-31     31-48  (248)
173 PRK08118 topology modulation p  97.4 0.00017 3.7E-09   42.5   2.7   19   13-31      2-20  (167)
174 cd01894 EngA1 EngA1 subfamily.  97.4 0.00026 5.6E-09   39.7   3.2   16   16-31      1-16  (157)
175 PRK09602 translation-associate  97.3 0.00057 1.2E-08   45.4   5.1   39   13-52      2-41  (396)
176 cd00882 Ras_like_GTPase Ras-li  97.3 0.00017 3.7E-09   39.2   2.2   15   17-31      1-15  (157)
177 PF13207 AAA_17:  AAA domain; P  97.3 0.00018 3.8E-09   39.5   2.3   18   14-31      1-18  (121)
178 cd04165 GTPBP1_like GTPBP1-lik  97.3 0.00016 3.5E-09   44.4   2.3   18   14-31      1-18  (224)
179 PRK00093 GTP-binding protein D  97.3 0.00046 9.9E-09   45.5   4.4   19   13-31      2-20  (435)
180 PRK07261 topology modulation p  97.3 0.00023 4.9E-09   42.0   2.7   18   14-31      2-19  (171)
181 PRK03003 GTP-binding protein D  97.3 0.00041 8.8E-09   46.6   4.1   21   11-31    210-230 (472)
182 TIGR00436 era GTP-binding prot  97.3 0.00061 1.3E-08   42.6   4.4   18   14-31      2-19  (270)
183 cd00881 GTP_translation_factor  97.3 0.00022 4.9E-09   41.1   2.3   18   14-31      1-18  (189)
184 PF09439 SRPRB:  Signal recogni  97.3 0.00022 4.8E-09   43.0   2.2   19   13-31      4-22  (181)
185 PRK05291 trmE tRNA modificatio  97.2 0.00058 1.3E-08   45.8   4.4   21   11-31    214-234 (449)
186 COG0563 Adk Adenylate kinase a  97.2 0.00023 4.9E-09   42.6   2.2   18   14-31      2-19  (178)
187 PF00735 Septin:  Septin;  Inte  97.2 0.00026 5.6E-09   45.0   2.5   21   11-31      3-23  (281)
188 cd01856 YlqF YlqF.  Proteins o  97.2  0.0008 1.7E-08   39.4   4.3   21   11-31    114-134 (171)
189 PRK10078 ribose 1,5-bisphospho  97.2 0.00035 7.5E-09   41.5   2.7   18   14-31      4-21  (186)
190 cd01890 LepA LepA subfamily.    97.2 0.00022 4.8E-09   41.2   1.8   18   14-31      2-19  (179)
191 COG3842 PotA ABC-type spermidi  97.2 0.00027 5.9E-09   46.4   2.3   17   15-31     34-50  (352)
192 PF04548 AIG1:  AIG1 family;  I  97.2 0.00074 1.6E-08   41.0   4.1   19   13-31      1-19  (212)
193 smart00382 AAA ATPases associa  97.2 0.00041 8.9E-09   37.4   2.7   19   13-31      3-21  (148)
194 cd01857 HSR1_MMR1 HSR1/MMR1.    97.2 0.00042 9.2E-09   39.4   2.7   18   14-31     85-102 (141)
195 PRK15467 ethanolamine utilizat  97.2 0.00043 9.4E-09   40.1   2.7   18   14-31      3-20  (158)
196 PRK12296 obgE GTPase CgtA; Rev  97.2   0.001 2.2E-08   45.5   4.8   52   13-65    160-212 (500)
197 TIGR03594 GTPase_EngA ribosome  97.1 0.00078 1.7E-08   44.3   4.0   18   14-31      1-18  (429)
198 KOG0070|consensus               97.1 0.00034 7.4E-09   42.2   2.1   36   10-52     15-50  (181)
199 COG1126 GlnQ ABC-type polar am  97.1 0.00042 9.1E-09   43.3   2.6   17   14-30     30-46  (240)
200 PRK14738 gmk guanylate kinase;  97.1 0.00079 1.7E-08   40.7   3.7   21   11-31     12-32  (206)
201 COG4525 TauB ABC-type taurine   97.1 0.00055 1.2E-08   42.6   3.0   18   14-31     33-50  (259)
202 cd01852 AIG1 AIG1 (avrRpt2-ind  97.1  0.0013 2.9E-08   39.1   4.7   19   13-31      1-19  (196)
203 cd03238 ABC_UvrA The excision   97.1 0.00047   1E-08   41.1   2.6   19   13-31     22-40  (176)
204 PRK09518 bifunctional cytidyla  97.1 0.00076 1.6E-08   47.5   3.9   20   12-31    450-469 (712)
205 PF00004 AAA:  ATPase family as  97.1 0.00052 1.1E-08   37.7   2.5   17   15-31      1-17  (132)
206 PF07728 AAA_5:  AAA domain (dy  97.1 0.00033 7.1E-09   39.4   1.6   17   15-31      2-18  (139)
207 PF13671 AAA_33:  AAA domain; P  97.1 0.00042 9.2E-09   38.8   2.0   17   15-31      2-18  (143)
208 cd00071 GMPK Guanosine monopho  97.1 0.00054 1.2E-08   39.1   2.5   17   15-31      2-18  (137)
209 PRK03003 GTP-binding protein D  97.1  0.0013 2.9E-08   44.2   4.7   20   12-31     38-57  (472)
210 cd01859 MJ1464 MJ1464.  This f  97.1  0.0014   3E-08   37.6   4.2   21   11-31    100-120 (156)
211 COG1136 SalX ABC-type antimicr  97.1 0.00049 1.1E-08   42.8   2.4   18   14-31     33-50  (226)
212 PRK09554 feoB ferrous iron tra  97.0  0.0017 3.6E-08   46.4   5.3   20   12-31      3-22  (772)
213 PRK14737 gmk guanylate kinase;  97.0 0.00054 1.2E-08   41.1   2.5   19   13-31      5-23  (186)
214 PF13191 AAA_16:  AAA ATPase do  97.0 0.00042 9.1E-09   40.2   2.0   19   13-31     25-43  (185)
215 TIGR02322 phosphon_PhnN phosph  97.0 0.00059 1.3E-08   40.0   2.5   18   14-31      3-20  (179)
216 COG0194 Gmk Guanylate kinase [  97.0 0.00065 1.4E-08   41.3   2.7   19   13-31      5-23  (191)
217 cd00820 PEPCK_HprK Phosphoenol  97.0 0.00059 1.3E-08   38.0   2.3   18   14-31     17-34  (107)
218 cd00009 AAA The AAA+ (ATPases   97.0 0.00069 1.5E-08   37.0   2.5   19   13-31     20-38  (151)
219 KOG0073|consensus               97.0  0.0018 3.8E-08   39.0   4.3   36   10-52     14-49  (185)
220 TIGR03263 guanyl_kin guanylate  97.0 0.00069 1.5E-08   39.6   2.5   18   14-31      3-20  (180)
221 TIGR03594 GTPase_EngA ribosome  97.0  0.0027   6E-08   41.7   5.5   21   11-31    171-191 (429)
222 PF13521 AAA_28:  AAA domain; P  97.0 0.00069 1.5E-08   39.2   2.3   18   14-31      1-18  (163)
223 PRK12297 obgE GTPase CgtA; Rev  97.0  0.0023   5E-08   43.0   5.0   18   14-31    160-177 (424)
224 TIGR03499 FlhF flagellar biosy  97.0 0.00067 1.4E-08   43.0   2.4   20   12-31    194-213 (282)
225 PF13555 AAA_29:  P-loop contai  96.9  0.0008 1.7E-08   34.1   2.3   18   14-31     25-42  (62)
226 PF00005 ABC_tran:  ABC transpo  96.9 0.00065 1.4E-08   37.9   2.1   18   14-31     13-30  (137)
227 PF13401 AAA_22:  AAA domain; P  96.9 0.00044 9.6E-09   38.2   1.4   18   14-31      6-23  (131)
228 PRK06217 hypothetical protein;  96.9 0.00087 1.9E-08   39.6   2.7   19   13-31      2-20  (183)
229 PRK11889 flhF flagellar biosyn  96.9 0.00085 1.8E-08   45.2   2.8   19   13-31    242-260 (436)
230 PF05729 NACHT:  NACHT domain    96.9 0.00067 1.5E-08   38.4   2.1   17   15-31      3-19  (166)
231 PRK00089 era GTPase Era; Revie  96.9  0.0013 2.9E-08   41.3   3.5   21   11-31      4-24  (292)
232 PF04665 Pox_A32:  Poxvirus A32  96.9 0.00083 1.8E-08   42.1   2.4   22   10-31     11-32  (241)
233 COG1162 Predicted GTPases [Gen  96.9 0.00081 1.8E-08   43.4   2.3   18   14-31    166-183 (301)
234 COG1117 PstB ABC-type phosphat  96.9 0.00074 1.6E-08   42.3   2.0   17   15-31     36-52  (253)
235 PRK00300 gmk guanylate kinase;  96.9 0.00093   2E-08   39.8   2.4   19   13-31      6-24  (205)
236 cd01858 NGP_1 NGP-1.  Autoanti  96.8  0.0011 2.5E-08   38.1   2.6   20   12-31    102-121 (157)
237 PRK12288 GTPase RsgA; Reviewed  96.8   0.001 2.2E-08   43.5   2.5   17   15-31    208-224 (347)
238 PF13173 AAA_14:  AAA domain     96.8 0.00095 2.1E-08   37.4   2.0   18   14-31      4-21  (128)
239 COG1120 FepC ABC-type cobalami  96.8  0.0011 2.3E-08   42.0   2.3   17   15-31     31-47  (258)
240 COG3638 ABC-type phosphate/pho  96.8  0.0016 3.4E-08   41.2   3.0   17   15-31     33-49  (258)
241 PF03266 NTPase_1:  NTPase;  In  96.8  0.0014   3E-08   38.9   2.6   18   14-31      1-18  (168)
242 PF01637 Arch_ATPase:  Archaeal  96.8 0.00082 1.8E-08   39.9   1.7   19   13-31     21-39  (234)
243 PRK05541 adenylylsulfate kinas  96.8  0.0023   5E-08   37.4   3.6   20   12-31      7-26  (176)
244 PRK12726 flagellar biosynthesi  96.8  0.0011 2.4E-08   44.3   2.4   20   12-31    206-225 (407)
245 cd03255 ABC_MJ0796_Lo1CDE_FtsE  96.8  0.0013 2.9E-08   39.6   2.6   18   14-31     32-49  (218)
246 PRK12299 obgE GTPase CgtA; Rev  96.8  0.0037 7.9E-08   40.7   4.7   52   13-65    159-212 (335)
247 PRK05480 uridine/cytidine kina  96.8  0.0019 4.1E-08   38.8   3.2   21   11-31      5-25  (209)
248 TIGR03596 GTPase_YlqF ribosome  96.7  0.0033 7.2E-08   39.6   4.4   21   11-31    117-137 (276)
249 PF04670 Gtr1_RagA:  Gtr1/RagA   96.7  0.0024 5.2E-08   39.8   3.6   18   14-31      1-18  (232)
250 TIGR00487 IF-2 translation ini  96.7  0.0043 9.3E-08   43.1   5.1   21   11-31     86-106 (587)
251 PRK12723 flagellar biosynthesi  96.7   0.002 4.3E-08   42.8   3.3   19   13-31    175-193 (388)
252 PHA00729 NTP-binding motif con  96.7  0.0018 3.9E-08   40.3   2.9   19   13-31     18-36  (226)
253 TIGR01313 therm_gnt_kin carboh  96.7  0.0012 2.5E-08   38.2   2.0   17   15-31      1-17  (163)
254 PF00625 Guanylate_kin:  Guanyl  96.7  0.0015 3.3E-08   38.6   2.5   18   14-31      4-21  (183)
255 smart00072 GuKc Guanylate kina  96.7  0.0015 3.3E-08   38.7   2.5   18   14-31      4-21  (184)
256 TIGR00960 3a0501s02 Type II (G  96.7  0.0016 3.4E-08   39.2   2.6   18   14-31     31-48  (216)
257 TIGR00157 ribosome small subun  96.7  0.0015 3.2E-08   40.7   2.5   18   14-31    122-139 (245)
258 cd03226 ABC_cobalt_CbiO_domain  96.7  0.0016 3.5E-08   38.9   2.6   18   14-31     28-45  (205)
259 PRK10416 signal recognition pa  96.7  0.0015 3.4E-08   42.2   2.6   20   12-31    114-133 (318)
260 PF07724 AAA_2:  AAA domain (Cd  96.7   0.002 4.3E-08   38.2   2.9   20   12-31      3-22  (171)
261 COG1125 OpuBA ABC-type proline  96.7  0.0014   3E-08   42.1   2.3   17   14-30     29-45  (309)
262 TIGR02315 ABC_phnC phosphonate  96.7  0.0017 3.6E-08   39.7   2.6   18   14-31     30-47  (243)
263 PF13238 AAA_18:  AAA domain; P  96.7  0.0014   3E-08   35.8   2.0   17   15-31      1-17  (129)
264 cd04167 Snu114p Snu114p subfam  96.7  0.0013 2.8E-08   39.7   2.0   18   14-31      2-19  (213)
265 TIGR00101 ureG urease accessor  96.7   0.002 4.3E-08   39.0   2.8   19   13-31      2-20  (199)
266 cd03225 ABC_cobalt_CbiO_domain  96.7  0.0018 3.9E-08   38.8   2.6   18   14-31     29-46  (211)
267 cd04178 Nucleostemin_like Nucl  96.7  0.0039 8.5E-08   37.0   4.0   20   12-31    117-136 (172)
268 cd03264 ABC_drug_resistance_li  96.7  0.0016 3.4E-08   39.1   2.3   18   14-31     27-44  (211)
269 cd03269 ABC_putative_ATPase Th  96.6  0.0018   4E-08   38.8   2.6   18   14-31     28-45  (210)
270 TIGR03015 pepcterm_ATPase puta  96.6  0.0017 3.6E-08   40.0   2.5   18   14-31     45-62  (269)
271 TIGR00235 udk uridine kinase.   96.6  0.0026 5.6E-08   38.3   3.2   20   12-31      6-25  (207)
272 cd03292 ABC_FtsE_transporter F  96.6  0.0019 4.1E-08   38.7   2.6   18   14-31     29-46  (214)
273 cd03224 ABC_TM1139_LivF_branch  96.6  0.0019 4.1E-08   38.9   2.6   18   14-31     28-45  (222)
274 PF12775 AAA_7:  P-loop contain  96.6   0.002 4.3E-08   40.8   2.8   19   13-31     34-52  (272)
275 PRK13695 putative NTPase; Prov  96.6   0.002 4.3E-08   37.7   2.6   19   13-31      1-19  (174)
276 PRK12289 GTPase RsgA; Reviewed  96.6  0.0016 3.4E-08   42.8   2.3   17   15-31    175-191 (352)
277 PRK14722 flhF flagellar biosyn  96.6  0.0019 4.1E-08   42.8   2.7   20   12-31    137-156 (374)
278 cd03257 ABC_NikE_OppD_transpor  96.6   0.002 4.2E-08   39.0   2.6   18   14-31     33-50  (228)
279 TIGR01166 cbiO cobalt transpor  96.6  0.0018 3.9E-08   38.3   2.4   18   14-31     20-37  (190)
280 cd03261 ABC_Org_Solvent_Resist  96.6   0.002 4.3E-08   39.3   2.6   18   14-31     28-45  (235)
281 TIGR03608 L_ocin_972_ABC putat  96.6  0.0021 4.5E-08   38.3   2.6   18   14-31     26-43  (206)
282 cd03262 ABC_HisP_GlnQ_permease  96.6  0.0021 4.5E-08   38.5   2.6   18   14-31     28-45  (213)
283 cd03222 ABC_RNaseL_inhibitor T  96.6  0.0021 4.6E-08   38.4   2.6   18   14-31     27-44  (177)
284 PRK06893 DNA replication initi  96.6  0.0019 4.1E-08   39.7   2.3   18   14-31     41-58  (229)
285 cd03260 ABC_PstB_phosphate_tra  96.6  0.0022 4.7E-08   38.9   2.6   18   14-31     28-45  (227)
286 cd03259 ABC_Carb_Solutes_like   96.6  0.0022 4.7E-08   38.5   2.6   18   14-31     28-45  (213)
287 TIGR02673 FtsE cell division A  96.6  0.0022 4.8E-08   38.5   2.6   18   14-31     30-47  (214)
288 cd03265 ABC_DrrA DrrA is the A  96.6  0.0022 4.8E-08   38.7   2.6   18   14-31     28-45  (220)
289 TIGR03420 DnaA_homol_Hda DnaA   96.6  0.0021 4.5E-08   38.7   2.5   19   13-31     39-57  (226)
290 PRK09563 rbgA GTPase YlqF; Rev  96.6  0.0052 1.1E-07   39.0   4.4   21   11-31    120-140 (287)
291 cd03235 ABC_Metallic_Cations A  96.6  0.0022 4.8E-08   38.5   2.6   18   14-31     27-44  (213)
292 PRK05057 aroK shikimate kinase  96.6  0.0025 5.3E-08   37.6   2.7   19   13-31      5-23  (172)
293 TIGR01360 aden_kin_iso1 adenyl  96.6  0.0022 4.8E-08   37.4   2.5   18   14-31      5-22  (188)
294 cd03266 ABC_NatA_sodium_export  96.6  0.0023   5E-08   38.5   2.6   18   14-31     33-50  (218)
295 TIGR02211 LolD_lipo_ex lipopro  96.5  0.0023   5E-08   38.6   2.6   18   14-31     33-50  (221)
296 PRK03839 putative kinase; Prov  96.5  0.0024 5.2E-08   37.5   2.6   18   14-31      2-19  (180)
297 PF13479 AAA_24:  AAA domain     96.5  0.0026 5.7E-08   38.7   2.8   20   12-31      3-22  (213)
298 cd03293 ABC_NrtD_SsuB_transpor  96.5  0.0024 5.2E-08   38.6   2.6   18   14-31     32-49  (220)
299 cd03219 ABC_Mj1267_LivG_branch  96.5  0.0023 5.1E-08   38.9   2.6   18   14-31     28-45  (236)
300 cd03256 ABC_PhnC_transporter A  96.5  0.0024 5.1E-08   38.9   2.6   18   14-31     29-46  (241)
301 cd03218 ABC_YhbG The ABC trans  96.5  0.0024 5.2E-08   38.8   2.6   18   14-31     28-45  (232)
302 PRK09183 transposase/IS protei  96.5  0.0021 4.5E-08   40.4   2.3   19   13-31    103-121 (259)
303 TIGR01978 sufC FeS assembly AT  96.5  0.0024 5.3E-08   38.9   2.6   18   14-31     28-45  (243)
304 PRK14530 adenylate kinase; Pro  96.5  0.0026 5.7E-08   38.5   2.7   18   14-31      5-22  (215)
305 PRK14721 flhF flagellar biosyn  96.5  0.0024 5.3E-08   42.8   2.7   20   12-31    191-210 (420)
306 TIGR02868 CydC thiol reductant  96.5  0.0023 4.9E-08   43.2   2.6   19   13-31    362-380 (529)
307 cd02023 UMPK Uridine monophosp  96.5  0.0025 5.4E-08   37.9   2.5   17   15-31      2-18  (198)
308 TIGR00064 ftsY signal recognit  96.5  0.0028 6.1E-08   40.1   2.8   19   13-31     73-91  (272)
309 cd03263 ABC_subfamily_A The AB  96.5  0.0026 5.6E-08   38.3   2.6   18   14-31     30-47  (220)
310 PRK15177 Vi polysaccharide exp  96.5  0.0025 5.5E-08   38.6   2.6   18   14-31     15-32  (213)
311 PRK11629 lolD lipoprotein tran  96.5  0.0026 5.6E-08   38.8   2.6   18   14-31     37-54  (233)
312 PRK08084 DNA replication initi  96.5  0.0025 5.5E-08   39.3   2.6   19   13-31     46-64  (235)
313 cd03301 ABC_MalK_N The N-termi  96.5  0.0027 5.8E-08   38.1   2.6   18   14-31     28-45  (213)
314 PRK11248 tauB taurine transpor  96.5  0.0026 5.7E-08   39.5   2.6   18   14-31     29-46  (255)
315 PRK11247 ssuB aliphatic sulfon  96.5  0.0027 5.8E-08   39.7   2.6   18   14-31     40-57  (257)
316 cd02019 NK Nucleoside/nucleoti  96.5  0.0033 7.2E-08   31.9   2.5   17   15-31      2-18  (69)
317 PRK00098 GTPase RsgA; Reviewed  96.5  0.0025 5.5E-08   40.6   2.5   18   14-31    166-183 (298)
318 PRK13949 shikimate kinase; Pro  96.5  0.0029 6.3E-08   37.3   2.6   18   14-31      3-20  (169)
319 TIGR03410 urea_trans_UrtE urea  96.5  0.0029 6.2E-08   38.4   2.6   18   14-31     28-45  (230)
320 cd03258 ABC_MetN_methionine_tr  96.5  0.0029 6.2E-08   38.5   2.6   18   14-31     33-50  (233)
321 cd03216 ABC_Carb_Monos_I This   96.5   0.003 6.6E-08   36.8   2.6   18   14-31     28-45  (163)
322 PRK14532 adenylate kinase; Pro  96.5  0.0029 6.4E-08   37.3   2.6   18   14-31      2-19  (188)
323 PRK06526 transposase; Provisio  96.5  0.0023 5.1E-08   40.2   2.2   19   13-31     99-117 (254)
324 cd03268 ABC_BcrA_bacitracin_re  96.4  0.0026 5.6E-08   38.1   2.4   18   14-31     28-45  (208)
325 TIGR02881 spore_V_K stage V sp  96.4  0.0032   7E-08   39.2   2.8   21   11-31     41-61  (261)
326 cd01131 PilT Pilus retraction   96.4  0.0028 6.2E-08   38.1   2.5   17   15-31      4-20  (198)
327 PRK10895 lipopolysaccharide AB  96.4  0.0029 6.4E-08   38.7   2.6   18   14-31     31-48  (241)
328 PRK10908 cell division protein  96.4   0.003 6.5E-08   38.2   2.6   18   14-31     30-47  (222)
329 PRK12724 flagellar biosynthesi  96.4  0.0023   5E-08   43.2   2.2   19   13-31    224-242 (432)
330 PRK13540 cytochrome c biogenes  96.4   0.003 6.6E-08   37.7   2.6   18   14-31     29-46  (200)
331 TIGR03864 PQQ_ABC_ATP ABC tran  96.4   0.003 6.6E-08   38.6   2.6   18   14-31     29-46  (236)
332 PRK09087 hypothetical protein;  96.4  0.0027 5.9E-08   39.1   2.4   18   14-31     46-63  (226)
333 cd03233 ABC_PDR_domain1 The pl  96.4  0.0031 6.7E-08   37.9   2.6   18   14-31     35-52  (202)
334 COG0218 Predicted GTPase [Gene  96.4  0.0032 6.9E-08   38.6   2.6   24    8-31     20-43  (200)
335 PRK08181 transposase; Validate  96.4  0.0025 5.4E-08   40.4   2.2   19   13-31    107-125 (269)
336 cd03214 ABC_Iron-Siderophores_  96.4  0.0033 7.1E-08   37.1   2.6   18   14-31     27-44  (180)
337 cd03297 ABC_ModC_molybdenum_tr  96.4  0.0031 6.8E-08   37.9   2.6   19   13-31     24-42  (214)
338 cd03237 ABC_RNaseL_inhibitor_d  96.4  0.0031 6.7E-08   39.2   2.6   18   14-31     27-44  (246)
339 cd03229 ABC_Class3 This class   96.4  0.0033 7.2E-08   37.0   2.6   18   14-31     28-45  (178)
340 TIGR01189 ccmA heme ABC export  96.4  0.0033 7.1E-08   37.5   2.6   18   14-31     28-45  (198)
341 PRK08903 DnaA regulatory inact  96.4  0.0028 6.1E-08   38.4   2.3   18   14-31     44-61  (227)
342 cd03296 ABC_CysA_sulfate_impor  96.4  0.0032   7E-08   38.5   2.6   18   14-31     30-47  (239)
343 cd03298 ABC_ThiQ_thiamine_tran  96.4  0.0033 7.1E-08   37.7   2.6   18   14-31     26-43  (211)
344 cd03230 ABC_DR_subfamily_A Thi  96.4  0.0035 7.5E-08   36.7   2.6   18   14-31     28-45  (173)
345 PRK13638 cbiO cobalt transport  96.4  0.0032   7E-08   39.3   2.6   18   14-31     29-46  (271)
346 PRK14242 phosphate transporter  96.4  0.0033 7.2E-08   38.7   2.6   18   14-31     34-51  (253)
347 PRK13541 cytochrome c biogenes  96.4  0.0034 7.3E-08   37.4   2.6   18   14-31     28-45  (195)
348 cd01120 RecA-like_NTPases RecA  96.4  0.0032 6.9E-08   35.3   2.3   17   15-31      2-18  (165)
349 cd03272 ABC_SMC3_euk Eukaryoti  96.4  0.0029 6.3E-08   38.7   2.3   18   14-31     25-42  (243)
350 PRK10584 putative ABC transpor  96.4  0.0034 7.3E-08   38.1   2.6   18   14-31     38-55  (228)
351 PRK02496 adk adenylate kinase;  96.4   0.004 8.7E-08   36.6   2.8   19   13-31      2-20  (184)
352 PRK08233 hypothetical protein;  96.4  0.0041 8.9E-08   36.1   2.9   19   13-31      4-22  (182)
353 PRK11124 artP arginine transpo  96.4  0.0034 7.3E-08   38.4   2.6   18   14-31     30-47  (242)
354 PRK10247 putative ABC transpor  96.4  0.0034 7.4E-08   38.2   2.6   18   14-31     35-52  (225)
355 TIGR02323 CP_lyasePhnK phospho  96.4  0.0033 7.3E-08   38.7   2.6   18   14-31     31-48  (253)
356 cd03278 ABC_SMC_barmotin Barmo  96.4   0.003 6.6E-08   38.0   2.3   18   14-31     24-41  (197)
357 cd03273 ABC_SMC2_euk Eukaryoti  96.4  0.0032 6.9E-08   38.9   2.5   18   14-31     27-44  (251)
358 cd03232 ABC_PDR_domain2 The pl  96.4  0.0035 7.7E-08   37.3   2.6   18   14-31     35-52  (192)
359 PRK08727 hypothetical protein;  96.4  0.0031 6.6E-08   38.9   2.4   17   15-31     44-60  (233)
360 PRK14247 phosphate ABC transpo  96.4  0.0035 7.5E-08   38.6   2.6   18   14-31     31-48  (250)
361 COG4161 ArtP ABC-type arginine  96.4  0.0029 6.4E-08   38.6   2.2   18   14-31     30-47  (242)
362 cd01849 YlqF_related_GTPase Yl  96.4    0.01 2.2E-07   34.1   4.4   21   11-31     99-119 (155)
363 PRK05642 DNA replication initi  96.4  0.0031 6.7E-08   38.9   2.4   19   13-31     46-64  (234)
364 PRK13538 cytochrome c biogenes  96.4  0.0036 7.8E-08   37.5   2.6   18   14-31     29-46  (204)
365 PRK13539 cytochrome c biogenes  96.3  0.0036 7.8E-08   37.6   2.6   18   14-31     30-47  (207)
366 PRK00093 GTP-binding protein D  96.3   0.015 3.2E-07   38.4   5.7   21   11-31    172-192 (435)
367 TIGR00475 selB selenocysteine-  96.3   0.008 1.7E-07   41.7   4.5   18   14-31      2-19  (581)
368 COG1618 Predicted nucleotide k  96.3  0.0064 1.4E-07   36.6   3.6   21   11-31      4-24  (179)
369 cd03254 ABCC_Glucan_exporter_l  96.3  0.0036 7.8E-08   37.9   2.6   18   14-31     31-48  (229)
370 cd01130 VirB11-like_ATPase Typ  96.3  0.0037 8.1E-08   37.1   2.6   19   13-31     26-44  (186)
371 PRK14974 cell division protein  96.3  0.0032   7E-08   41.1   2.5   20   12-31    140-159 (336)
372 TIGR03238 dnd_assoc_3 dnd syst  96.3  0.0029 6.2E-08   43.4   2.3   17   14-30     34-50  (504)
373 PRK06620 hypothetical protein;  96.3  0.0032 6.9E-08   38.5   2.3   19   13-31     45-63  (214)
374 cd03247 ABCC_cytochrome_bd The  96.3  0.0038 8.3E-08   36.6   2.6   18   14-31     30-47  (178)
375 PRK13851 type IV secretion sys  96.3  0.0041 8.8E-08   40.8   2.9   20   12-31    162-181 (344)
376 cd03223 ABCD_peroxisomal_ALDP   96.3  0.0039 8.5E-08   36.4   2.6   18   14-31     29-46  (166)
377 COG0572 Udk Uridine kinase [Nu  96.3  0.0079 1.7E-07   37.4   4.0   22   10-31      6-27  (218)
378 PRK14239 phosphate transporter  96.3  0.0037   8E-08   38.4   2.6   18   14-31     33-50  (252)
379 TIGR01184 ntrCD nitrate transp  96.3  0.0038 8.2E-08   38.1   2.6   18   14-31     13-30  (230)
380 COG1119 ModF ABC-type molybden  96.3   0.004 8.7E-08   39.4   2.7   18   13-30     58-75  (257)
381 cd03252 ABCC_Hemolysin The ABC  96.3  0.0038 8.2E-08   38.1   2.6   18   14-31     30-47  (237)
382 cd03215 ABC_Carb_Monos_II This  96.3  0.0039 8.5E-08   36.8   2.6   18   14-31     28-45  (182)
383 PRK13649 cbiO cobalt transport  96.3  0.0037 8.1E-08   39.2   2.6   18   14-31     35-52  (280)
384 PRK14273 phosphate ABC transpo  96.3  0.0038 8.3E-08   38.5   2.6   18   14-31     35-52  (254)
385 cd01854 YjeQ_engC YjeQ/EngC.    96.3  0.0039 8.5E-08   39.6   2.7   19   13-31    162-180 (287)
386 PRK11264 putative amino-acid A  96.3  0.0039 8.4E-08   38.3   2.6   18   14-31     31-48  (250)
387 PRK11650 ugpC glycerol-3-phosp  96.3  0.0033 7.1E-08   41.1   2.4   17   15-31     33-49  (356)
388 PRK11432 fbpC ferric transport  96.3  0.0033 7.1E-08   41.1   2.4   18   14-31     34-51  (351)
389 PRK14267 phosphate ABC transpo  96.3  0.0035 7.5E-08   38.6   2.4   18   14-31     32-49  (253)
390 COG4987 CydC ABC-type transpor  96.3  0.0034 7.4E-08   43.5   2.5   19   13-31    365-383 (573)
391 cd03295 ABC_OpuCA_Osmoprotecti  96.3   0.004 8.6E-08   38.2   2.6   18   14-31     29-46  (242)
392 PRK13645 cbiO cobalt transport  96.3  0.0039 8.4E-08   39.3   2.6   18   14-31     39-56  (289)
393 cd03245 ABCC_bacteriocin_expor  96.3  0.0041 8.8E-08   37.5   2.6   18   14-31     32-49  (220)
394 PRK06547 hypothetical protein;  96.3   0.005 1.1E-07   36.6   2.9   21   11-31     14-34  (172)
395 PRK14250 phosphate ABC transpo  96.3  0.0041 8.8E-08   38.2   2.6   18   14-31     31-48  (241)
396 cd03283 ABC_MutS-like MutS-lik  96.3  0.0036 7.8E-08   37.8   2.3   18   14-31     27-44  (199)
397 cd03246 ABCC_Protease_Secretio  96.3  0.0043 9.3E-08   36.3   2.6   18   14-31     30-47  (173)
398 PF00910 RNA_helicase:  RNA hel  96.3  0.0032   7E-08   34.4   1.9   17   15-31      1-17  (107)
399 PRK06995 flhF flagellar biosyn  96.3  0.0034 7.4E-08   42.8   2.4   19   13-31    257-275 (484)
400 PRK10418 nikD nickel transport  96.3  0.0041 8.9E-08   38.5   2.6   18   14-31     31-48  (254)
401 cd03221 ABCF_EF-3 ABCF_EF-3  E  96.3   0.004 8.6E-08   35.7   2.4   18   14-31     28-45  (144)
402 CHL00131 ycf16 sulfate ABC tra  96.3  0.0042   9E-08   38.2   2.6   17   14-30     35-51  (252)
403 cd03267 ABC_NatA_like Similar   96.3  0.0042 9.1E-08   38.1   2.6   18   14-31     49-66  (236)
404 PRK14274 phosphate ABC transpo  96.3  0.0041   9E-08   38.5   2.6   18   14-31     40-57  (259)
405 cd03270 ABC_UvrA_I The excisio  96.3  0.0034 7.3E-08   38.4   2.2   16   14-29     23-38  (226)
406 PRK10744 pstB phosphate transp  96.3  0.0042   9E-08   38.6   2.6   18   14-31     41-58  (260)
407 PRK13543 cytochrome c biogenes  96.3  0.0041 8.9E-08   37.5   2.5   18   14-31     39-56  (214)
408 TIGR01425 SRP54_euk signal rec  96.3  0.0037 8.1E-08   42.1   2.5   20   12-31    100-119 (429)
409 PRK14241 phosphate transporter  96.3  0.0042 9.1E-08   38.4   2.6   18   14-31     32-49  (258)
410 TIGR03411 urea_trans_UrtD urea  96.3  0.0042 9.2E-08   37.9   2.6   18   14-31     30-47  (242)
411 PRK14262 phosphate ABC transpo  96.3  0.0043 9.2E-08   38.2   2.6   18   14-31     31-48  (250)
412 COG0552 FtsY Signal recognitio  96.3  0.0025 5.3E-08   41.8   1.6   44   10-59    137-180 (340)
413 TIGR02770 nickel_nikD nickel i  96.3  0.0043 9.2E-08   37.8   2.6   18   14-31     14-31  (230)
414 TIGR00635 ruvB Holliday juncti  96.3   0.004 8.6E-08   39.2   2.5   18   14-31     32-49  (305)
415 PRK10575 iron-hydroxamate tran  96.3  0.0043 9.2E-08   38.7   2.6   18   14-31     39-56  (265)
416 PRK13947 shikimate kinase; Pro  96.3  0.0046   1E-07   35.8   2.6   18   14-31      3-20  (171)
417 PRK09580 sufC cysteine desulfu  96.2  0.0043 9.4E-08   38.0   2.6   17   14-30     29-45  (248)
418 cd03234 ABCG_White The White s  96.2  0.0044 9.5E-08   37.6   2.6   18   14-31     35-52  (226)
419 TIGR02769 nickel_nikE nickel i  96.2  0.0043 9.3E-08   38.6   2.6   18   14-31     39-56  (265)
420 PRK15112 antimicrobial peptide  96.2  0.0042 9.1E-08   38.8   2.5   18   14-31     41-58  (267)
421 cd01918 HprK_C HprK/P, the bif  96.2  0.0043 9.4E-08   36.4   2.4   19   13-31     15-33  (149)
422 PRK15056 manganese/iron transp  96.2  0.0043 9.4E-08   38.8   2.6   18   14-31     35-52  (272)
423 cd03220 ABC_KpsT_Wzt ABC_KpsT_  96.2  0.0044 9.6E-08   37.7   2.6   18   14-31     50-67  (224)
424 PRK11701 phnK phosphonate C-P   96.2  0.0043 9.4E-08   38.4   2.6   18   14-31     34-51  (258)
425 cd03231 ABC_CcmA_heme_exporter  96.2  0.0045 9.8E-08   37.0   2.6   18   14-31     28-45  (201)
426 cd03240 ABC_Rad50 The catalyti  96.2  0.0038 8.2E-08   37.8   2.2   18   14-31     24-41  (204)
427 PRK11300 livG leucine/isoleuci  96.2  0.0044 9.6E-08   38.1   2.6   18   14-31     33-50  (255)
428 TIGR03005 ectoine_ehuA ectoine  96.2  0.0045 9.7E-08   38.2   2.6   18   14-31     28-45  (252)
429 COG4619 ABC-type uncharacteriz  96.2  0.0042 9.1E-08   38.0   2.4   18   14-31     31-48  (223)
430 PRK05703 flhF flagellar biosyn  96.2  0.0039 8.6E-08   41.7   2.5   18   14-31    223-240 (424)
431 PRK10751 molybdopterin-guanine  96.2  0.0046   1E-07   37.0   2.5   19   13-31      7-25  (173)
432 cd01128 rho_factor Transcripti  96.2  0.0044 9.6E-08   38.9   2.5   20   12-31     16-35  (249)
433 PRK11831 putative ABC transpor  96.2  0.0045 9.8E-08   38.7   2.6   18   14-31     35-52  (269)
434 cd01428 ADK Adenylate kinase (  96.2  0.0041 8.9E-08   36.5   2.3   18   14-31      1-18  (194)
435 PRK14261 phosphate ABC transpo  96.2  0.0046   1E-07   38.1   2.6   18   14-31     34-51  (253)
436 TIGR02324 CP_lyasePhnL phospho  96.2  0.0048   1E-07   37.3   2.6   18   14-31     36-53  (224)
437 cd00880 Era_like Era (E. coli   96.2  0.0025 5.4E-08   35.0   1.3   15   17-31      1-15  (163)
438 PRK09544 znuC high-affinity zi  96.2  0.0047   1E-07   38.4   2.6   18   14-31     32-49  (251)
439 PF01695 IstB_IS21:  IstB-like   96.2  0.0039 8.4E-08   37.2   2.1   20   12-31     47-66  (178)
440 cd03236 ABC_RNaseL_inhibitor_d  96.2  0.0047   1E-07   38.6   2.6   18   14-31     28-45  (255)
441 PRK10771 thiQ thiamine transpo  96.2  0.0047   1E-07   37.6   2.6   18   14-31     27-44  (232)
442 PRK11000 maltose/maltodextrin   96.2  0.0045 9.7E-08   40.6   2.6   18   14-31     31-48  (369)
443 PRK14531 adenylate kinase; Pro  96.2  0.0052 1.1E-07   36.4   2.7   19   13-31      3-21  (183)
444 TIGR00972 3a0107s01c2 phosphat  96.2  0.0042 9.2E-08   38.2   2.4   18   14-31     29-46  (247)
445 PLN02772 guanylate kinase       96.2  0.0055 1.2E-07   41.0   3.0   19   13-31    136-154 (398)
446 PRK12298 obgE GTPase CgtA; Rev  96.2   0.012 2.7E-07   39.0   4.6   18   14-31    161-178 (390)
447 PRK13632 cbiO cobalt transport  96.2  0.0042 9.1E-08   38.8   2.4   18   14-31     37-54  (271)
448 TIGR03265 PhnT2 putative 2-ami  96.2  0.0045 9.8E-08   40.4   2.6   18   14-31     32-49  (353)
449 PRK14240 phosphate transporter  96.2  0.0048   1E-07   37.9   2.6   18   14-31     31-48  (250)
450 cd03248 ABCC_TAP TAP, the Tran  96.2  0.0049 1.1E-07   37.3   2.6   18   14-31     42-59  (226)
451 cd02021 GntK Gluconate kinase   96.2  0.0048   1E-07   35.0   2.4   17   15-31      2-18  (150)
452 cd03294 ABC_Pro_Gly_Bertaine T  96.2  0.0043 9.2E-08   38.8   2.4   18   14-31     52-69  (269)
453 PRK14259 phosphate ABC transpo  96.2  0.0048   1E-07   38.6   2.6   18   14-31     41-58  (269)
454 COG1484 DnaC DNA replication p  96.2  0.0046 9.9E-08   38.8   2.5   20   12-31    105-124 (254)
455 PRK11144 modC molybdate transp  96.2  0.0047   1E-07   40.2   2.6   18   14-31     26-43  (352)
456 PTZ00088 adenylate kinase 1; P  96.2  0.0052 1.1E-07   38.1   2.7   19   13-31      7-25  (229)
457 smart00053 DYNc Dynamin, GTPas  96.2  0.0048   1E-07   38.6   2.5   21   11-31     25-45  (240)
458 PF03205 MobB:  Molybdopterin g  96.2  0.0035 7.6E-08   36.1   1.8   18   14-31      2-19  (140)
459 COG1220 HslU ATP-dependent pro  96.2  0.0054 1.2E-07   40.9   2.8   21   11-31     49-69  (444)
460 TIGR01288 nodI ATP-binding ABC  96.2  0.0049 1.1E-07   39.2   2.6   18   14-31     32-49  (303)
461 COG4136 ABC-type uncharacteriz  96.2  0.0046 9.9E-08   37.3   2.3   16   15-30     31-46  (213)
462 TIGR00150 HI0065_YjeE ATPase,   96.2  0.0048   1E-07   35.5   2.3   18   14-31     24-41  (133)
463 TIGR03740 galliderm_ABC gallid  96.2  0.0052 1.1E-07   37.2   2.6   18   14-31     28-45  (223)
464 cd03251 ABCC_MsbA MsbA is an e  96.2  0.0052 1.1E-07   37.3   2.6   18   14-31     30-47  (234)
465 PRK09452 potA putrescine/sperm  96.2  0.0043 9.4E-08   40.9   2.4   18   14-31     42-59  (375)
466 cd01855 YqeH YqeH.  YqeH is an  96.1  0.0045 9.7E-08   36.6   2.2   19   13-31    128-146 (190)
467 cd03279 ABC_sbcCD SbcCD and ot  96.1   0.005 1.1E-07   37.3   2.5   18   14-31     30-47  (213)
468 PRK09825 idnK D-gluconate kina  96.1  0.0048   1E-07   36.6   2.4   18   14-31      5-22  (176)
469 cd03228 ABCC_MRP_Like The MRP   96.1  0.0049 1.1E-07   36.0   2.4   18   14-31     30-47  (171)
470 cd01124 KaiC KaiC is a circadi  96.1  0.0047   1E-07   36.0   2.3   17   15-31      2-18  (187)
471 cd00227 CPT Chloramphenicol (C  96.1  0.0052 1.1E-07   36.0   2.5   18   14-31      4-21  (175)
472 PRK09493 glnQ glutamine ABC tr  96.1  0.0054 1.2E-07   37.5   2.6   18   14-31     29-46  (240)
473 KOG0060|consensus               96.1  0.0044 9.6E-08   43.4   2.4   19   13-31    462-480 (659)
474 PRK11607 potG putrescine trans  96.1  0.0045 9.8E-08   40.8   2.4   17   15-31     48-64  (377)
475 PF13476 AAA_23:  AAA domain; P  96.1  0.0033 7.1E-08   36.7   1.6   17   15-31     22-38  (202)
476 TIGR03771 anch_rpt_ABC anchore  96.1  0.0053 1.2E-07   37.3   2.5   19   13-31      7-25  (223)
477 cd03243 ABC_MutS_homologs The   96.1   0.005 1.1E-07   36.9   2.4   19   13-31     30-48  (202)
478 cd03253 ABCC_ATM1_transporter   96.1  0.0054 1.2E-07   37.3   2.6   18   14-31     29-46  (236)
479 PRK14237 phosphate transporter  96.1  0.0048   1E-07   38.5   2.4   18   14-31     48-65  (267)
480 PRK13548 hmuV hemin importer A  96.1  0.0055 1.2E-07   38.1   2.6   18   14-31     30-47  (258)
481 PTZ00258 GTP-binding protein;   96.1   0.015 3.2E-07   38.9   4.7   26   10-36     19-44  (390)
482 PRK14256 phosphate ABC transpo  96.1  0.0049 1.1E-07   38.0   2.4   18   14-31     32-49  (252)
483 PRK00131 aroK shikimate kinase  96.1  0.0059 1.3E-07   35.1   2.5   19   13-31      5-23  (175)
484 cd03217 ABC_FeS_Assembly ABC-t  96.1  0.0058 1.3E-07   36.6   2.6   18   14-31     28-45  (200)
485 TIGR01351 adk adenylate kinase  96.1  0.0049 1.1E-07   37.2   2.3   18   14-31      1-18  (210)
486 PRK13646 cbiO cobalt transport  96.1  0.0055 1.2E-07   38.7   2.6   18   14-31     35-52  (286)
487 PRK15093 antimicrobial peptide  96.1  0.0048   1E-07   39.8   2.4   18   14-31     35-52  (330)
488 PRK15064 ABC transporter ATP-b  96.1  0.0051 1.1E-07   41.7   2.6   18   14-31     29-46  (530)
489 COG1118 CysA ABC-type sulfate/  96.1  0.0046   1E-07   40.5   2.3   18   14-31     30-47  (345)
490 PRK10253 iron-enterobactin tra  96.1  0.0057 1.2E-07   38.1   2.6   18   14-31     35-52  (265)
491 cd03244 ABCC_MRP_domain2 Domai  96.1  0.0051 1.1E-07   37.1   2.3   18   14-31     32-49  (221)
492 TIGR01277 thiQ thiamine ABC tr  96.1  0.0058 1.3E-07   36.8   2.6   18   14-31     26-43  (213)
493 TIGR01188 drrA daunorubicin re  96.1  0.0056 1.2E-07   38.9   2.6   18   14-31     21-38  (302)
494 PRK14244 phosphate ABC transpo  96.1  0.0058 1.3E-07   37.6   2.6   18   14-31     33-50  (251)
495 cd03290 ABCC_SUR1_N The SUR do  96.1  0.0053 1.1E-07   37.0   2.4   18   14-31     29-46  (218)
496 PLN02165 adenylate isopentenyl  96.1  0.0078 1.7E-07   39.5   3.3   18   14-31     45-62  (334)
497 PRK11174 cysteine/glutathione   96.1  0.0053 1.1E-07   42.0   2.6   19   13-31    377-395 (588)
498 PRK13648 cbiO cobalt transport  96.1  0.0058 1.2E-07   38.1   2.6   18   14-31     37-54  (269)
499 PRK09984 phosphonate/organopho  96.1  0.0058 1.3E-07   37.9   2.6   18   14-31     32-49  (262)
500 cd00464 SK Shikimate kinase (S  96.1   0.006 1.3E-07   34.5   2.5   17   15-31      2-18  (154)

No 1  
>KOG0084|consensus
Probab=99.60  E-value=2.3e-15  Score=90.99  Aligned_cols=50  Identities=22%  Similarity=0.275  Sum_probs=44.5

Q ss_pred             CCCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEE
Q psy15257          6 EQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKD   62 (65)
Q Consensus         6 ~~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~   62 (65)
                      +...++.||++++||+|||||||+.|      |..+.|.+.|.+||| ||+-.++++
T Consensus         3 ~~~~dylFKiiliGds~VGKtCL~~R------f~~~~f~e~~~sTIG-VDf~~rt~e   52 (205)
T KOG0084|consen    3 NPEYDYLFKIILIGDSGVGKTCLLLR------FKDDTFTESYISTIG-VDFKIRTVE   52 (205)
T ss_pred             CcccceEEEEEEECCCCcChhhhhhh------hccCCcchhhcceee-eEEEEEEee
Confidence            45678999999999999999999998      999999999999999 887765554


No 2  
>KOG0094|consensus
Probab=99.50  E-value=4.5e-14  Score=85.65  Aligned_cols=50  Identities=28%  Similarity=0.224  Sum_probs=44.9

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEEecC
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDTLE   65 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~i~~   65 (65)
                      .-..+|++++||.+||||||+.|      |+.+.|...|.+||| +||.+.+..+.|
T Consensus        19 ~~k~~KlVflGdqsVGKTslItR------f~yd~fd~~YqATIG-iDFlskt~~l~d   68 (221)
T KOG0094|consen   19 PLKKYKLVFLGDQSVGKTSLITR------FMYDKFDNTYQATIG-IDFLSKTMYLED   68 (221)
T ss_pred             cceEEEEEEEccCccchHHHHHH------HHHhhhcccccceee-eEEEEEEEEEcC
Confidence            34559999999999999999998      999999999999999 999998876654


No 3  
>KOG0078|consensus
Probab=99.47  E-value=1.9e-13  Score=83.16  Aligned_cols=52  Identities=27%  Similarity=0.295  Sum_probs=46.8

Q ss_pred             CCCCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEEe
Q psy15257          5 NEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT   63 (65)
Q Consensus         5 ~~~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~i   63 (65)
                      ...++++.+|++++||++|||||++.|      |.++.|...|..||| |||..+++.+
T Consensus         5 ~~~~~d~~~kvlliGDs~vGKt~~l~r------f~d~~f~~~~~sTiG-IDFk~kti~l   56 (207)
T KOG0078|consen    5 AKEDYDYLFKLLLIGDSGVGKTCLLLR------FSDDSFNTSFISTIG-IDFKIKTIEL   56 (207)
T ss_pred             ccCCcceEEEEEEECCCCCchhHhhhh------hhhccCcCCccceEE-EEEEEEEEEe
Confidence            344788999999999999999999998      999999999999999 8998877764


No 4  
>KOG0394|consensus
Probab=99.37  E-value=4.8e-13  Score=80.63  Aligned_cols=49  Identities=22%  Similarity=0.283  Sum_probs=42.8

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEEe
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT   63 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~i   63 (65)
                      .....+||+++||+|||||||+.+      |..+.|...|..||| +||..+.+.|
T Consensus         5 ~K~~lLKViiLGDsGVGKtSLmn~------yv~~kF~~qykaTIg-adFltKev~V   53 (210)
T KOG0394|consen    5 RKRTLLKVIILGDSGVGKTSLMNQ------YVNKKFSQQYKATIG-ADFLTKEVQV   53 (210)
T ss_pred             CcccceEEEEeCCCCccHHHHHHH------HHHHHHHHHhccccc-hhheeeEEEE
Confidence            446679999999999999999998      999999999999999 7887766554


No 5  
>KOG0080|consensus
Probab=99.37  E-value=2.7e-12  Score=76.46  Aligned_cols=49  Identities=18%  Similarity=0.228  Sum_probs=42.7

Q ss_pred             CCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEE
Q psy15257          7 QPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKD   62 (65)
Q Consensus         7 ~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~   62 (65)
                      ..+...+|++++|++|||||||+.|      |..+.|.+....||| +||..+...
T Consensus         6 s~~~~t~KiLlIGeSGVGKSSLllr------Fv~~~fd~~~~~tIG-vDFkvk~m~   54 (209)
T KOG0080|consen    6 SGYDTTFKILLIGESGVGKSSLLLR------FVSNTFDDLHPTTIG-VDFKVKVMQ   54 (209)
T ss_pred             cCcceeEEEEEEccCCccHHHHHHH------HHhcccCccCCceee-eeEEEEEEE
Confidence            4567789999999999999999998      999999999999999 777666544


No 6  
>KOG0098|consensus
Probab=99.34  E-value=2.5e-12  Score=77.75  Aligned_cols=50  Identities=24%  Similarity=0.330  Sum_probs=42.4

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEee---------EEEEEEecC
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQ---------YRIYKDTLE   65 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~---------~~~~~~i~~   65 (65)
                      +.+.+|++++||.|||||||+.|      |+.+.|.+.+..|+| +|+         ...+++|||
T Consensus         3 ~~~~fKyIiiGd~gVGKSclllr------f~~krF~~~hd~TiG-vefg~r~~~id~k~IKlqiwD   61 (216)
T KOG0098|consen    3 YAYLFKYIIIGDTGVGKSCLLLR------FTDKRFQPVHDLTIG-VEFGARMVTIDGKQIKLQIWD   61 (216)
T ss_pred             ccceEEEEEECCCCccHHHHHHH------HhccCccccccceee-eeeceeEEEEcCceEEEEEEe
Confidence            46789999999999999999998      999999999999998 565         445555665


No 7  
>KOG0087|consensus
Probab=99.31  E-value=5.7e-12  Score=77.07  Aligned_cols=51  Identities=24%  Similarity=0.324  Sum_probs=45.0

Q ss_pred             CCCCCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEE
Q psy15257          4 DNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK   61 (65)
Q Consensus         4 ~~~~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~   61 (65)
                      +.+...++.||++++||++||||.|+.|      |..++|..+-.+||| +|+.+.++
T Consensus         6 ~~~~~~dylFKiVliGDS~VGKsnLlsR------ftrnEF~~~SksTIG-vef~t~t~   56 (222)
T KOG0087|consen    6 DKSEEYDYLFKIVLIGDSAVGKSNLLSR------FTRNEFSLESKSTIG-VEFATRTV   56 (222)
T ss_pred             CCccccceEEEEEEeCCCccchhHHHHH------hcccccCccccccee-EEEEeece
Confidence            3456789999999999999999999998      999999999999999 88887544


No 8  
>KOG0092|consensus
Probab=99.28  E-value=6.5e-12  Score=75.86  Aligned_cols=46  Identities=24%  Similarity=0.269  Sum_probs=39.9

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKD   62 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~   62 (65)
                      ...+|++++|+++||||||+.|      |..+.|.+...|||| .-|+++++.
T Consensus         3 ~~~~KvvLLG~~~VGKSSlV~R------fvk~~F~e~~e~TIG-aaF~tktv~   48 (200)
T KOG0092|consen    3 TREFKVVLLGDSGVGKSSLVLR------FVKDQFHENIEPTIG-AAFLTKTVT   48 (200)
T ss_pred             cceEEEEEECCCCCCchhhhhh------hhhCccccccccccc-cEEEEEEEE
Confidence            3569999999999999999998      999999999999999 566665544


No 9  
>KOG0393|consensus
Probab=99.28  E-value=1.9e-12  Score=78.51  Aligned_cols=45  Identities=42%  Similarity=0.636  Sum_probs=42.6

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEEe
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT   63 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~i   63 (65)
                      ...|++++||++|||||++..      |..+.|+..|.||++  |+|++.+.|
T Consensus         3 ~~~K~VvVGDga~GKT~ll~~------~t~~~fp~~yvPTVF--dnys~~v~V   47 (198)
T KOG0393|consen    3 RRIKCVVVGDGAVGKTCLLIS------YTTNAFPEEYVPTVF--DNYSANVTV   47 (198)
T ss_pred             eeeEEEEECCCCcCceEEEEE------eccCcCcccccCeEE--ccceEEEEe
Confidence            468999999999999999998      999999999999999  999999887


No 10 
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily.  Rnd3/RhoE/Rho8 is a member of the novel Rho subfamily Rnd, together with Rnd1/Rho6 and Rnd2/Rho7.  Rnd3/RhoE is known to bind the serine-threonine kinase ROCK I.  Unphosphorylated Rnd3/RhoE associates primarily with membranes, but ROCK I-phosphorylated Rnd3/RhoE localizes in the cytosol.  Phosphorylation of Rnd3/RhoE correlates with its activity in disrupting RhoA-induced stress fibers and inhibiting Ras-induced fibroblast transformation.  In cells that lack stress fibers, such as macrophages and monocytes, Rnd3/RhoE induces a redistribution of actin, causing morphological changes in the cell.  In addition, Rnd3/RhoE has been shown to inhibit cell cycle progression in G1 phase at a point upstream of the pRb family pocket protein checkpoint.  Rnd3/RhoE has also been shown to inhibit Ras- and Raf-induced fibroblast transformation.  In mammary epithelial tumor cells, Rnd3/RhoE regulates the assembly of the apical junction complex and tight
Probab=99.28  E-value=1e-11  Score=73.87  Aligned_cols=44  Identities=34%  Similarity=0.452  Sum_probs=37.9

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK   61 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~   61 (65)
                      ...+|++++|++|||||||+.|      |..+.|..+|.||++  +.|...+
T Consensus         3 ~~~~KivvvGd~~vGKTsli~~------~~~~~f~~~~~pT~~--~~~~~~~   46 (182)
T cd04172           3 NVKCKIVVVGDSQCGKTALLHV------FAKDCFPENYVPTVF--ENYTASF   46 (182)
T ss_pred             cceEEEEEECCCCCCHHHHHHH------HHhCCCCCccCCcee--eeeEEEE
Confidence            4568999999999999999998      888999999999998  6665443


No 11 
>cd01875 RhoG RhoG subfamily.  RhoG is a GTPase with high sequence similarity to members of the Rac subfamily, including the regions involved in effector recognition and binding.  However, RhoG does not bind to known Rac1 and Cdc42 effectors, including proteins containing a Cdc42/Rac interacting binding (CRIB) motif.  Instead, RhoG interacts directly with Elmo, an upstream regulator of Rac1, in a GTP-dependent manner and forms a ternary complex with Dock180 to induce activation of Rac1.  The RhoG-Elmo-Dock180 pathway is required for activation of Rac1 and cell spreading mediated by integrin, as well as for neurite outgrowth induced by nerve growth factor.  Thus RhoG activates Rac1 through Elmo and Dock180 to control cell morphology.  RhoG has also been shown to play a role in caveolar trafficking and has a novel role in signaling the neutrophil respiratory burst stimulated by G protein-coupled receptor (GPCR) agonists.  Most Rho proteins contain a lipid modification site at the C-termin
Probab=99.27  E-value=9.6e-12  Score=73.99  Aligned_cols=40  Identities=45%  Similarity=0.732  Sum_probs=35.9

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      .+|++++|+++||||+|+.|      |..+.|...|.||++  +.|..
T Consensus         3 ~~ki~~vG~~~vGKTsli~~------~~~~~f~~~~~~t~~--~~~~~   42 (191)
T cd01875           3 SIKCVVVGDGAVGKTCLLIC------YTTNAFPKEYIPTVF--DNYSA   42 (191)
T ss_pred             cEEEEEECCCCCCHHHHHHH------HHhCCCCcCCCCceE--eeeEE
Confidence            48999999999999999998      999999999999999  66653


No 12 
>cd01874 Cdc42 Cdc42 subfamily.  Cdc42 is an essential GTPase that belongs to the Rho family of Ras-like GTPases.  These proteins act as molecular switches by responding to exogenous and/or endogenous signals and relaying those signals to activate downstream components of a biological pathway.  Cdc42 transduces signals to the actin cytoskeleton to initiate and maintain polarized growth and to mitogen-activated protein morphogenesis. In the budding yeast Saccharomyces cerevisiae, Cdc42 plays an important role in multiple actin-dependent morphogenetic events such as bud emergence, mating-projection formation, and pseudohyphal growth.  In mammalian cells, Cdc42 regulates a variety of actin-dependent events and induces the JNK/SAPK protein kinase cascade, which leads to the activation of transcription factors within the nucleus.  Cdc42 mediates these processes through interactions with a myriad of downstream effectors, whose number and regulation we are just starting to understand.  In addi
Probab=99.26  E-value=1.1e-11  Score=72.88  Aligned_cols=39  Identities=49%  Similarity=0.833  Sum_probs=35.0

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      +|++++|+.|||||||+.+      |..+.|...|.||++  +.|..
T Consensus         2 ~ki~vvG~~~vGKTsl~~~------~~~~~f~~~~~pt~~--~~~~~   40 (175)
T cd01874           2 IKCVVVGDGAVGKTCLLIS------YTTNKFPSEYVPTVF--DNYAV   40 (175)
T ss_pred             eEEEEECCCCCCHHHHHHH------HHcCCCCCCCCCcee--eeeEE
Confidence            6999999999999999998      888889889999998  66653


No 13 
>cd01873 RhoBTB RhoBTB subfamily.  Members of the RhoBTB subfamily of Rho GTPases are present in vertebrates, Drosophila, and Dictyostelium.  RhoBTB proteins are characterized by a modular organization, consisting of a GTPase domain, a proline rich region, a tandem of two BTB (Broad-Complex, Tramtrack, and Bric a brac) domains, and a C-terminal region of unknown function.  RhoBTB proteins may act as docking points for multiple components participating in signal transduction cascades.  RhoBTB genes appeared upregulated in some cancer cell lines, suggesting a participation of RhoBTB proteins in the pathogenesis of particular tumors.  Note that the Dictyostelium RacA GTPase domain is more closely related to Rac proteins than to RhoBTB proteins, where RacA actually belongs.  Thus, the Dictyostelium RacA is not included here.  Most Rho proteins contain a lipid modification site at the C-terminus; however, RhoBTB is one of few Rho subfamilies that lack this feature.
Probab=99.25  E-value=1.9e-11  Score=73.41  Aligned_cols=47  Identities=81%  Similarity=1.316  Sum_probs=37.1

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      .+||+++|+++||||||+.+++++..|..+.|..+|.||++.+++|.
T Consensus         2 ~~Kiv~vG~~~vGKTsLi~~~~~~~~~~~~~f~~~~~pTi~~~~~~~   48 (195)
T cd01873           2 TIKCVVVGDNAVGKTRLICARACNKTLTQYQLLATHVPTVWAIDQYR   48 (195)
T ss_pred             ceEEEEECCCCcCHHHHHHHHHhCCCcccccCccccCCceeccccee
Confidence            47999999999999999976666666666778888999997334443


No 14 
>KOG0079|consensus
Probab=99.23  E-value=3.9e-12  Score=74.96  Aligned_cols=49  Identities=22%  Similarity=0.301  Sum_probs=43.5

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEEe
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT   63 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~i   63 (65)
                      .++..+|.+++||+|||||+|+.|      |..+.|...|..|+| +|+..+++.|
T Consensus         4 ~~dhLfkllIigDsgVGKssLl~r------F~ddtFs~sYitTiG-vDfkirTv~i   52 (198)
T KOG0079|consen    4 DYDHLFKLLIIGDSGVGKSSLLLR------FADDTFSGSYITTIG-VDFKIRTVDI   52 (198)
T ss_pred             cHHHHHHHHeecCCcccHHHHHHH------HhhcccccceEEEee-eeEEEEEeec
Confidence            345678999999999999999998      999999999999999 8988877664


No 15 
>cd04131 Rnd Rnd subfamily.  The Rnd subfamily contains Rnd1/Rho6, Rnd2/Rho7, and Rnd3/RhoE/Rho8.  These novel Rho family proteins have substantial structural differences compared to other Rho members, including N- and C-terminal extensions relative to other Rhos.  Rnd3/RhoE is farnesylated at the C-terminal prenylation site, unlike most other Rho proteins that are geranylgeranylated.  In addition, Rnd members are unable to hydrolyze GTP and are resistant to GAP activity.  They are believed to exist only in the GTP-bound conformation, and are antagonists of RhoA activity.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=99.23  E-value=2.3e-11  Score=71.94  Aligned_cols=40  Identities=40%  Similarity=0.530  Sum_probs=35.4

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY   60 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~   60 (65)
                      +|++++|++|||||||+.+      |..+.|...|.||++  +.|...
T Consensus         2 ~Kiv~vG~~~vGKTsli~~------~~~~~f~~~~~~t~~--~~~~~~   41 (178)
T cd04131           2 CKIVVVGDVQCGKTALLQV------FAKDCYPETYVPTVF--ENYTAS   41 (178)
T ss_pred             eEEEEECCCCCCHHHHHHH------HHhCcCCCCcCCceE--EEEEEE
Confidence            7999999999999999998      888899999999998  666533


No 16 
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily.  Rnd1/Rho6 is a member of the novel Rho subfamily Rnd, together with Rnd2/Rho7 and Rnd3/RhoE/Rho8.  Rnd1/Rho6 binds GTP but does not hydrolyze it to GDP, indicating that it is constitutively active.  In rat, Rnd1/Rho6 is highly expressed in the cerebral cortex and hippocampus during synapse formation, and plays a role in spine formation.  Rnd1/Rho6 is also expressed in the liver and in endothelial cells, and is upregulated in uterine myometrial cells during pregnancy.  Like Rnd3/RhoE/Rho8, Rnd1/Rho6 is believed to function as an antagonist to RhoA.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=99.23  E-value=3.1e-11  Score=74.52  Aligned_cols=45  Identities=33%  Similarity=0.445  Sum_probs=38.8

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEE
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY   60 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~   60 (65)
                      +....+|++++|++|||||||+.+      |..+.|...|.||++  +.|...
T Consensus         9 ~~~~~~KIvvvGd~~VGKTsLi~r------~~~~~F~~~y~pTi~--~~~~~~   53 (232)
T cd04174           9 PLVMRCKLVLVGDVQCGKTAMLQV------LAKDCYPETYVPTVF--ENYTAG   53 (232)
T ss_pred             CceeeEEEEEECCCCCcHHHHHHH------HhcCCCCCCcCCcee--eeeEEE
Confidence            445678999999999999999998      888999999999998  666543


No 17 
>cd04133 Rop_like Rop subfamily.  The Rop (Rho-related protein from plants) subfamily plays a role in diverse cellular processes, including cytoskeletal organization, pollen and vegetative cell growth, hormone responses, stress responses, and pathogen resistance.  Rops are able to regulate several downstream pathways to amplify a specific signal by acting as master switches early in the signaling cascade.  They transmit a variety of extracellular and intracellular signals.  Rops are involved in establishing cell polarity in root-hair development, root-hair elongation, pollen-tube growth, cell-shape formation, responses to hormones such as abscisic acid (ABA) and auxin, responses to abiotic stresses such as oxygen deprivation, and disease resistance and disease susceptibility.  An individual Rop can have a unique function or an overlapping function shared with other Rop proteins; in addition, a given Rop-regulated function can be controlled by one or multiple Rop proteins.  For example, 
Probab=99.19  E-value=3.8e-11  Score=71.14  Aligned_cols=40  Identities=40%  Similarity=0.706  Sum_probs=35.6

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY   60 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~   60 (65)
                      +|++++|+.|||||+|+.|      |..+.|..+|.||++  +.|...
T Consensus         2 ~kivv~G~~~vGKTsli~~------~~~~~f~~~~~~Ti~--~~~~~~   41 (176)
T cd04133           2 IKCVTVGDGAVGKTCMLIC------YTSNKFPTDYIPTVF--DNFSAN   41 (176)
T ss_pred             eEEEEECCCCCcHHHHHHH------HhcCCCCCCCCCcce--eeeEEE
Confidence            6999999999999999998      999999999999998  666543


No 18 
>cd04128 Spg1 Spg1p.  Spg1p (septum-promoting GTPase) was first identified in the fission yeast S. pombe, where it regulates septum formation in the septation initiation network (SIN) through the cdc7 protein kinase.  Spg1p is an essential gene that localizes to the spindle pole bodies.  When GTP-bound, it binds cdc7 and causes it to translocate to spindle poles. Sid4p (septation initiation defective) is required for localization of Spg1p to the spindle pole body, and the ability of Spg1p to promote septum formation from any point in the cell cycle depends on Sid4p.  Spg1p is negatively regulated by Byr4 and cdc16, which form a two-component GTPase activating protein (GAP) for Spg1p.  The existence of a SIN-related pathway in plants has been proposed.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP.  Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are
Probab=99.19  E-value=4e-11  Score=71.10  Aligned_cols=40  Identities=20%  Similarity=0.286  Sum_probs=34.5

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      +|++++|++|||||||+.|      |..+.|..+|.||++ .+++.+
T Consensus         1 ~Ki~vlG~~~vGKTsLi~~------~~~~~f~~~~~~T~g-~~~~~~   40 (182)
T cd04128           1 LKIGLLGDAQIGKTSLMVK------YVEGEFDEDYIQTLG-VNFMEK   40 (182)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHhCCCCCCCCCccc-eEEEEE
Confidence            5899999999999999998      888889989999998 455443


No 19 
>KOG0095|consensus
Probab=99.18  E-value=5.5e-11  Score=70.37  Aligned_cols=49  Identities=24%  Similarity=0.234  Sum_probs=43.8

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEEe
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT   63 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~i   63 (65)
                      .+...||++++|..|||||||+.|      |..+-|+.....||| +||-.++++|
T Consensus         3 dykflfkivlvgnagvgktclvrr------ftqglfppgqgatig-vdfmiktvev   51 (213)
T KOG0095|consen    3 DYKFLFKIVLVGNAGVGKTCLVRR------FTQGLFPPGQGATIG-VDFMIKTVEV   51 (213)
T ss_pred             ccceeEEEEEEccCCcCcchhhhh------hhccCCCCCCCceee-eeEEEEEEEE
Confidence            356789999999999999999998      999999999999999 8988877664


No 20 
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily.  Rnd2/Rho7 is a member of the novel Rho subfamily Rnd, together with Rnd1/Rho6 and Rnd3/RhoE/Rho8.  Rnd2/Rho7 is transiently expressed in radially migrating cells in the brain while they are within the subventricular zone of the hippocampus and cerebral cortex.  These migrating cells typically develop into pyramidal neurons.  Cells that exogenously expressed Rnd2/Rho7 failed to migrate to upper layers of the brain, suggesting that Rnd2/Rho7 plays a role in the radial migration and morphological changes of developing pyramidal neurons, and that Rnd2/Rho7 degradation is necessary for proper cellular migration.  The Rnd2/Rho7 GEF Rapostlin is found primarily in the brain and together with Rnd2/Rho7 induces dendrite branching.  Unlike Rnd1/Rho6 and Rnd3/RhoE/Rho8, which are RhoA antagonists, Rnd2/Rho7 binds the GEF Pragmin and significantly stimulates RhoA activity and Rho-A mediated cell contraction.  Rnd2/Rho7 is also found to be expressed in sperma
Probab=99.18  E-value=3.3e-11  Score=73.94  Aligned_cols=39  Identities=38%  Similarity=0.568  Sum_probs=35.1

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      +|++++|++|||||||+.+      |..+.|+..|.||++  +.|..
T Consensus         2 ~KIvvvGd~~vGKTsLi~~------~~~~~f~~~y~pTi~--~~~~~   40 (222)
T cd04173           2 CKIVVVGDAECGKTALLQV------FAKDAYPGSYVPTVF--ENYTA   40 (222)
T ss_pred             eEEEEECCCCCCHHHHHHH------HHcCCCCCccCCccc--cceEE
Confidence            7999999999999999998      888899999999998  66653


No 21 
>PLN03110 Rab GTPase; Provisional
Probab=99.16  E-value=1.7e-10  Score=69.96  Aligned_cols=52  Identities=19%  Similarity=0.305  Sum_probs=40.6

Q ss_pred             CCCCCCCCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257          1 MLSDNEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus         1 m~~~~~~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      |..+..+...+.+|++++|++|||||+|+.+      +..+.|...+.||++ +++...
T Consensus         1 ~~~~~~~~~~~~~Ki~ivG~~~vGKStLi~~------l~~~~~~~~~~~t~g-~~~~~~   52 (216)
T PLN03110          1 MAHRVDHEYDYLFKIVLIGDSGVGKSNILSR------FTRNEFCLESKSTIG-VEFATR   52 (216)
T ss_pred             CCCCcccccCceeEEEEECCCCCCHHHHHHH------HhcCCCCCCCCCcee-EEEEEE
Confidence            3444555566789999999999999999997      877778778889988 555443


No 22 
>PLN03071 GTP-binding nuclear protein Ran; Provisional
Probab=99.14  E-value=1.3e-10  Score=70.69  Aligned_cols=43  Identities=23%  Similarity=0.289  Sum_probs=36.9

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      ...+|++++|++|||||+|+.+      |..+.|...|.||++ ++.+..
T Consensus        11 ~~~~Ki~vvG~~gvGKTsli~~------~~~~~f~~~~~~tig-~~~~~~   53 (219)
T PLN03071         11 YPSFKLVIVGDGGTGKTTFVKR------HLTGEFEKKYEPTIG-VEVHPL   53 (219)
T ss_pred             CCceEEEEECcCCCCHHHHHHH------HhhCCCCCccCCccc-eeEEEE
Confidence            5678999999999999999998      888889888999998 555543


No 23 
>cd01892 Miro2 Miro2 subfamily.  Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs.  Genes encoding Miro-like proteins were found in several eukaryotic organisms.  This CD represents the putative GTPase domain in the C terminus of Miro proteins.  These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis.  Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature.
Probab=99.14  E-value=9.9e-11  Score=68.35  Aligned_cols=37  Identities=24%  Similarity=0.395  Sum_probs=33.4

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhcccccccccc-ccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLL-TTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~-~~~~~ti~   52 (65)
                      +..+|++++|++|||||+|+.|      |..+.|. .+|.||++
T Consensus         2 ~~~~kv~~vG~~~vGKTsli~~------~~~~~f~~~~~~~T~~   39 (169)
T cd01892           2 RNVFLCFVLGAKGSGKSALLRA------FLGRSFSLNAYSPTIK   39 (169)
T ss_pred             CeEEEEEEECCCCCcHHHHHHH------HhCCCCCcccCCCccC
Confidence            4568999999999999999998      8888888 88999987


No 24 
>cd04121 Rab40 Rab40 subfamily.  This subfamily contains Rab40a, Rab40b, and Rab40c, which are all highly homologous.  In rat, Rab40c is localized to the perinuclear recycling compartment (PRC), and is distributed in a tissue-specific manor, with high expression in brain, heart, kidney, and testis, low expression in lung and liver, and no expression in spleen and skeletal muscle.  Rab40c is highly expressed in differentiated oligodendrocytes but minimally expressed in oligodendrocyte progenitors, suggesting a role in the vesicular transport of myelin components.  Unlike most other Ras-superfamily proteins, Rab40c was shown to have a much lower affinity for GTP, and an affinity for GDP that is lower than for GTP. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide d
Probab=99.12  E-value=2.2e-10  Score=68.64  Aligned_cols=44  Identities=23%  Similarity=0.252  Sum_probs=35.8

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      ....+|++++|+.|||||+|+.+      |..+.|...|.|+++ .+++..
T Consensus         3 ~~~~~KivviG~~~vGKTsll~~------~~~~~~~~~~~~t~~-~~~~~~   46 (189)
T cd04121           3 YDYLLKFLLVGDSDVGKGEILAS------LQDGSTESPYGYNMG-IDYKTT   46 (189)
T ss_pred             CCceeEEEEECCCCCCHHHHHHH------HHcCCCCCCCCCcce-eEEEEE
Confidence            34669999999999999999998      888888888888887 444433


No 25 
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily.  Rit (Ras-like protein in all tissues), Rin (Ras-like protein in neurons) and Ric (Ras-related protein which interacts with calmodulin) form a subfamily with several unique structural and functional characteristics.   These proteins all lack a the C-terminal CaaX lipid-binding motif typical of Ras family proteins, and Rin and Ric contain calmodulin-binding domains.  Rin, which is expressed only in neurons, induces neurite outgrowth in rat pheochromocytoma cells through its association with calmodulin and its activation of endogenous Rac/cdc42.  Rit, which is ubiquitously expressed in mammals, inhibits growth-factor withdrawl-mediated apoptosis and induces neurite extension in pheochromocytoma cells.  Rit and Rin are both able to form a ternary complex with PAR6, a cell polarity-regulating protein, and Rac/cdc42.  This ternary complex is proposed to have physiological function in processes such as tumorigenesis.  Activated Ric is likely to sign
Probab=99.09  E-value=1.8e-10  Score=67.48  Aligned_cols=41  Identities=27%  Similarity=0.345  Sum_probs=35.1

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY   60 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~   60 (65)
                      .+|++++|+.|||||+|+.+      |..+.|...+.||++  +.+...
T Consensus         2 ~~ki~vvG~~~vGKTsL~~~------~~~~~f~~~~~~t~~--~~~~~~   42 (172)
T cd04141           2 EYKIVMLGAGGVGKSAVTMQ------FISHSFPDYHDPTIE--DAYKQQ   42 (172)
T ss_pred             ceEEEEECCCCCcHHHHHHH------HHhCCCCCCcCCccc--ceEEEE
Confidence            37999999999999999998      888888888999998  666543


No 26 
>KOG0086|consensus
Probab=99.09  E-value=9.7e-11  Score=69.51  Aligned_cols=48  Identities=17%  Similarity=0.189  Sum_probs=42.0

Q ss_pred             CCCCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257          5 NEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus         5 ~~~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      +...+++.+|++++|++|.|||||+++      |..+.|.+.-..||| +||-+.
T Consensus         2 msEtYDyLfKfl~iG~aGtGKSCLLh~------Fie~kfkDdssHTiG-veFgSr   49 (214)
T KOG0086|consen    2 MSETYDYLFKFLVIGSAGTGKSCLLHQ------FIENKFKDDSSHTIG-VEFGSR   49 (214)
T ss_pred             cchhhhhhheeEEeccCCCChhHHHHH------HHHhhhcccccceee-eeecce
Confidence            345688999999999999999999998      999999998889998 787654


No 27 
>cd04120 Rab12 Rab12 subfamily.  Rab12 was first identified in canine cells, where it was localized to the Golgi complex.  The specific function of Rab12 remains unknown, and inconsistent results about its cellular localization have been reported.  More recent studies have identified Rab12 associated with post-Golgi vesicles, or with other small vesicle-like structures but not with the Golgi complex.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic
Probab=99.09  E-value=2.2e-10  Score=69.28  Aligned_cols=41  Identities=20%  Similarity=0.223  Sum_probs=34.9

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK   61 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~   61 (65)
                      .++++|++|||||||+.|      |..+.|...|.||++ ++++...+
T Consensus         2 ~vvvlG~~gVGKTSli~r------~~~~~f~~~~~~Ti~-~~~~~~~i   42 (202)
T cd04120           2 QVIIIGSRGVGKTSLMRR------FTDDTFCEACKSGVG-VDFKIKTV   42 (202)
T ss_pred             EEEEECcCCCCHHHHHHH------HHhCCCCCcCCCcce-eEEEEEEE
Confidence            589999999999999998      888999999999998 56655443


No 28 
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily.  Rab34, found primarily in the Golgi, interacts with its effector, Rab-interacting lysosomal protein (RILP). This enables its participation in microtubular dynenin-dynactin-mediated repositioning of lysosomes from the cell periphery to the Golgi. A Rab34 (Rah) isoform that lacks the consensus GTP-binding region has been identified in mice.  This isoform is associated with membrane ruffles and promotes macropinosome formation.  Rab36 has been mapped to human chromosome 22q11.2, a region that is homozygously deleted in malignant rhabdoid tumors (MRTs). However, experimental assessments do not implicate Rab36 as a tumor suppressor that would enable tumor formation through a loss-of-function mechanism.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further re
Probab=99.08  E-value=3.4e-10  Score=66.20  Aligned_cols=39  Identities=33%  Similarity=0.302  Sum_probs=34.1

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      ||+++|+.|||||+|+.+      |..+.|..+|.||++ .+++..
T Consensus         2 ki~ivG~~~vGKTsli~~------~~~~~f~~~~~~t~~-~~~~~~   40 (170)
T cd04108           2 KVIVVGDLSVGKTCLINR------FCKDVFDKNYKATIG-VDFEME   40 (170)
T ss_pred             EEEEECCCCCCHHHHHHH------HhcCCCCCCCCCcee-eEEEEE
Confidence            899999999999999998      888899999999998 455433


No 29 
>cd01871 Rac1_like Rac1-like subfamily.  The Rac1-like subfamily consists of Rac1, Rac2, and Rac3 proteins, plus the splice variant Rac1b that contains a 19-residue insertion near switch II relative to Rac1.  While Rac1 is ubiquitously expressed, Rac2 and Rac3 are largely restricted to hematopoietic and neural tissues respectively.  Rac1 stimulates the formation of actin lamellipodia and membrane ruffles.  It also plays a role in cell-matrix adhesion and cell anoikis.  In intestinal epithelial cells, Rac1 is an important regulator of migration and mediates apoptosis.  Rac1 is also essential for RhoA-regulated actin stress fiber and focal adhesion complex formation.  In leukocytes, Rac1 and Rac2 have distinct roles in regulating cell morphology, migration, and invasion, but are not essential for macrophage migration or chemotaxis.  Rac3 has biochemical properties that are closely related to Rac1, such as effector interaction, nucleotide binding, and hydrolysis; Rac2 has a slower nucleoti
Probab=99.08  E-value=2.5e-10  Score=67.03  Aligned_cols=39  Identities=46%  Similarity=0.764  Sum_probs=34.4

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      +|++++|+.+||||+|+.|      |..+.|...|.||++  +.|..
T Consensus         2 ~ki~iiG~~~vGKSsli~~------~~~~~f~~~~~~t~~--~~~~~   40 (174)
T cd01871           2 IKCVVVGDGAVGKTCLLIS------YTTNAFPGEYIPTVF--DNYSA   40 (174)
T ss_pred             eEEEEECCCCCCHHHHHHH------HhcCCCCCcCCCcce--eeeEE
Confidence            6999999999999999998      888889889999987  66553


No 30 
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily.  H-Ras, N-Ras, and K-Ras4A/4B are the prototypical members of the Ras family.  These isoforms generate distinct signal outputs despite interacting with a common set of activators and effectors, and are strongly associated with oncogenic progression in tumor initiation.  Mutated versions of Ras that are insensitive to GAP stimulation (and are therefore constitutively active) are found in a significant fraction of human cancers.  Many Ras guanine nucleotide exchange factors (GEFs) have been identified.  They are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active (GTP-bound) Ras interacts with several effector proteins that stimulate a variety of diverse cytoplasmic signaling activities.  Some are known to positively mediate the oncogenic properties of Ras, including Raf, phosphatidylinositol 3-kinase (PI3K), RalGEFs, and Tiam1.  
Probab=99.08  E-value=2.3e-10  Score=64.95  Aligned_cols=39  Identities=36%  Similarity=0.480  Sum_probs=33.2

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      +|++++|++|||||+|+.+      +..+.|...+.||++  +.+..
T Consensus         2 ~ki~iiG~~~vGKTsl~~~------~~~~~~~~~~~~t~~--~~~~~   40 (162)
T cd04138           2 YKLVVVGAGGVGKSALTIQ------LIQNHFVDEYDPTIE--DSYRK   40 (162)
T ss_pred             eEEEEECCCCCCHHHHHHH------HHhCCCcCCcCCcch--heEEE
Confidence            6999999999999999997      777788888888887  55543


No 31 
>cd04109 Rab28 Rab28 subfamily.  First identified in maize, Rab28 has been shown to be a late embryogenesis-abundant (Lea) protein that is regulated by the plant hormone abcisic acid (ABA).  In Arabidopsis, Rab28 is expressed during embryo development and is generally restricted to provascular tissues in mature embryos.  Unlike maize Rab28, it is not ABA-inducible. Characterization of the human Rab28 homolog revealed two isoforms, which differ by a 95-base pair insertion, producing an alternative sequence for the 30 amino acids at the C-terminus.  The two human isoforms are presumbly the result of alternative splicing.  Since they differ at the C-terminus but not in the GTP-binding region, they are predicted to be targeted to different cellular locations.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs 
Probab=99.07  E-value=3.3e-10  Score=68.42  Aligned_cols=42  Identities=31%  Similarity=0.305  Sum_probs=36.4

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK   61 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~   61 (65)
                      +|++++|+++||||+|+.+      |..+.|...|.||++ +|++...+
T Consensus         1 ~Ki~ivG~~~vGKSsLi~~------l~~~~~~~~~~~T~~-~d~~~~~i   42 (215)
T cd04109           1 FKIVVLGDGAVGKTSLCRR------FAKEGFGKSYKQTIG-LDFFSKRV   42 (215)
T ss_pred             CEEEEECcCCCCHHHHHHH------HhcCCCCCCCCCcee-EEEEEEEE
Confidence            5899999999999999998      888889999999998 67766544


No 32 
>cd04127 Rab27A Rab27a subfamily.  The Rab27a subfamily consists of Rab27a and its highly homologous isoform, Rab27b.  Unlike most Rab proteins whose functions remain poorly defined, Rab27a has many known functions.  Rab27a has multiple effector proteins, and depending on which effector it binds, Rab27a has different functions as well as tissue distribution and/or cellular localization. Putative functions have been assigned to Rab27a when associated with the effector proteins Slp1, Slp2, Slp3, Slp4, Slp5, DmSlp, rabphilin, Dm/Ce-rabphilin, Slac2-a, Slac2-b, Slac2-c, Noc2, JFC1, and Munc13-4. Rab27a has been associated with several human diseases, including hemophagocytic syndrome (Griscelli syndrome or GS), Hermansky-Pudlak syndrome, and choroidermia. In the case of GS, a rare, autosomal recessive disease, a Rab27a mutation is directly responsible for the disorder.  When Rab27a is localized to the secretory granules of pancreatic beta cells, it is believed to mediate glucose-stimulated 
Probab=99.07  E-value=4.5e-10  Score=65.38  Aligned_cols=41  Identities=29%  Similarity=0.416  Sum_probs=35.2

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      +.+|++++|+++||||+|+.+      +..+.|...+.||++ +++..
T Consensus         3 ~~~ki~ivG~~~vGKTsli~~------~~~~~~~~~~~~t~~-~~~~~   43 (180)
T cd04127           3 YLIKFLALGDSGVGKTSFLYQ------YTDNKFNPKFITTVG-IDFRE   43 (180)
T ss_pred             ceEEEEEECCCCCCHHHHHHH------HhcCCCCccCCCccc-eEEEE
Confidence            568999999999999999998      888888888999987 45543


No 33 
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily.  Rab32 and Rab38 are members of the Rab family of small GTPases.  Human Rab32 was first identified in platelets but it is expressed in a variety of cell types, where it functions as an A-kinase anchoring protein (AKAP). Rab38 has been shown to be melanocyte-specific.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=99.06  E-value=4.2e-10  Score=67.19  Aligned_cols=39  Identities=28%  Similarity=0.306  Sum_probs=33.6

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      +|++++|++|||||||+.+      |..+.|...+.||++ .+++.
T Consensus         1 ~KivivG~~~vGKTsli~~------l~~~~~~~~~~~t~~-~d~~~   39 (201)
T cd04107           1 LKVLVIGDLGVGKTSIIKR------YVHGIFSQHYKATIG-VDFAL   39 (201)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHcCCCCCCCCCcee-EEEEE
Confidence            5899999999999999998      888888888999998 45443


No 34 
>KOG0093|consensus
Probab=99.06  E-value=2.9e-10  Score=67.06  Aligned_cols=47  Identities=26%  Similarity=0.359  Sum_probs=41.8

Q ss_pred             CCCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257          6 EQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus         6 ~~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      +++.++.+|++++|++.|||||++.|      |..+.|...|.+|+| |+|..+
T Consensus        15 dqnFDymfKlliiGnssvGKTSfl~r------y~ddSFt~afvsTvG-idFKvK   61 (193)
T KOG0093|consen   15 DQNFDYMFKLLIIGNSSVGKTSFLFR------YADDSFTSAFVSTVG-IDFKVK   61 (193)
T ss_pred             cccccceeeEEEEccCCccchhhhHH------hhccccccceeeeee-eeEEEe
Confidence            44668889999999999999999998      999999999999999 786544


No 35 
>KOG0091|consensus
Probab=99.05  E-value=2.1e-10  Score=68.60  Aligned_cols=43  Identities=26%  Similarity=0.421  Sum_probs=38.8

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      ..+.|+++++||+.||||||++.      |..+.|..--.||+| +|||.
T Consensus         5 f~yqfrlivigdstvgkssll~~------ft~gkfaelsdptvg-vdffa   47 (213)
T KOG0091|consen    5 FHYQFRLIVIGDSTVGKSSLLRY------FTEGKFAELSDPTVG-VDFFA   47 (213)
T ss_pred             eEEEEEEEEEcCCcccHHHHHHH------HhcCcccccCCCccc-hHHHH
Confidence            35789999999999999999997      999999998899999 88764


No 36 
>PF00071 Ras:  Ras family;  InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases. This superfamily contains proteins that control a vast number of important processes and possess a common, structurally preserved GTP-binding domain [, ]. Sequence comparisons of small G proteins from various species have revealed that they are conserved in primary structures at the level of 30-55% similarity []. Crystallographic analysis of various small G proteins revealed the presence of a 20 kDa catalytic domain that is unique for the whole superfamily [, ]. The domain is built of five alpha helices (A1-A5), six beta-strands (B1-B6) and five polypeptide loops (G1-G5). A structural comparison of the GTP- and GDP-bound form, allows one to distinguish two functional loop regions: switch I and switch II that surround the gamma-phosphate group of the nucleotide. The G1 loop (also called the P-loop) that connects the B1 strand and the A1 helix is responsible for the binding of the phosphate groups. The G3 loop provides residues for Mg(2+) and phosphate binding and is located at the N terminus of the A2 helix. The G1 and G3 loops are sequentially similar to Walker A and Walker B boxes that are found in other nucleotide binding motifs. The G2 loop connects the A1 helix and the B2 strand and contains a conserved Thr residue responsible for Mg(2+) binding. The guanine base is recognised by the G4 and G5 loops. The consensus sequence NKXD of the G4 loop contains Lys and Asp residues directly interacting with the nucleotide. Part of the G5 loop located between B6 and A5 acts as a recognition site for the guanine base []. The small GTPase superfamily can be divided into at least 8 different families, including:  Arf small GTPases. GTP-binding proteins involved in protein trafficking by modulating vesicle budding and uncoating within the Golgi apparatus. Ran small GTPases. GTP-binding proteins involved in nucleocytoplasmic transport. Required for the import of proteins into the nucleus and also for RNA export. Rab small GTPases. GTP-binding proteins involved in vesicular traffic. Rho small GTPases. GTP-binding proteins that control cytoskeleton reorganisation. Ras small GTPases. GTP-binding proteins involved in signalling pathways. Sar1 small GTPases. Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). Mitochondrial Rho (Miro). Small GTPase domain found in mitochondrial proteins involved in mitochondrial trafficking. Roc small GTPases domain. Small GTPase domain always found associated with the COR domain. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction; PDB: 1M7B_A 2V55_B 3EG5_C 3LAW_A 1YHN_A 1T91_B 1HE8_B 3SEA_B 3T5G_A 1XTS_A ....
Probab=99.05  E-value=1.8e-10  Score=65.97  Aligned_cols=42  Identities=40%  Similarity=0.528  Sum_probs=35.7

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKD   62 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~   62 (65)
                      ||+++|+.+||||+|+.+      |..+.|...+.||++ .+.+...+.
T Consensus         1 Ki~vvG~~~vGKtsl~~~------~~~~~~~~~~~~t~~-~~~~~~~~~   42 (162)
T PF00071_consen    1 KIVVVGDSGVGKTSLINR------LINGEFPENYIPTIG-IDSYSKEVS   42 (162)
T ss_dssp             EEEEEESTTSSHHHHHHH------HHHSSTTSSSETTSS-EEEEEEEEE
T ss_pred             CEEEECCCCCCHHHHHHH------HHhhccccccccccc-ccccccccc
Confidence            899999999999999998      888888899999985 476665554


No 37 
>cd04136 Rap_like Rap-like subfamily.  The Rap subfamily consists of the Rap1, Rap2, and RSR1.  Rap subfamily proteins perform different cellular functions, depending on the isoform and its subcellular localization. For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules.  Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and microsomal membrane of the pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts.   Rap1 localizes in the nucleus of human oropharyngeal squamous cell carcinomas (SCCs) and cell lines.  Rap1 plays a role in phagocytosis by controlling the binding of adhesion receptors (typically integrins) to their ligands.  In yeast, Rap1 has been implicated in multiple functions, including activation and silencing of transcription and maintenance of telomeres. 
Probab=99.05  E-value=2.6e-10  Score=65.10  Aligned_cols=40  Identities=33%  Similarity=0.432  Sum_probs=33.3

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY   60 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~   60 (65)
                      +|++++|+.|||||||+.+      +..+.|...+.||++  +.+...
T Consensus         2 ~ki~i~G~~~vGKTsl~~~------~~~~~~~~~~~~t~~--~~~~~~   41 (163)
T cd04136           2 YKVVVLGSGGVGKSALTVQ------FVQGIFVEKYDPTIE--DSYRKQ   41 (163)
T ss_pred             eEEEEECCCCCCHHHHHHH------HHhCCCCcccCCchh--hhEEEE
Confidence            7999999999999999997      777778888888876  555543


No 38 
>cd04102 RabL3 RabL3 (Rab-like3) subfamily.  RabL3s are novel proteins that have high sequence similarity with Rab family members, but display features that are distinct from Rabs, and have been termed Rab-like.  As in other Rab-like proteins, RabL3 lacks a prenylation site at the C-terminus.  The specific function of RabL3 remains unknown.
Probab=99.05  E-value=4.6e-10  Score=68.03  Aligned_cols=34  Identities=38%  Similarity=0.502  Sum_probs=31.5

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +|++++|++|||||||+.+      |..+.|...+.||++
T Consensus         1 vKIvlvGd~gVGKTSLi~~------~~~~~f~~~~~~Tig   34 (202)
T cd04102           1 VRVLVVGDSGVGKSSLVHL------ICKNQVLGRPSWTVG   34 (202)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHcCCCCCCCCccee
Confidence            4899999999999999998      888889888999998


No 39 
>cd04117 Rab15 Rab15 subfamily.  Rab15 colocalizes with the transferrin receptor in early endosome compartments, but not with late endosomal markers. It codistributes with Rab4 and Rab5 on early/sorting endosomes, and with Rab11 on pericentriolar recycling endosomes. It is believed to function as an inhibitory GTPase that regulates distinct steps in early endocytic trafficking.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to
Probab=99.04  E-value=6e-10  Score=64.37  Aligned_cols=38  Identities=29%  Similarity=0.614  Sum_probs=33.0

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQY   57 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~   57 (65)
                      +|++++|++|+|||+|+.+      +..+.|...+.||++ .+.+
T Consensus         1 ~ki~vvG~~~~GKTsli~~------~~~~~~~~~~~~t~~-~~~~   38 (161)
T cd04117           1 FRLLLIGDSGVGKTCLLCR------FTDNEFHSSHISTIG-VDFK   38 (161)
T ss_pred             CEEEEECcCCCCHHHHHHH------HhcCCCCCCCCCcee-eEEE
Confidence            5899999999999999998      888888888999998 4444


No 40 
>PLN00023 GTP-binding protein; Provisional
Probab=99.04  E-value=6.9e-10  Score=71.78  Aligned_cols=45  Identities=24%  Similarity=0.285  Sum_probs=37.7

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      .....+||+++|++|||||||+.+      |..+.|...+.||+| .+++.+
T Consensus        17 ~~~~~iKIVLLGdsGVGKTSLI~r------f~~g~F~~~~~pTIG-~d~~ik   61 (334)
T PLN00023         17 PPCGQVRVLVVGDSGVGKSSLVHL------IVKGSSIARPPQTIG-CTVGVK   61 (334)
T ss_pred             CCccceEEEEECCCCCcHHHHHHH------HhcCCcccccCCcee-eeEEEE
Confidence            445679999999999999999998      888889889999998 455433


No 41 
>cd04111 Rab39 Rab39 subfamily.  Found in eukaryotes, Rab39 is mainly found in epithelial cell lines, but is distributed widely in various human tissues and cell lines.  It is believed to be a novel Rab protein involved in regulating Golgi-associated vesicular transport during cellular endocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.   Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=99.03  E-value=6.9e-10  Score=67.13  Aligned_cols=43  Identities=26%  Similarity=0.420  Sum_probs=35.5

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK   61 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~   61 (65)
                      .+||+++|+++||||+|+.+      +..+.|...+.||++ .|++...+
T Consensus         2 ~~KIvvvG~~~vGKTsLi~~------l~~~~~~~~~~~ti~-~d~~~~~i   44 (211)
T cd04111           2 QFRLIVIGDSTVGKSSLLKR------FTEGRFAEVSDPTVG-VDFFSRLI   44 (211)
T ss_pred             ceEEEEECCCCCCHHHHHHH------HHcCCCCCCCCceec-eEEEEEEE
Confidence            58999999999999999997      777778888889987 56655433


No 42 
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases. Ran GTPase is involved in diverse biological functions, such as nuclear transport, spindle formation during mitosis, DNA replication, and cell division.  Among the Ras superfamily, Ran is a unique small G protein.  It does not have a lipid modification motif at the C-terminus to bind to the membrane, which is often observed within the Ras superfamily.  Ran may therefore interact with a wide range of proteins in various intracellular locations.  Like other GTPases, Ran exists in GTP- and GDP-bound conformations that interact differently with effectors.  Conversion between these forms and the assembly or disassembly of effector complexes requires the interaction of regulator proteins.  The intrinsic GTPase activity of Ran is very low, but it is greatly stimulated by a GTPase-activating protein (RanGAP1) located in the cytoplasm. By contrast, RCC1, a guanine nucleotide exchange factor that generates RanGTP, is
Probab=99.03  E-value=6.1e-10  Score=64.76  Aligned_cols=39  Identities=26%  Similarity=0.292  Sum_probs=32.9

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      +|++++|++|||||||+.+      +..+.+...+.||++ ++.+.
T Consensus         1 ~ki~vvG~~~vGKTsli~~------~~~~~~~~~~~~t~~-~~~~~   39 (166)
T cd00877           1 FKLVLVGDGGTGKTTFVKR------HLTGEFEKKYVATLG-VEVHP   39 (166)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHhCCCCCCCCCcee-eEEEE
Confidence            5899999999999999997      777788888889987 45443


No 43 
>cd04110 Rab35 Rab35 subfamily.  Rab35 is one of several Rab proteins to be found to participate in the regulation of osteoclast cells in rats. In addition, Rab35 has been identified as a protein that interacts with nucleophosmin-anaplastic lymphoma kinase (NPM-ALK) in human cells.  Overexpression of NPM-ALK is a key oncogenic event in some anaplastic large-cell lymphomas; since Rab35 interacts with N|PM-ALK, it may provide a target for cancer treatments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is 
Probab=99.02  E-value=8.3e-10  Score=65.96  Aligned_cols=41  Identities=24%  Similarity=0.421  Sum_probs=34.6

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQY   57 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~   57 (65)
                      +..+|++++|++|||||||+.+      |..+.|...+.||++ ++..
T Consensus         4 ~~~~kivvvG~~~vGKTsli~~------l~~~~~~~~~~~t~~-~~~~   44 (199)
T cd04110           4 DHLFKLLIIGDSGVGKSSLLLR------FADNTFSGSYITTIG-VDFK   44 (199)
T ss_pred             CceeEEEEECCCCCCHHHHHHH------HhcCCCCCCcCcccc-ceeE
Confidence            4569999999999999999998      888888888889987 4543


No 44 
>PTZ00369 Ras-like protein; Provisional
Probab=99.01  E-value=5.7e-10  Score=66.06  Aligned_cols=40  Identities=35%  Similarity=0.442  Sum_probs=34.4

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      .+|++++|++|||||||+.+      |..+.|...+.||++  +.|.+
T Consensus         5 ~~Ki~iiG~~~~GKTsLi~~------~~~~~~~~~~~~t~~--~~~~~   44 (189)
T PTZ00369          5 EYKLVVVGGGGVGKSALTIQ------FIQNHFIDEYDPTIE--DSYRK   44 (189)
T ss_pred             ceEEEEECCCCCCHHHHHHH------HhcCCCCcCcCCchh--hEEEE
Confidence            58999999999999999998      888888888888887  55554


No 45 
>cd04119 RJL RJL (RabJ-Like) subfamily.  RJLs are found in many protists and as chimeras with C-terminal DNAJ domains in deuterostome metazoa. They are not found in plants, fungi, and protostome metazoa, suggesting a horizontal gene transfer between protists and deuterostome metazoa.  RJLs lack any known membrane targeting signal and contain a degenerate phosphate/magnesium-binding 3 (PM3) motif, suggesting an impaired ability to hydrolyze GTP.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.
Probab=99.01  E-value=7.9e-10  Score=63.08  Aligned_cols=38  Identities=26%  Similarity=0.457  Sum_probs=32.5

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQY   57 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~   57 (65)
                      +|++++|+++||||||+.+      +..+.|...+.||++ .+..
T Consensus         1 ~ki~~vG~~~vGKTsli~~------l~~~~~~~~~~~t~~-~~~~   38 (168)
T cd04119           1 IKVISMGNSGVGKSCIIKR------YCEGRFVSKYLPTIG-IDYG   38 (168)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHhCCCCCCCCCccc-eeEE
Confidence            4899999999999999998      888888888899987 4443


No 46 
>cd04122 Rab14 Rab14 subfamily.  Rab14 GTPases are localized to biosynthetic compartments, including the rough ER, the Golgi complex, and the trans-Golgi network, and to endosomal compartments, including early endosomal vacuoles and associated vesicles.  Rab14 is believed to function in both the biosynthetic and recycling pathways between the Golgi and endosomal compartments.  Rab14 has also been identified on GLUT4 vesicles, and has been suggested to help regulate GLUT4 translocation.  In addition, Rab14 is believed to play a role in the regulation of phagocytosis.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GT
Probab=99.01  E-value=8.9e-10  Score=63.60  Aligned_cols=35  Identities=23%  Similarity=0.450  Sum_probs=31.1

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      .+|++++|+.+||||||+.+      +..+.|...+.||++
T Consensus         2 ~~ki~iiG~~~vGKTsli~~------~~~~~~~~~~~~t~~   36 (166)
T cd04122           2 IFKYIIIGDMGVGKSCLLHQ------FTEKKFMADCPHTIG   36 (166)
T ss_pred             ceEEEEECCCCCCHHHHHHH------HhcCCCCCCCCcccc
Confidence            48999999999999999998      888888888888876


No 47 
>cd04134 Rho3 Rho3 subfamily.  Rho3 is a member of the Rho family found only in fungi.  Rho3 is believed to regulate cell polarity by interacting with the diaphanous/formin family protein For3 to control both the actin cytoskeleton and microtubules.  Rho3 is also believed to have a direct role in exocytosis that is independent of its role in regulating actin polarity.  The function in exocytosis may be two-pronged: first, in the transport of post-Golgi vesicles from the mother cell to the bud, mediated by myosin (Myo2); second, in the docking and fusion of vesicles to the plasma membrane, mediated by an exocyst (Exo70) protein.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.
Probab=99.00  E-value=7.6e-10  Score=65.60  Aligned_cols=38  Identities=37%  Similarity=0.524  Sum_probs=33.2

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      .|++++|++|||||+|+.+      |..+.|...|.||++  +.|.
T Consensus         1 ~kivivG~~~vGKTsli~~------~~~~~~~~~~~~t~~--~~~~   38 (189)
T cd04134           1 RKVVVLGDGACGKTSLLNV------FTRGYFPQVYEPTVF--ENYV   38 (189)
T ss_pred             CEEEEECCCCCCHHHHHHH------HhcCCCCCccCCcce--eeeE
Confidence            3899999999999999998      888888888999987  5554


No 48 
>cd04176 Rap2 Rap2 subgroup.  The Rap2 subgroup is part of the Rap subfamily of the Ras family.  It consists of Rap2a, Rap2b, and Rap2c.  Both isoform 3 of the human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4) and Traf2- and Nck-interacting kinase (TNIK) are putative effectors of Rap2 in mediating the activation of c-Jun N-terminal kinase (JNK) to regulate the actin cytoskeleton.  In human platelets, Rap2 was shown to interact with the cytoskeleton by binding the actin filaments.  In embryonic Xenopus development, Rap2 is necessary for the Wnt/beta-catenin signaling pathway.  The Rap2 interacting protein 9 (RPIP9) is highly expressed in human breast carcinomas and correlates with a poor prognosis, suggesting a role for Rap2 in breast cancer oncogenesis.  Rap2b, but not Rap2a, Rap2c, Rap1a, or Rap1b, is expressed in human red blood cells, where it is believed to be involved in vesiculation.  A number of additional effector proteins for Rap2 have been identified, incl
Probab=99.00  E-value=5.7e-10  Score=63.99  Aligned_cols=40  Identities=33%  Similarity=0.420  Sum_probs=34.1

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY   60 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~   60 (65)
                      +|++++|++|||||+|+.+      +..+.|...+.||++  +++...
T Consensus         2 ~ki~i~G~~~vGKTsl~~~------~~~~~~~~~~~~t~~--~~~~~~   41 (163)
T cd04176           2 YKVVVLGSGGVGKSALTVQ------FVSGTFIEKYDPTIE--DFYRKE   41 (163)
T ss_pred             eEEEEECCCCCCHHHHHHH------HHcCCCCCCCCCchh--heEEEE
Confidence            7999999999999999998      888888888888876  665543


No 49 
>KOG0395|consensus
Probab=99.00  E-value=2.6e-10  Score=68.98  Aligned_cols=45  Identities=29%  Similarity=0.348  Sum_probs=41.8

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEEe
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT   63 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~i   63 (65)
                      ..+|++++|.+|||||+|..+      |..+.|...|.||++  |+|++.+.+
T Consensus         2 ~~~kvvvlG~~gVGKSal~~q------f~~~~f~~~y~ptie--d~y~k~~~v   46 (196)
T KOG0395|consen    2 REYKVVVLGAGGVGKSALTIQ------FLTGRFVEDYDPTIE--DSYRKELTV   46 (196)
T ss_pred             CceEEEEECCCCCCcchheee------ecccccccccCCCcc--ccceEEEEE
Confidence            358999999999999999998      999999999999999  999988875


No 50 
>PTZ00132 GTP-binding nuclear protein Ran; Provisional
Probab=99.00  E-value=1.1e-09  Score=65.89  Aligned_cols=44  Identities=23%  Similarity=0.297  Sum_probs=36.1

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      .....+|++++|++|+|||||+.+      +..+.|...|.||++ ++...
T Consensus         5 ~~~~~~kv~liG~~g~GKTtLi~~------~~~~~~~~~~~~t~~-~~~~~   48 (215)
T PTZ00132          5 DEVPEFKLILVGDGGVGKTTFVKR------HLTGEFEKKYIPTLG-VEVHP   48 (215)
T ss_pred             cCCCCceEEEECCCCCCHHHHHHH------HHhCCCCCCCCCccc-eEEEE
Confidence            345568999999999999999987      777888888999998 45543


No 51 
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2.  Rab8/Sec4/Ypt2 are known or suspected to be involved in post-Golgi transport to the plasma membrane. It is likely that these Rabs have functions that are specific to the mammalian lineage and have no orthologs in plants. Rab8 modulates polarized membrane transport through reorganization of actin and microtubules, induces the formation of new surface extensions, and has an important role in directed membrane transport to cell surfaces. The Ypt2 gene of the fission yeast Schizosaccharomyces pombe encodes a member of the Ypt/Rab family of small GTP-binding proteins, related in sequence to Sec4p of Saccharomyces cerevisiae but closer to mammalian Rab8.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhi
Probab=98.98  E-value=1e-09  Score=63.44  Aligned_cols=36  Identities=28%  Similarity=0.428  Sum_probs=32.1

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +.+||+++|+++||||+|+.+      +..+.|...|.||++
T Consensus         2 ~~~ki~vvG~~~~GKSsl~~~------~~~~~f~~~~~~t~~   37 (167)
T cd01867           2 YLFKLLLIGDSGVGKSCLLLR------FSEDSFNPSFISTIG   37 (167)
T ss_pred             cceEEEEECCCCCCHHHHHHH------HhhCcCCcccccCcc
Confidence            458999999999999999998      888888888888887


No 52 
>cd04175 Rap1 Rap1 subgroup.  The Rap1 subgroup is part of the Rap subfamily of the Ras family.  It can be further divided into the Rap1a and Rap1b isoforms.  In humans, Rap1a and Rap1b share 95% sequence homology, but are products of two different genes located on chromosomes 1 and 12, respectively.  Rap1a is sometimes called smg p21 or Krev1 in the older literature.  Rap1 proteins are believed to perform different cellular functions, depending on the isoform, its subcellular localization, and the effector proteins it binds.  For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules.  Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and the microsomal membrane of pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts.  High expression of Rap1 has been observed in the n
Probab=98.98  E-value=8.2e-10  Score=63.47  Aligned_cols=38  Identities=34%  Similarity=0.475  Sum_probs=32.4

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      +|++++|+.|||||||+.+      +..+.|...+.||++  +.+.
T Consensus         2 ~ki~~~G~~~~GKTsli~~------~~~~~~~~~~~~t~~--~~~~   39 (164)
T cd04175           2 YKLVVLGSGGVGKSALTVQ------FVQGIFVEKYDPTIE--DSYR   39 (164)
T ss_pred             cEEEEECCCCCCHHHHHHH------HHhCCCCcccCCcch--heEE
Confidence            7999999999999999997      777778888888887  5444


No 53 
>cd04130 Wrch_1 Wrch-1 subfamily.  Wrch-1 (Wnt-1 responsive Cdc42 homolog) is a Rho family GTPase that shares significant sequence and functional similarity with Cdc42.  Wrch-1 was first identified in mouse mammary epithelial cells, where its transcription is upregulated in Wnt-1 transformation.  Wrch-1 contains N- and C-terminal extensions relative to cdc42, suggesting potential differences in cellular localization and function.  The Wrch-1 N-terminal extension contains putative SH3 domain-binding motifs and has been shown to bind the SH3 domain-containing protein Grb2, which increases the level of active Wrch-1 in cells.  Unlike Cdc42, which localizes to the cytosol and perinuclear membranes, Wrch-1 localizes extensively with the plasma membrane and endosomes.  The membrane association, localization, and biological activity of Wrch-1 indicate an atypical model of regulation distinct from other Rho family GTPases.  Most Rho proteins contain a lipid modification site at the C-terminus, 
Probab=98.97  E-value=1.3e-09  Score=63.50  Aligned_cols=39  Identities=46%  Similarity=0.767  Sum_probs=33.7

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      +|++++|++|+|||+|+.+      |..+.|..+|.||+.  +.|..
T Consensus         1 ~k~~i~G~~~~GKtsl~~~------~~~~~~~~~~~~t~~--~~~~~   39 (173)
T cd04130           1 LKCVLVGDGAVGKTSLIVS------YTTNGYPTEYVPTAF--DNFSV   39 (173)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHhCCCCCCCCCcee--eeeeE
Confidence            5899999999999999998      888888888999986  66654


No 54 
>cd01865 Rab3 Rab3 subfamily.  The Rab3 subfamily contains Rab3A, Rab3B, Rab3C, and Rab3D.  All four isoforms were found in mouse brain and endocrine tissues, with varying levels of expression.  Rab3A, Rab3B, and Rab3C localized to synaptic and secretory vesicles; Rab3D was expressed at high levels only in adipose tissue, exocrine glands, and the endocrine pituitary, where it is localized to cytoplasmic secretory granules.  Rab3 appears to control Ca2+-regulated exocytosis. The appropriate GDP/GTP exchange cycle of Rab3A is required for Ca2+-regulated exocytosis to occur, and interaction of the GTP-bound form of Rab3A with effector molecule(s) is widely believed to be essential for this process. Functionally, most studies point toward a role for Rab3 in the secretion of hormones and neurotransmitters. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promot
Probab=98.97  E-value=1.9e-09  Score=62.23  Aligned_cols=37  Identities=30%  Similarity=0.463  Sum_probs=32.4

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEee
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQ   56 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~   56 (65)
                      +|++++|+.+||||+|+.+      +..+.|...|.||++ +++
T Consensus         2 ~ki~i~G~~~~GKSsli~~------l~~~~~~~~~~~t~~-~~~   38 (165)
T cd01865           2 FKLLIIGNSSVGKTSFLFR------YADDSFTSAFVSTVG-IDF   38 (165)
T ss_pred             eEEEEECCCCCCHHHHHHH------HhcCCCCCCCCCcee-eEE
Confidence            7999999999999999998      888888888889887 443


No 55 
>cd01870 RhoA_like RhoA-like subfamily.  The RhoA subfamily consists of RhoA, RhoB, and RhoC.  RhoA promotes the formation of stress fibers and focal adhesions, regulating cell shape, attachment, and motility.  RhoA can bind to multiple effector proteins, thereby triggering different downstream responses.  In many cell types, RhoA mediates local assembly of the contractile ring, which is necessary for cytokinesis.  RhoA is vital for muscle contraction; in vascular smooth muscle cells, RhoA plays a key role in cell contraction, differentiation, migration, and proliferation.  RhoA activities appear to be elaborately regulated in a time- and space-dependent manner to control cytoskeletal changes.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  RhoA and RhoC are observed only in geranyl
Probab=98.96  E-value=1.2e-09  Score=63.31  Aligned_cols=34  Identities=47%  Similarity=0.586  Sum_probs=30.6

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      .|++++|++|||||+|+.+      |..+.|...|.||++
T Consensus         2 ~ki~iiG~~~~GKTsl~~~------~~~~~~~~~~~~t~~   35 (175)
T cd01870           2 KKLVIVGDGACGKTCLLIV------FSKDQFPEVYVPTVF   35 (175)
T ss_pred             cEEEEECCCCCCHHHHHHH------HhcCCCCCCCCCccc
Confidence            6899999999999999998      888888888888877


No 56 
>KOG0081|consensus
Probab=98.96  E-value=3.2e-11  Score=71.90  Aligned_cols=48  Identities=27%  Similarity=0.311  Sum_probs=42.2

Q ss_pred             CCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEE
Q psy15257          7 QPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYK   61 (65)
Q Consensus         7 ~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~   61 (65)
                      ..+++.+|.+.+||+||||||++.+      |..+.|...+++|+| |||-.+.+
T Consensus         4 GdydylikfLaLGDSGVGKTs~Ly~------YTD~~F~~qFIsTVG-IDFreKrv   51 (219)
T KOG0081|consen    4 GDYDYLIKFLALGDSGVGKTSFLYQ------YTDGKFNTQFISTVG-IDFREKRV   51 (219)
T ss_pred             ccHHHHHHHHhhccCCCCceEEEEE------ecCCcccceeEEEee-cccccceE
Confidence            4567888999999999999999998      999999999999999 88765543


No 57 
>cd04143 Rhes_like Rhes_like subfamily.  This subfamily includes Rhes (Ras homolog enriched in striatum) and Dexras1/AGS1 (activator of G-protein signaling 1).  These proteins are homologous, but exhibit significant differences in tissue distribution and subcellular localization.  Rhes is found primarily in the striatum of the brain, but is also expressed in other areas of the brain, such as the cerebral cortex, hippocampus, inferior colliculus, and cerebellum.  Rhes expression is controlled by thyroid hormones.  In rat PC12 cells, Rhes is farnesylated and localizes to the plasma membrane.  Rhes binds and activates PI3K, and plays a role in coupling serpentine membrane receptors with heterotrimeric G-protein signaling.  Rhes has recently been shown to be reduced under conditions of dopamine supersensitivity and may play a role in determining dopamine receptor sensitivity.  Dexras1/AGS1 is a dexamethasone-induced Ras protein that is expressed primarily in the brain, with low expression l
Probab=98.95  E-value=7.8e-10  Score=68.67  Aligned_cols=40  Identities=28%  Similarity=0.343  Sum_probs=34.4

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY   60 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~   60 (65)
                      +|++++|+.|||||||+.+      |..+.|...|.||++  |++...
T Consensus         1 ~KVvvlG~~gvGKTSLi~r------~~~~~f~~~y~pTi~--d~~~k~   40 (247)
T cd04143           1 YRMVVLGASKVGKTAIVSR------FLGGRFEEQYTPTIE--DFHRKL   40 (247)
T ss_pred             CEEEEECcCCCCHHHHHHH------HHcCCCCCCCCCChh--HhEEEE
Confidence            5899999999999999998      888888888999997  666543


No 58 
>cd04103 Centaurin_gamma Centaurin gamma.  The centaurins (alpha, beta, gamma, and delta) are large, multi-domain proteins that all contain an ArfGAP domain and ankyrin repeats, and in some cases, numerous additional domains.  Centaurin gamma contains an additional GTPase domain near its N-terminus.  The specific function of this GTPase domain has not been well characterized, but centaurin gamma 2 (CENTG2) may play a role in the development of autism.  Centaurin gamma 1 is also called PIKE (phosphatidyl inositol (PI) 3-kinase enhancer) and centaurin gamma 2 is also known as AGAP (ArfGAP protein with a GTPase-like domain, ankyrin repeats and a Pleckstrin homology domain) or GGAP.  Three isoforms of PIKE have been identified. PIKE-S (short) and PIKE-L (long) are brain-specific isoforms, with PIKE-S restricted to the nucleus and PIKE-L found in multiple cellular compartments.  A third isoform, PIKE-A was identified in human glioblastoma brain cancers and has been found in various tissues. 
Probab=98.95  E-value=1.3e-09  Score=63.27  Aligned_cols=32  Identities=22%  Similarity=0.339  Sum_probs=26.6

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccce
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPT   50 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~t   50 (65)
                      +|++++|++|||||+|+.+      |..+.|...+.|+
T Consensus         1 ~ki~vvG~~gvGKTsli~~------~~~~~f~~~~~~~   32 (158)
T cd04103           1 LKLGIVGNLQSGKSALVHR------YLTGSYVQLESPE   32 (158)
T ss_pred             CEEEEECCCCCcHHHHHHH------HHhCCCCCCCCCC
Confidence            4899999999999999997      7777776666554


No 59 
>cd04135 Tc10 TC10 subfamily.  TC10 is a Rho family protein that has been shown to induce microspike formation and neurite outgrowth in vitro.  Its expression changes dramatically after peripheral nerve injury, suggesting an important role in promoting axonal outgrowth and regeneration.  TC10 regulates translocation of insulin-stimulated GLUT4 in adipocytes and has also been shown to bind directly to Golgi COPI coat proteins.  GTP-bound TC10 in vitro can bind numerous potential effectors.  Depending on its subcellular localization and distinct functional domains, TC10 can differentially regulate two types of filamentous actin in adipocytes.  TC10 mRNAs are highly expressed in three types of mouse muscle tissues:  leg skeletal muscle, cardiac muscle, and uterus; they were also present in brain, with higher levels in adults than in newborns.  TC10 has also been shown to play a role in regulating the expression of cystic fibrosis transmembrane conductance regulator (CFTR) through interacti
Probab=98.95  E-value=1.8e-09  Score=62.44  Aligned_cols=39  Identities=49%  Similarity=0.778  Sum_probs=33.0

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      +|++++|+.++|||+|+.+      |..+.|...+.||++  +.+..
T Consensus         1 ~ki~i~G~~~~GKTsl~~~------~~~~~~~~~~~~t~~--~~~~~   39 (174)
T cd04135           1 LKCVVVGDGAVGKTCLLMS------YANDAFPEEYVPTVF--DHYAV   39 (174)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHhCCCCCCCCCcee--eeeEE
Confidence            5899999999999999997      888888888888887  55543


No 60 
>cd04101 RabL4 RabL4 (Rab-like4) subfamily.  RabL4s are novel proteins that have high sequence similarity with Rab family members, but display features that are distinct from Rabs, and have been termed Rab-like.  As in other Rab-like proteins, RabL4 lacks a prenylation site at the C-terminus.  The specific function of RabL4 remains unknown.
Probab=98.95  E-value=2.5e-09  Score=61.30  Aligned_cols=40  Identities=30%  Similarity=0.358  Sum_probs=32.1

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccc--cccccccceEEEEeeEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLS--QLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~--~~~~~~~~ti~~vd~~~~   59 (65)
                      +|++++|++|+|||+|+.+      +..+  .|..+|.||++ .+.+..
T Consensus         1 ~ki~vvG~~~~GKtsl~~~------l~~~~~~~~~~~~~t~~-~~~~~~   42 (164)
T cd04101           1 LRCAVVGDPAVGKTAFVQM------FHSNGAVFPKNYLMTTG-CDFVVK   42 (164)
T ss_pred             CEEEEECCCCCCHHHHHHH------HhcCCCCcCccCCCceE-EEEEEE
Confidence            4899999999999999997      6543  67888999997 455443


No 61 
>cd04116 Rab9 Rab9 subfamily.  Rab9 is found in late endosomes, together with mannose 6-phosphate receptors (MPRs) and the tail-interacting protein of 47 kD (TIP47).  Rab9 is a key mediator of vesicular transport from late endosomes to the trans-Golgi network (TGN) by redirecting the MPRs.  Rab9 has been identified as a key component for the replication of several viruses, including HIV1, Ebola, Marburg, and measles, making it a potential target for inhibiting a variety of viruses.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CX
Probab=98.94  E-value=4.1e-09  Score=60.85  Aligned_cols=41  Identities=24%  Similarity=0.382  Sum_probs=34.0

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQY   57 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~   57 (65)
                      ...+|++++|+++||||+|+.+      +..+.|...+.|+++ ++++
T Consensus         3 ~~~~ki~vvG~~~~GKTsli~~------~~~~~~~~~~~~~~~-~~~~   43 (170)
T cd04116           3 SSLLKVILLGDGGVGKSSLMNR------YVTNKFDTQLFHTIG-VEFL   43 (170)
T ss_pred             ceEEEEEEECCCCCCHHHHHHH------HHcCCCCcCcCCcee-eEEE
Confidence            3568999999999999999997      777888887888887 4443


No 62 
>cd01864 Rab19 Rab19 subfamily.  Rab19 proteins are associated with Golgi stacks. Similarity analysis indicated that Rab41 is closely related to Rab19. However, the function of these Rabs is not yet chracterized. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=98.94  E-value=2.7e-09  Score=61.45  Aligned_cols=36  Identities=25%  Similarity=0.325  Sum_probs=30.5

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +.+|++++|++|+|||+|+.+      +..+.|...+.++++
T Consensus         2 ~~~kv~vvG~~~~GKTsli~~------l~~~~~~~~~~~t~~   37 (165)
T cd01864           2 FLFKIILIGDSNVGKTCVVQR------FKSGTFSERQGNTIG   37 (165)
T ss_pred             ceeEEEEECCCCCCHHHHHHH------HhhCCCcccCCCccc
Confidence            468999999999999999997      776777777777776


No 63 
>cd04140 ARHI_like ARHI subfamily.  ARHI (A Ras homolog member I) is a member of the Ras family with several unique structural and functional properties.  ARHI is expressed in normal human ovarian and breast tissue, but its expression is decreased or eliminated in breast and ovarian cancer.  ARHI contains an N-terminal extension of 34 residues (human) that is required to retain its tumor suppressive activity.   Unlike most other Ras family members, ARHI is maintained in the constitutively active (GTP-bound) state in resting cells and has modest GTPase activity.  ARHI inhibits STAT3 (signal transducers and activators of transcription 3), a latent transcription factor whose abnormal activation plays a critical role in oncogenesis.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.  Due to
Probab=98.93  E-value=1.9e-09  Score=62.29  Aligned_cols=38  Identities=32%  Similarity=0.521  Sum_probs=32.8

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      +||+++|++|||||+|+.+      +..+.|...+.||++  +.|.
T Consensus         2 ~kv~~vG~~~vGKTsli~~------~~~~~f~~~~~~t~~--~~~~   39 (165)
T cd04140           2 YRVVVFGAGGVGKSSLVLR------FVKGTFRESYIPTIE--DTYR   39 (165)
T ss_pred             eEEEEECCCCCCHHHHHHH------HHhCCCCCCcCCcch--heEE
Confidence            7999999999999999998      888888888888887  5554


No 64 
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily.  Rab33B is ubiquitously expressed in mouse tissues and cells, where it is localized to the medial Golgi cisternae. It colocalizes with alpha-mannose II.  Together with the other cisternal Rabs, Rab6A and Rab6A', it is believed to regulate the Golgi response to stress and is likely a molecular target in stress-activated signaling pathways. Rab33A (previously known as S10) is expressed primarily in the brain and immune system cells.  In humans, it is located on the X chromosome at Xq26 and its expression is down-regulated in tuberculosis patients. Experimental evidence suggests that Rab33A is a novel CD8+ T cell factor that likely plays a role in tuberculosis disease processes.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine 
Probab=98.93  E-value=3.3e-09  Score=61.60  Aligned_cols=40  Identities=28%  Similarity=0.390  Sum_probs=33.1

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      .+|++++|++|||||+|+.+      +..+.|...+.|+++ .+++.
T Consensus         2 ~~ki~vvG~~~vGKTsli~~------~~~~~~~~~~~~t~~-~~~~~   41 (170)
T cd04115           2 IFKIIVIGDSNVGKTCLTYR------FCAGRFPERTEATIG-VDFRE   41 (170)
T ss_pred             ceEEEEECCCCCCHHHHHHH------HHhCCCCCcccccee-EEEEE
Confidence            47999999999999999998      777788877888887 44443


No 65 
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily.  Rab1 is found in every eukaryote and is a key regulatory component for the transport of vesicles from the ER to the Golgi apparatus. Studies on mutations of Ypt1, the yeast homolog of Rab1, showed that this protein is necessary for the budding of vesicles of the ER as well as for their transport to, and fusion with, the Golgi apparatus. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to t
Probab=98.92  E-value=3e-09  Score=61.22  Aligned_cols=39  Identities=26%  Similarity=0.401  Sum_probs=32.4

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQY   57 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~   57 (65)
                      .+|++++|+++||||+|+.+      +..+.|...+.||++ .++.
T Consensus         2 ~~ki~i~G~~~vGKSsli~~------~~~~~~~~~~~~t~~-~~~~   40 (166)
T cd01869           2 LFKLLLIGDSGVGKSCLLLR------FADDTYTESYISTIG-VDFK   40 (166)
T ss_pred             eEEEEEECCCCCCHHHHHHH------HhcCCCCCCCCCccc-eeEE
Confidence            48999999999999999997      777778778888887 4443


No 66 
>cd04106 Rab23_lke Rab23-like subfamily.  Rab23 is a member of the Rab family of small GTPases. In mouse, Rab23 has been shown to function as a negative regulator in the sonic hedgehog (Shh) signalling pathway. Rab23 mediates the activity of Gli2 and Gli3, transcription factors that regulate Shh signaling in the spinal cord, primarily by preventing Gli2 activation in the absence of Shh ligand. Rab23 also regulates a step in the cytoplasmic signal transduction pathway that mediates the effect of Smoothened (one of two integral membrane proteins that are essential components of the Shh signaling pathway in vertebrates). In humans, Rab23 is expressed in the retina.  Mice contain an isoform that shares 93% sequence identity with the human Rab23 and an alternative splicing isoform that is specific to the brain. This isoform causes the murine open brain phenotype, indicating it may have a role in the development of the central nervous system.  GTPase activating proteins (GAPs) interact with G
Probab=98.92  E-value=3.7e-09  Score=60.37  Aligned_cols=38  Identities=26%  Similarity=0.357  Sum_probs=32.4

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQY   57 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~   57 (65)
                      +|++++|++++|||||+.+      +..+.|...+.||++ .+..
T Consensus         1 ~kv~~vG~~~~GKTsl~~~------~~~~~~~~~~~~t~~-~~~~   38 (162)
T cd04106           1 IKVIVVGNGNVGKSSMIQR------FVKGIFTKDYKKTIG-VDFL   38 (162)
T ss_pred             CEEEEECCCCCCHHHHHHH------HhcCCCCCCCCCcEE-EEEE
Confidence            4899999999999999997      888888888889987 4543


No 67 
>smart00173 RAS Ras subfamily of RAS small GTPases. Similar in fold and function to the bacterial EF-Tu GTPase. p21Ras couples receptor Tyr kinases and G protein receptors  to protein kinase cascades
Probab=98.92  E-value=1.6e-09  Score=62.04  Aligned_cols=38  Identities=34%  Similarity=0.492  Sum_probs=31.3

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      +|++++|++|||||||+.+      +..+.|...+.||+.  +.+.
T Consensus         1 ~ki~v~G~~~~GKTsli~~------~~~~~~~~~~~~t~~--~~~~   38 (164)
T smart00173        1 YKLVVLGSGGVGKSALTIQ------FVQGHFVDDYDPTIE--DSYR   38 (164)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHhCcCCcccCCchh--hhEE
Confidence            5899999999999999997      777777777777776  5554


No 68 
>cd04132 Rho4_like Rho4-like subfamily.  Rho4 is a GTPase that controls septum degradation by regulating secretion of Eng1 or Agn1 during cytokinesis.  Rho4 also plays a role in cell morphogenesis.  Rho4 regulates septation and cell morphology by controlling the actin cytoskeleton and cytoplasmic microtubules.  The localization of Rho4 is modulated by Rdi1, which may function as a GDI, and by Rga9, which is believed to function as a GAP.  In S. pombe, both Rho4 deletion and Rho4 overexpression result in a defective cell wall, suggesting a role for Rho4 in maintaining cell wall integrity.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.
Probab=98.91  E-value=3.2e-09  Score=62.27  Aligned_cols=38  Identities=42%  Similarity=0.576  Sum_probs=32.9

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      .|++++|+.+||||+|+.+      +..+.|...+.||++  +.|.
T Consensus         1 ~ki~vvG~~~vGKTsli~~------l~~~~~~~~~~~t~~--~~~~   38 (187)
T cd04132           1 KKIVVVGDGGCGKTCLLIV------YSQGKFPEEYVPTVF--ENYV   38 (187)
T ss_pred             CeEEEECCCCCCHHHHHHH------HHhCcCCCCCCCeee--eeeE
Confidence            4899999999999999998      888888888899987  5544


No 69 
>cd04125 RabA_like RabA-like subfamily.  RabA was first identified in D. discoideum, where its expression levels were compared to other Rabs in growing and developing cells.  The RabA mRNA levels were below the level of detection by Northern blot analysis, suggesting a very low level of expression.  The function of RabA remains unknown.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=98.91  E-value=3.9e-09  Score=62.20  Aligned_cols=34  Identities=26%  Similarity=0.423  Sum_probs=30.7

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +|++++|+++||||+|+.+      +..+.|...+.||++
T Consensus         1 ~ki~v~G~~~vGKSsli~~------~~~~~~~~~~~~t~~   34 (188)
T cd04125           1 FKVVIIGDYGVGKSSLLKR------FTEDEFSESTKSTIG   34 (188)
T ss_pred             CEEEEECCCCCCHHHHHHH------HhcCCCCCCCCCcee
Confidence            5899999999999999998      888888887888887


No 70 
>cd04142 RRP22 RRP22 subfamily.  RRP22 (Ras-related protein on chromosome 22) subfamily consists of proteins that inhibit cell growth and promote caspase-independent cell death.  Unlike most Ras proteins, RRP22 is down-regulated in many human tumor cells due to promoter methylation.  RRP22 localizes to the nucleolus in a GTP-dependent manner, suggesting a novel function in modulating transport of nucleolar components.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.  Like most Ras family proteins, RRP22 is farnesylated.
Probab=98.90  E-value=2e-09  Score=64.71  Aligned_cols=38  Identities=26%  Similarity=0.413  Sum_probs=31.8

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQY   57 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~   57 (65)
                      +||+++|+++||||||+.+      |..+.|...|.||++ .+.+
T Consensus         1 ~kI~ivG~~~vGKTsLi~~------~~~~~f~~~~~pt~~-~~~~   38 (198)
T cd04142           1 VRVAVLGAPGVGKTAIVRQ------FLAQEFPEEYIPTEH-RRLY   38 (198)
T ss_pred             CEEEEECCCCCcHHHHHHH------HHcCCCCcccCCccc-cccc
Confidence            5899999999999999998      888888888888886 3443


No 71 
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]
Probab=98.89  E-value=4.3e-09  Score=62.96  Aligned_cols=34  Identities=35%  Similarity=0.429  Sum_probs=32.2

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +|++++|+.|+|||||+.+      +..+.|...+.||++
T Consensus         6 ~kivv~G~~g~GKTtl~~~------l~~~~~~~~~~~t~~   39 (219)
T COG1100           6 FKIVVLGDGGVGKTTLLNR------LVGDEFPEGYPPTIG   39 (219)
T ss_pred             EEEEEEcCCCccHHHHHHH------HhcCcCcccCCCcee
Confidence            8999999999999999998      999999999999987


No 72 
>PLN03108 Rab family protein; Provisional
Probab=98.89  E-value=4.3e-09  Score=63.52  Aligned_cols=40  Identities=28%  Similarity=0.421  Sum_probs=32.6

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEee
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQ   56 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~   56 (65)
                      .+.+||+++|+.++|||+|+.+      +..+.|...+.||++ .++
T Consensus         4 ~~~~kivivG~~gvGKStLi~~------l~~~~~~~~~~~ti~-~~~   43 (210)
T PLN03108          4 AYLFKYIIIGDTGVGKSCLLLQ------FTDKRFQPVHDLTIG-VEF   43 (210)
T ss_pred             CcceEEEEECCCCCCHHHHHHH------HHhCCCCCCCCCCcc-ceE
Confidence            3569999999999999999997      777777777778876 344


No 73 
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily.  This subfamily contains R-Ras2/TC21, M-Ras/R-Ras3, and related members of the Ras family. M-Ras is expressed in lympho-hematopoetic cells.  It interacts with some of the known Ras effectors, but appears to also have its own effectors.  Expression of mutated M-Ras leads to transformation of several types of cell lines, including hematopoietic cells, mammary epithelial cells, and fibroblasts.  Overexpression of M-Ras is observed in carcinomas from breast, uterus, thyroid, stomach, colon, kidney, lung, and rectum.  In addition, expression of a constitutively active M-Ras mutant in murine bone marrow induces a malignant mast cell leukemia that is distinct from the monocytic leukemia induced by H-Ras.  TC21, along with H-Ras, has been shown to regulate the branching morphogenesis of ureteric bud cell branching in mice.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an ali
Probab=98.87  E-value=4.3e-09  Score=60.07  Aligned_cols=40  Identities=38%  Similarity=0.414  Sum_probs=32.7

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      .+|++++|++++|||+|+.+      +..+.+...+.||++  +.+..
T Consensus         2 ~~ki~i~G~~~~GKtsl~~~------~~~~~~~~~~~~t~~--~~~~~   41 (164)
T cd04145           2 TYKLVVVGGGGVGKSALTIQ------FIQSYFVTDYDPTIE--DSYTK   41 (164)
T ss_pred             ceEEEEECCCCCcHHHHHHH------HHhCCCCcccCCCcc--ceEEE
Confidence            47999999999999999997      777777777888877  55443


No 74 
>cd04124 RabL2 RabL2 subfamily.  RabL2 (Rab-like2) subfamily.  RabL2s are novel Rab proteins identified recently which display features that are distinct from other Rabs, and have been termed Rab-like. RabL2 contains RabL2a and RabL2b, two very similar Rab proteins that share  98% sequence identity in humans. RabL2b maps to the subtelomeric region of chromosome 22q13.3 and RabL2a maps to 2q13, a region that suggests it is also a subtelomeric gene. Both genes are believed to be expressed ubiquitously, suggesting that RabL2s are the first example of duplicated genes in human proximal subtelomeric regions that are both expressed actively. Like other Rab-like proteins, RabL2s lack a prenylation site at the C-terminus. The specific functions of RabL2a and RabL2b remain unknown.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-b
Probab=98.87  E-value=6.6e-09  Score=59.93  Aligned_cols=34  Identities=29%  Similarity=0.463  Sum_probs=28.6

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +|++++|++|||||||+.+      +..+.|...+.|+++
T Consensus         1 ~ki~vvG~~~vGKTsli~~------~~~~~~~~~~~~~~~   34 (161)
T cd04124           1 VKIILLGDSAVGKSKLVER------FLMDGYEPQQLSTYA   34 (161)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHhCCCCCCcCCcee
Confidence            4899999999999999997      777777777777765


No 75 
>KOG0088|consensus
Probab=98.87  E-value=1.3e-09  Score=65.10  Aligned_cols=55  Identities=24%  Similarity=0.303  Sum_probs=42.5

Q ss_pred             CCCCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEE--------EeeEEEEEEecC
Q psy15257          5 NEQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWA--------IDQYRIYKDTLE   65 (65)
Q Consensus         5 ~~~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~--------vd~~~~~~~i~~   65 (65)
                      ........||++++|+..||||||+.|      |+.+.|...+.+|+-+        ++.-++.+.|||
T Consensus         6 ~~~g~s~~FK~VLLGEGCVGKtSLVLR------y~EnkFn~kHlsTlQASF~~kk~n~ed~ra~L~IWD   68 (218)
T KOG0088|consen    6 NVDGKSFKFKIVLLGEGCVGKTSLVLR------YVENKFNCKHLSTLQASFQNKKVNVEDCRADLHIWD   68 (218)
T ss_pred             cccCCceeeEEEEEcCCccchhHHHHH------HHHhhcchhhHHHHHHHHhhcccccccceeeeeeee
Confidence            344567889999999999999999998      8888888777665431        445666777776


No 76 
>cd01866 Rab2 Rab2 subfamily.  Rab2 is localized on cis-Golgi membranes and interacts with Golgi matrix proteins. Rab2 is also implicated in the maturation of vesicular tubular clusters (VTCs), which are microtubule-associated intermediates in transport between the ER and Golgi apparatus. In plants, Rab2 regulates vesicle trafficking between the ER and the Golgi bodies and is important to pollen tube growth.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key featur
Probab=98.87  E-value=6.9e-09  Score=60.12  Aligned_cols=37  Identities=30%  Similarity=0.426  Sum_probs=31.2

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ...+||+++|+++||||+|+.+      +....+...+.|+++
T Consensus         2 ~~~~ki~vvG~~~vGKSsLl~~------l~~~~~~~~~~~t~~   38 (168)
T cd01866           2 AYLFKYIIIGDTGVGKSCLLLQ------FTDKRFQPVHDLTIG   38 (168)
T ss_pred             CcceEEEEECCCCCCHHHHHHH------HHcCCCCCCCCCccc
Confidence            3458999999999999999997      777777777777776


No 77 
>cd01868 Rab11_like Rab11-like.  Rab11a, Rab11b, and Rab25 are closely related, evolutionary conserved Rab proteins that are differentially expressed. Rab11a is ubiquitously synthesized, Rab11b is enriched in brain and heart and Rab25 is only found in epithelia. Rab11/25 proteins seem to regulate recycling pathways from endosomes to the plasma membrane and to the trans-Golgi network. Furthermore, Rab11a is thought to function in the histamine-induced fusion of tubulovesicles containing H+, K+ ATPase with the plasma membrane in gastric parietal cells and in insulin-stimulated insertion of GLUT4 in the plasma membrane of cardiomyocytes. Overexpression of Rab25 has recently been observed in ovarian cancer and breast cancer, and has been correlated with worsened outcomes in both diseases. In addition, Rab25 overexpression has also been observed in prostate cancer, transitional cell carcinoma of the bladder, and invasive breast tumor cells. GTPase activating proteins (GAPs) interact with GTP
Probab=98.86  E-value=7.1e-09  Score=59.52  Aligned_cols=36  Identities=28%  Similarity=0.429  Sum_probs=30.8

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ..+|++++|+++||||+|+.+      +..+.|...+.|+++
T Consensus         2 ~~~ki~vvG~~~~GKSsli~~------l~~~~~~~~~~~t~~   37 (165)
T cd01868           2 YLFKIVLIGDSGVGKSNLLSR------FTRNEFNLDSKSTIG   37 (165)
T ss_pred             CceEEEEECCCCCCHHHHHHH------HhcCCCCCCCCCccc
Confidence            348999999999999999997      777777777778877


No 78 
>cd04144 Ras2 Ras2 subfamily.  The Ras2 subfamily, found exclusively in fungi, was first identified in Ustilago maydis.  In U. maydis, Ras2 is regulated by Sql2, a protein that is homologous to GEFs (guanine nucleotide exchange factors) of the CDC25 family.  Ras2 has been shown to induce filamentous growth, but the signaling cascade through which Ras2 and Sql2 regulate cell morphology is not known.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.
Probab=98.86  E-value=2.4e-09  Score=63.44  Aligned_cols=37  Identities=46%  Similarity=0.663  Sum_probs=31.3

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      |++++|+.|||||||+.+      |..+.|...+.||++  +.+.
T Consensus         1 ki~ivG~~~vGKTsli~~------l~~~~f~~~~~~t~~--~~~~   37 (190)
T cd04144           1 KLVVLGDGGVGKTALTIQ------LCLNHFVETYDPTIE--DSYR   37 (190)
T ss_pred             CEEEECCCCCCHHHHHHH------HHhCCCCccCCCchH--hhEE
Confidence            689999999999999997      777788888888887  5554


No 79 
>KOG0097|consensus
Probab=98.85  E-value=4.9e-09  Score=61.76  Aligned_cols=47  Identities=17%  Similarity=0.256  Sum_probs=40.1

Q ss_pred             CCCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257          6 EQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus         6 ~~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      +..+.+.||.+++||-|||||||+++      |....|......||| ++|-+.
T Consensus         5 pynysyifkyiiigdmgvgkscllhq------ftekkfmadcphtig-vefgtr   51 (215)
T KOG0097|consen    5 PYNYSYIFKYIIIGDMGVGKSCLLHQ------FTEKKFMADCPHTIG-VEFGTR   51 (215)
T ss_pred             ccchhheEEEEEEccccccHHHHHHH------HHHHHHhhcCCcccc-eeccee
Confidence            45678899999999999999999998      999889888888888 676543


No 80 
>cd04177 RSR1 RSR1 subgroup.  RSR1/Bud1p is a member of the Rap subfamily of the Ras family that is found in fungi.  In budding yeasts, RSR1 is involved in selecting a site for bud growth on the cell cortex, which directs the establishment of cell polarization.  The Rho family GTPase cdc42 and its GEF, cdc24, then establish an axis of polarized growth by organizing the actin cytoskeleton and secretory apparatus at the bud site.  It is believed that cdc42 interacts directly with RSR1 in vivo.  In filamentous fungi, polar growth occurs at the tips of hypha and at novel growth sites along the extending hypha.  In Ashbya gossypii, RSR1 is a key regulator of hyphal growth, localizing at the tip region and regulating in apical polarization of the actin cytoskeleton.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key featu
Probab=98.84  E-value=6.1e-09  Score=60.28  Aligned_cols=39  Identities=33%  Similarity=0.469  Sum_probs=33.1

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      +|++++|++|+|||+|+.+      +..+.|...+.||++  +.+..
T Consensus         2 ~ki~liG~~~~GKTsli~~------~~~~~~~~~~~~t~~--~~~~~   40 (168)
T cd04177           2 YKIVVLGAGGVGKSALTVQ------FVQNVFIESYDPTIE--DSYRK   40 (168)
T ss_pred             eEEEEECCCCCCHHHHHHH------HHhCCCCcccCCcch--heEEE
Confidence            7999999999999999998      888888888888887  55543


No 81 
>cd04113 Rab4 Rab4 subfamily.  Rab4 has been implicated in numerous functions within the cell.  It helps regulate endocytosis through the sorting, recycling, and degradation of early endosomes. Mammalian Rab4 is involved in the regulation of many surface proteins including G-protein-coupled receptors, transferrin receptor, integrins, and surfactant protein A.  Experimental data implicate Rab4 in regulation of the recycling of internalized receptors back to the plasma membrane.  It is also believed to influence receptor-mediated antigen processing in B-lymphocytes, in calcium-dependent exocytosis in platelets, in alpha-amylase secretion in pancreatic cells, and in insulin-induced translocation of Glut4 from internal vesicles to the cell surface. Rab4 is known to share effector proteins with Rab5 and Rab11.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to p
Probab=98.83  E-value=9.6e-09  Score=58.75  Aligned_cols=34  Identities=18%  Similarity=0.317  Sum_probs=28.9

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +|++++|+++||||+|+.+      +..+.+...+.|+++
T Consensus         1 ~ki~v~G~~~vGKTsli~~------l~~~~~~~~~~~~~~   34 (161)
T cd04113           1 FKFIIIGSSGTGKSCLLHR------FVENKFKEDSQHTIG   34 (161)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHhCCCCCCCCCcee
Confidence            5899999999999999997      777777777777766


No 82 
>cd04118 Rab24 Rab24 subfamily.  Rab24 is distinct from other Rabs in several ways.  It exists primarily in the GTP-bound state, having a low intrinsic GTPase activity; it is not efficiently geranyl-geranylated at the C-terminus; it does not form a detectable complex with Rab GDP-dissociation inhibitors (GDIs); and it has recently been shown to undergo tyrosine phosphorylation when overexpressed in vitro. The specific function of Rab24 still remains unknown. It is found in a transport route between ER-cis-Golgi and late endocytic compartments.  It is putatively involved in an autophagic pathway, possibly directing misfolded proteins in the ER to degradative pathways.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilita
Probab=98.83  E-value=9.1e-09  Score=60.70  Aligned_cols=34  Identities=32%  Similarity=0.402  Sum_probs=29.1

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccc-cccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLT-THVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~-~~~~ti~   52 (65)
                      +||+++|+++||||||+.+      +..+.|.. .|.||++
T Consensus         1 ~ki~vvG~~~vGKSsLi~~------~~~~~~~~~~~~~t~~   35 (193)
T cd04118           1 VKVVMLGKESVGKTSLVER------YVHHRFLVGPYQNTIG   35 (193)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHhCCcCCcCccccee
Confidence            4899999999999999997      77777764 6888887


No 83 
>cd04126 Rab20 Rab20 subfamily.  Rab20 is one of several Rab proteins that appear to be restricted in expression to the apical domain of murine polarized epithelial cells.  It is expressed on the apical side of polarized kidney tubule and intestinal epithelial cells, and in non-polarized cells. It also localizes to vesico-tubular structures below the apical brush border of renal proximal tubule cells and in the apical region of duodenal epithelial cells.  Rab20 has also been shown to colocalize with vacuolar H+-ATPases (V-ATPases) in mouse kidney cells, suggesting a role in the regulation of V-ATPase traffic in specific portions of the nephron.  It was also shown to be one of several proteins whose expression is upregulated in human myelodysplastic syndrome (MDS) patients. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bo
Probab=98.82  E-value=7.7e-09  Score=63.39  Aligned_cols=45  Identities=29%  Similarity=0.298  Sum_probs=34.4

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE-----EEEEecC
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR-----IYKDTLE   65 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~-----~~~~i~~   65 (65)
                      +|++++|+.+||||+|+.+      |..+.|.. +.||++ .+++.     ..+.+||
T Consensus         1 ~KIvivG~~~vGKTSLi~r------~~~~~f~~-~~~Tig-~~~~~~~~~~~~l~iwD   50 (220)
T cd04126           1 LKVVLLGDMNVGKTSLLHR------YMERRFKD-TVSTVG-GAFYLKQWGPYNISIWD   50 (220)
T ss_pred             CEEEEECCCCCcHHHHHHH------HhcCCCCC-CCCccc-eEEEEEEeeEEEEEEEe
Confidence            5899999999999999998      87777765 578887 35443     3355665


No 84 
>cd04148 RGK RGK subfamily.  The RGK (Rem, Rem2, Rad, Gem/Kir) subfamily of Ras GTPases are expressed in a tissue-specific manner and are dynamically regulated by transcriptional and posttranscriptional mechanisms in response to environmental cues.   RGK proteins bind to the beta subunit of L-type calcium channels, causing functional down-regulation of these voltage-dependent calcium channels, and either termination of calcium-dependent secretion or modulation of electrical conduction and contractile function.  Inhibition of L-type calcium channels by Rem2 may provide a mechanism for modulating calcium-triggered exocytosis in hormone-secreting cells, and has been proposed to influence the secretion of insulin in pancreatic beta cells.  RGK proteins also interact with and inhibit the Rho/Rho kinase pathway to modulate remodeling of the cytoskeleton.  Two characteristics of RGK proteins cited in the literature are N-terminal and C-terminal extensions beyond the GTPase domain typical of Ra
Probab=98.81  E-value=6.4e-09  Score=63.37  Aligned_cols=34  Identities=18%  Similarity=0.196  Sum_probs=27.5

Q ss_pred             eEEEEECCCCChHHHHHhHhhhcccccccccc-ccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLL-TTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~-~~~~~ti~   52 (65)
                      +||+++|++|||||+|+.+      |..+.|. ..|.|+++
T Consensus         1 ~KI~lvG~~gvGKTsLi~~------~~~~~~~~~~~~~t~~   35 (221)
T cd04148           1 YRVVMLGSPGVGKSSLASQ------FTSGEYDDHAYDASGD   35 (221)
T ss_pred             CEEEEECCCCCcHHHHHHH------HhcCCcCccCcCCCcc
Confidence            5899999999999999997      7666665 56666664


No 85 
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases. Members of this subfamily of Ras-like small GTPases include Cdc42 and Rac, as well as Rho isoforms.
Probab=98.81  E-value=8.2e-09  Score=59.70  Aligned_cols=38  Identities=42%  Similarity=0.586  Sum_probs=31.8

Q ss_pred             EEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEE
Q psy15257         15 CVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY   60 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~   60 (65)
                      |+++|++|||||+|+.+      |..+.|...|.|+++  +.|...
T Consensus         1 i~i~G~~~vGKTsli~~------~~~~~~~~~~~~~~~--~~~~~~   38 (174)
T smart00174        1 LVVVGDGAVGKTCLLIS------YTTNAFPEDYVPTVF--ENYSAD   38 (174)
T ss_pred             CEEECCCCCCHHHHHHH------HHhCCCCCCCCCcEE--eeeeEE
Confidence            57899999999999998      888888888888887  666543


No 86 
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily.  This subfamily contains Arf1, Arf2, Arf3, Arf4, Arf5, and related proteins.  Arfs1-5 are soluble proteins that are crucial for assembling coat proteins during vesicle formation.  Each contains an N-terminal myristoylated amphipathic helix that is folded into the protein in the GDP-bound state.  GDP/GTP exchange exposes the helix, which anchors to the membrane.  Following GTP hydrolysis, the helix dissociates from the membrane and folds back into the protein.  A general feature of Arf1-5 signaling may be the cooperation of two Arfs at the same site.  Arfs1-5 are generally considered to be interchangeable in function and location, but some specific functions have been assigned.  Arf1 localizes to the early/cis-Golgi, where it is activated by GBF1 and recruits the coat protein COPI.  It also localizes to the trans-Golgi network (TGN), where it is activated by BIG1/BIG2 and recruits the AP1, AP3, AP4, and GGA proteins.  Humans, but not rodents
Probab=98.79  E-value=7.3e-09  Score=59.85  Aligned_cols=33  Identities=30%  Similarity=0.596  Sum_probs=27.5

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +|++++|+.+||||||+.+      +..+.|. .+.||++
T Consensus         1 ~kv~~~G~~~~GKTsli~~------l~~~~~~-~~~pt~g   33 (159)
T cd04150           1 MRILMVGLDAAGKTTILYK------LKLGEIV-TTIPTIG   33 (159)
T ss_pred             CEEEEECCCCCCHHHHHHH------HhcCCCc-ccCCCCC
Confidence            4899999999999999997      7666666 3678876


No 87 
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily.  Arl9 (Arf-like 9) was first identified as part of the Human Cancer Genome Project.  It maps to chromosome 4q12 and is sometimes referred to as Arfrp2 (Arf-related protein 2).  This is a novel subfamily identified in human cancers that is uncharacterized to date.
Probab=98.77  E-value=6.2e-09  Score=60.48  Aligned_cols=32  Identities=34%  Similarity=0.441  Sum_probs=28.1

Q ss_pred             EEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         15 CVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ++++|+.|||||+|+.+      |..+.|...+.||++
T Consensus         2 i~ivG~~~vGKTsli~~------~~~~~~~~~~~pt~g   33 (164)
T cd04162           2 ILVLGLDGAGKTSLLHS------LSSERSLESVVPTTG   33 (164)
T ss_pred             EEEECCCCCCHHHHHHH------HhcCCCcccccccCC
Confidence            68999999999999998      777777788888876


No 88 
>cd01862 Rab7 Rab7 subfamily.  Rab7 is a small Rab GTPase that regulates vesicular traffic from early to late endosomal stages of the endocytic pathway.  The yeast Ypt7 and mammalian Rab7 are both involved in transport to the vacuole/lysosome, whereas Ypt7 is also required for homotypic vacuole fusion.  Mammalian Rab7 is an essential participant in the autophagic pathway for sequestration and targeting of cytoplasmic components to the lytic compartment. Mammalian Rab7 is also proposed to function as a tumor suppressor. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-
Probab=98.77  E-value=1.9e-08  Score=57.79  Aligned_cols=34  Identities=26%  Similarity=0.405  Sum_probs=28.5

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +||+++|++++|||||+.+      +....+...+.++++
T Consensus         1 ~ki~viG~~~~GKSsl~~~------l~~~~~~~~~~~t~~   34 (172)
T cd01862           1 LKVIILGDSGVGKTSLMNQ------YVNKKFSNQYKATIG   34 (172)
T ss_pred             CEEEEECCCCCCHHHHHHH------HhcCCCCcCcCCccc
Confidence            5899999999999999997      766667776777766


No 89 
>cd01860 Rab5_related Rab5-related subfamily.  This subfamily includes Rab5 and Rab22 of mammals, Ypt51/Ypt52/Ypt53 of yeast, and RabF of plants. The members of this subfamily are involved in endocytosis and endocytic-sorting pathways.  In mammals, Rab5 GTPases localize to early endosomes and regulate fusion of clathrin-coated vesicles to early endosomes and fusion between early endosomes. In yeast, Ypt51p family members similarly regulate membrane trafficking through prevacuolar compartments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence mo
Probab=98.77  E-value=2e-08  Score=57.33  Aligned_cols=35  Identities=26%  Similarity=0.399  Sum_probs=29.3

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      .+|++++|++++|||+|+.+      +..+.+...+.|+.+
T Consensus         1 ~~ki~v~G~~~~GKSsli~~------l~~~~~~~~~~~t~~   35 (163)
T cd01860           1 QFKLVLLGDSSVGKSSLVLR------FVKNEFSENQESTIG   35 (163)
T ss_pred             CeEEEEECCCCCCHHHHHHH------HHcCCCCCCCCCccc
Confidence            37999999999999999997      777777766777776


No 90 
>PTZ00133 ADP-ribosylation factor; Provisional
Probab=98.77  E-value=9.2e-09  Score=60.83  Aligned_cols=35  Identities=31%  Similarity=0.555  Sum_probs=28.7

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ..+|++++|+++||||+|+.+      +..+.|.. +.||++
T Consensus        16 ~~~kv~lvG~~~vGKTsli~~------~~~~~~~~-~~~T~~   50 (182)
T PTZ00133         16 KEVRILMVGLDAAGKTTILYK------LKLGEVVT-TIPTIG   50 (182)
T ss_pred             CccEEEEEcCCCCCHHHHHHH------HhcCCccc-cCCccc
Confidence            358999999999999999997      66666654 678877


No 91 
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily.  RERG (Ras-related and Estrogen- Regulated Growth inhibitor) and Ras-like 11 are members of a novel subfamily of Ras that were identified based on their behavior in breast and prostate tumors, respectively.  RERG expression was decreased or lost in a significant fraction of primary human breast tumors that lack estrogen receptor and are correlated with poor clinical prognosis.  Elevated RERG expression correlated with favorable patient outcome in a breast tumor subtype that is positive for estrogen receptor expression.  In contrast to most Ras proteins, RERG overexpression inhibited the growth of breast tumor cells in vitro and in vivo.  RasL11 was found to be ubiquitously expressed in human tissue, but down-regulated in prostate tumors.  Both RERG and RasL11 lack the C-terminal CaaX prenylation motif, where a = an aliphatic amino acid and X = any amino acid, and are localized primarily in the cytoplasm.  Both are believed to have tu
Probab=98.76  E-value=5.4e-09  Score=60.19  Aligned_cols=33  Identities=24%  Similarity=0.392  Sum_probs=26.3

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      |++++|++|||||+|+.+      +..+.|...|.|+..
T Consensus         1 ki~vvG~~~~GKtsli~~------~~~~~~~~~~~~t~~   33 (165)
T cd04146           1 KIAVLGASGVGKSALVVR------FLTKRFIGEYDPNLE   33 (165)
T ss_pred             CEEEECCCCCcHHHHHHH------HHhCccccccCCChH
Confidence            689999999999999997      666666666666653


No 92 
>cd04112 Rab26 Rab26 subfamily.  First identified in rat pancreatic acinar cells, Rab26 is believed to play a role in recruiting mature granules to the plasma membrane upon beta-adrenergic stimulation.  Rab26 belongs to the Rab functional group III, which are considered key regulators of intracellular vesicle transport during exocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=98.76  E-value=1.4e-08  Score=60.20  Aligned_cols=34  Identities=32%  Similarity=0.476  Sum_probs=27.1

Q ss_pred             eEEEEECCCCChHHHHHhHhhhcccccccccc-ccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLL-TTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~-~~~~~ti~   52 (65)
                      +|++++|+.+||||||+.+      +..+.|. ..+.||++
T Consensus         1 ~Ki~vvG~~~vGKTSli~~------~~~~~~~~~~~~~t~~   35 (191)
T cd04112           1 FKVMLLGDSGVGKTCLLVR------FKDGAFLNGNFIATVG   35 (191)
T ss_pred             CEEEEECCCCCCHHHHHHH------HhcCCCCccCcCCccc
Confidence            5899999999999999997      6666664 35666665


No 93 
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor. Ras homologues involved in vesicular transport. Activator of phospholipase D isoforms. Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated. ARFs are N-terminally myristoylated. Contains ATP/GTP-binding motif (P-loop).
Probab=98.76  E-value=1.4e-08  Score=59.47  Aligned_cols=35  Identities=29%  Similarity=0.501  Sum_probs=28.9

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ..+|++++|+.+||||+|+.+      +..+.|. .+.||++
T Consensus        12 ~~~ki~l~G~~~~GKTsL~~~------~~~~~~~-~~~~t~~   46 (175)
T smart00177       12 KEMRILMVGLDAAGKTTILYK------LKLGESV-TTIPTIG   46 (175)
T ss_pred             CccEEEEEcCCCCCHHHHHHH------HhcCCCC-CcCCccc
Confidence            458999999999999999997      7666664 4678887


No 94 
>cd04139 RalA_RalB RalA/RalB subfamily.  The Ral (Ras-like) subfamily consists of the highly homologous RalA and RalB.  Ral proteins are believed to play a crucial role in tumorigenesis, metastasis, endocytosis, and actin cytoskeleton dynamics.  Despite their high sequence similarity (80% sequence identity), nonoverlapping and opposing functions have been assigned to RalA and RalBs in tumor migration.  In human bladder and prostate cancer cells, RalB promotes migration while RalA inhibits it.  A Ral-specific set of GEFs has been identified that are activated by Ras binding.  This RalGEF activity is enhanced by Ras binding to another of its target proteins, phosphatidylinositol 3-kinase (PI3K).   Ral effectors include RLIP76/RalBP1, a Rac/cdc42 GAP, and the exocyst (Sec6/8) complex, a heterooctomeric protein complex that is involved in tethering vesicles to specific sites on the plasma membrane prior to exocytosis.  In rat kidney cells, RalB is required for functional assembly of the exo
Probab=98.75  E-value=1.4e-08  Score=57.83  Aligned_cols=34  Identities=29%  Similarity=0.382  Sum_probs=28.7

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +|++++|++|+|||||+.+      +..+.|...+.|+++
T Consensus         1 ~ki~~~G~~~~GKTsl~~~------l~~~~~~~~~~~~~~   34 (164)
T cd04139           1 YKVIVVGAGGVGKSALTLQ------FMYDEFVEDYEPTKA   34 (164)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHhCCCccccCCcch
Confidence            5899999999999999997      777777777777765


No 95 
>KOG4252|consensus
Probab=98.74  E-value=2.3e-09  Score=65.04  Aligned_cols=50  Identities=22%  Similarity=0.253  Sum_probs=43.4

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEEec
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDTL   64 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~i~   64 (65)
                      .....+|++++|..+|||+++++|      |+.+-|...|.-||| +|+...+..|+
T Consensus        16 d~e~aiK~vivGng~VGKssmiqr------yCkgifTkdykktIg-vdflerqi~v~   65 (246)
T KOG4252|consen   16 DYERAIKFVIVGNGSVGKSSMIQR------YCKGIFTKDYKKTIG-VDFLERQIKVL   65 (246)
T ss_pred             hhhhhEEEEEECCCccchHHHHHH------Hhccccccccccccc-hhhhhHHHHhh
Confidence            446679999999999999999998      999999999999999 88877665543


No 96 
>cd04129 Rho2 Rho2 subfamily.  Rho2 is a fungal GTPase that plays a role in cell morphogenesis, control of cell wall integrity, control of growth polarity, and maintenance of growth direction.  Rho2 activates the protein kinase C homolog Pck2, and Pck2 controls Mok1, the major (1-3) alpha-D-glucan synthase.  Together with Rho1 (RhoA), Rho2 regulates the construction of the cell wall.  Unlike Rho1, Rho2 is not an essential protein, but its overexpression is lethal.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for proper intracellular localization via membrane attachment.  As with other Rho family GTPases, the GDP/GTP cycling is regulated by GEFs (guanine nucleotide exchange factors), GAPs (GTPase-activating proteins) and GDIs (guanine nucleotide dissociation inhibitors).
Probab=98.74  E-value=2.1e-08  Score=59.25  Aligned_cols=38  Identities=39%  Similarity=0.620  Sum_probs=30.7

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      .|++++|++|+|||+|+.+      +..+.|...+.||++  +.+.
T Consensus         2 ~Ki~ivG~~g~GKStLl~~------l~~~~~~~~~~~t~~--~~~~   39 (187)
T cd04129           2 RKLVIVGDGACGKTSLLSV------FTLGEFPEEYHPTVF--ENYV   39 (187)
T ss_pred             eEEEEECCCCCCHHHHHHH------HHhCCCCcccCCccc--ceEE
Confidence            5999999999999999997      766677777777776  5444


No 97 
>cd00157 Rho Rho (Ras homology) family.  Members of the Rho family include RhoA, Cdc42, Rac, Rnd, Wrch1, RhoBTB, and Rop.  There are 22 human Rho family members identified currently.  These proteins are all involved in the reorganization of the actin cytoskeleton in response to external stimuli.  They also have roles in cell transformation by Ras in cytokinesis, in focal adhesion formation and in the stimulation of stress-activated kinase.  These various functions are controlled through distinct effector proteins and mediated through a GTP-binding/GTPase cycle involving three classes of regulating proteins: GAPs (GTPase-activating proteins), GEFs (guanine nucleotide exchange factors), and GDIs (guanine nucleotide dissociation inhibitors).  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho protein
Probab=98.74  E-value=2.7e-08  Score=57.07  Aligned_cols=40  Identities=48%  Similarity=0.667  Sum_probs=31.4

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIY   60 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~   60 (65)
                      +|++++|+.|+|||+|+.+      +..+.+...+.|++.  +.+...
T Consensus         1 iki~i~G~~~~GKSsli~~------l~~~~~~~~~~~~~~--~~~~~~   40 (171)
T cd00157           1 IKIVVVGDGAVGKTCLLIS------YTTGKFPTEYVPTVF--DNYSAT   40 (171)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHhCCCCCCCCCcee--eeeEEE
Confidence            5899999999999999997      777777666777776  544433


No 98 
>cd04114 Rab30 Rab30 subfamily.  Rab30 appears to be associated with the Golgi stack. It is expressed in a wide variety of tissue types and in humans maps to chromosome 11.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=98.73  E-value=5.2e-08  Score=55.99  Aligned_cols=41  Identities=27%  Similarity=0.339  Sum_probs=31.8

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQY   57 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~   57 (65)
                      ...+|++++|++|||||+|+.+      +..+.+...+.++++ .++.
T Consensus         5 ~~~~~v~v~G~~~~GKSsli~~------l~~~~~~~~~~~t~~-~~~~   45 (169)
T cd04114           5 DFLFKIVLIGNAGVGKTCLVRR------FTQGLFPPGQGATIG-VDFM   45 (169)
T ss_pred             CceeEEEEECCCCCCHHHHHHH------HHhCCCCCCCCCcee-eEEE
Confidence            3568999999999999999997      666666666777776 3443


No 99 
>cd01861 Rab6 Rab6 subfamily.  Rab6 is involved in microtubule-dependent transport pathways through the Golgi and from endosomes to the Golgi. Rab6A of mammals is implicated in retrograde transport through the Golgi stack, and is also required for a slow, COPI-independent, retrograde transport pathway from the Golgi to the endoplasmic reticulum (ER). This pathway may allow Golgi residents to be recycled through the ER for scrutiny by ER quality-control systems. Yeast Ypt6p, the homolog of the mammalian Rab6 GTPase, is not essential for cell viability. Ypt6p acts in endosome-to-Golgi, in intra-Golgi retrograde transport, and possibly also in Golgi-to-ER trafficking.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate
Probab=98.73  E-value=3.1e-08  Score=56.45  Aligned_cols=34  Identities=29%  Similarity=0.340  Sum_probs=27.7

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +|++++|++++|||+|+.+      +....+...+.|+.+
T Consensus         1 ~ki~liG~~~~GKSsli~~------l~~~~~~~~~~~~~~   34 (161)
T cd01861           1 HKLVFLGDQSVGKTSIITR------FMYDTFDNQYQATIG   34 (161)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHcCCCCccCCCcee
Confidence            4899999999999999997      666666666667665


No 100
>PLN03118 Rab family protein; Provisional
Probab=98.73  E-value=3.9e-08  Score=59.10  Aligned_cols=40  Identities=25%  Similarity=0.375  Sum_probs=30.6

Q ss_pred             CCCCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          6 EQPHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         6 ~~~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +......+|++++|++|||||+|+.+      +..+.+ ..+.|+++
T Consensus         8 ~~~~~~~~kv~ivG~~~vGKTsli~~------l~~~~~-~~~~~t~~   47 (211)
T PLN03118          8 SSGYDLSFKILLIGDSGVGKSSLLVS------FISSSV-EDLAPTIG   47 (211)
T ss_pred             ccccCcceEEEEECcCCCCHHHHHHH------HHhCCC-CCcCCCce
Confidence            34556679999999999999999997      655554 34567766


No 101
>smart00175 RAB Rab subfamily of small GTPases. Rab GTPases are implicated in vesicle trafficking.
Probab=98.72  E-value=4e-08  Score=55.96  Aligned_cols=34  Identities=24%  Similarity=0.410  Sum_probs=28.5

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +|++++|++++|||+|+.+      +....+...+.++++
T Consensus         1 ~kv~v~G~~~~GKTtli~~------l~~~~~~~~~~~~~~   34 (164)
T smart00175        1 FKIILIGDSGVGKSSLLSR------FTDGKFSEQYKSTIG   34 (164)
T ss_pred             CEEEEECCCCCCHHHHHHH------HhcCCCCCCCCCcee
Confidence            5899999999999999997      766666766777776


No 102
>TIGR02528 EutP ethanolamine utilization protein, EutP. This protein is found within operons which code for polyhedral organelles containing the enzyme ethanolamine ammonia lyase. The function of this gene is unknown, although the presence of an N-terminal GxxGxGK motif implies a GTP-binding site.
Probab=98.71  E-value=1.9e-08  Score=56.61  Aligned_cols=36  Identities=19%  Similarity=0.241  Sum_probs=27.5

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      |++++|+++||||||+.+      +....+  .+.+|++ +++..
T Consensus         2 kv~liG~~~vGKSsL~~~------l~~~~~--~~~~t~~-~~~~~   37 (142)
T TIGR02528         2 RIMFIGSVGCGKTTLTQA------LQGEEI--LYKKTQA-VEYND   37 (142)
T ss_pred             eEEEECCCCCCHHHHHHH------HcCCcc--cccccee-EEEcC
Confidence            899999999999999997      655544  3567776 45543


No 103
>smart00010 small_GTPase Small GTPase of the Ras superfamily; ill-defined subfamily. SMART predicts Ras-like small GTPases of the ARF, RAB, RAN, RAS, and SAR subfamilies. Others that could not be classified in this way are predicted to be members of the small GTPase superfamily without predictions of the subfamily.
Probab=98.71  E-value=9.4e-09  Score=56.30  Aligned_cols=34  Identities=24%  Similarity=0.152  Sum_probs=27.1

Q ss_pred             eEEEEECCCCChHHHHHhHhhhcccccccccccccc-ceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHV-PTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~-~ti~   52 (65)
                      +|++++|++|||||+|+.|      |..+.|...+. +|++
T Consensus         1 ~kvv~~G~~gvGKt~l~~~------~~~~~~~~~~~~~t~~   35 (124)
T smart00010        1 FKVVGIGDSGVGKVGKSAR------FVQFPFDYVPTVFTIG   35 (124)
T ss_pred             CEEEEECCCChhHHHHHHH------HhcCCccccCceehhh
Confidence            5899999999999999998      87777765554 5543


No 104
>cd04147 Ras_dva Ras-dva subfamily.  Ras-dva (Ras - dorsal-ventral anterior localization) subfamily consists of a set of proteins characterized only in Xenopus leavis, to date.  In Xenopus Ras-dva expression is activated by the transcription factor Otx2 and begins during gastrulation throughout the anterior ectoderm.  Ras-dva expression is inhibited in the anterior neural plate by factor Xanf1.  Downregulation of Ras-dva results in head development abnormalities through the inhibition of several regulators of the anterior neural plate and folds patterning, including Otx2, BF-1, Xag2, Pax6, Slug, and Sox9.  Downregulation of Ras-dva also interferes with the FGF-8a signaling within the anterior ectoderm.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.
Probab=98.71  E-value=1.4e-08  Score=60.60  Aligned_cols=33  Identities=30%  Similarity=0.286  Sum_probs=28.1

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ||+++|+.|||||+|+.+      +..+.|...+.+|+.
T Consensus         1 kv~vvG~~~vGKTsll~~------~~~~~~~~~~~~t~~   33 (198)
T cd04147           1 RLVFMGAAGVGKTALIQR------FLYDTFEPKYRRTVE   33 (198)
T ss_pred             CEEEECCCCCCHHHHHHH------HHhCCCCccCCCchh
Confidence            689999999999999997      777777777777765


No 105
>cd04149 Arf6 Arf6 subfamily.  Arf6 (ADP ribosylation factor 6) proteins localize to the plasma membrane, where they perform a wide variety of functions.  In its active, GTP-bound form, Arf6 is involved in cell spreading, Rac-induced formation of plasma membrane ruffles, cell migration, wound healing, and Fc-mediated phagocytosis.  Arf6 appears to change the actin structure at the plasma membrane by activating Rac, a Rho family protein involved in membrane ruffling.  Arf6 is required for and enhances Rac formation of ruffles.  Arf6 can regulate dendritic branching in hippocampal neurons, and in yeast it localizes to the growing bud, where it plays a role in polarized growth and bud site selection.  In leukocytes, Arf6 is required for chemokine-stimulated migration across endothelial cells.  Arf6 also plays a role in down-regulation of beta2-adrenergic receptors and luteinizing hormone receptors by facilitating the release of sequestered arrestin to allow endocytosis.  Arf6 is believed t
Probab=98.70  E-value=2.5e-08  Score=58.20  Aligned_cols=35  Identities=31%  Similarity=0.498  Sum_probs=28.1

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ..+|++++|+++||||||+.+      +..+.+. .+.||++
T Consensus         8 ~~~kv~i~G~~~~GKTsli~~------l~~~~~~-~~~~t~g   42 (168)
T cd04149           8 KEMRILMLGLDAAGKTTILYK------LKLGQSV-TTIPTVG   42 (168)
T ss_pred             CccEEEEECcCCCCHHHHHHH------HccCCCc-cccCCcc
Confidence            458999999999999999997      6655554 3567776


No 106
>PLN00223 ADP-ribosylation factor; Provisional
Probab=98.68  E-value=2.8e-08  Score=58.81  Aligned_cols=35  Identities=29%  Similarity=0.547  Sum_probs=29.0

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ..+|++++|+++||||+|+.+      +..+.|. .+.||++
T Consensus        16 ~~~ki~ivG~~~~GKTsl~~~------l~~~~~~-~~~pt~g   50 (181)
T PLN00223         16 KEMRILMVGLDAAGKTTILYK------LKLGEIV-TTIPTIG   50 (181)
T ss_pred             CccEEEEECCCCCCHHHHHHH------HccCCCc-cccCCcc
Confidence            358999999999999999997      7666665 4678887


No 107
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily.  Rheb was initially identified in rat brain, where its expression is elevated by seizures or by long-term potentiation.  It is expressed ubiquitously, with elevated levels in muscle and brain.  Rheb functions as an important mediator between the tuberous sclerosis complex proteins, TSC1 and TSC2, and the mammalian target of rapamycin (TOR) kinase to stimulate cell growth.  TOR kinase regulates cell growth by controlling nutrient availability, growth factors, and the energy status of the cell.  TSC1 and TSC2 form a dimeric complex that has tumor suppressor activity, and TSC2 is a GTPase activating protein (GAP) for Rheb.  The TSC1/TSC2 complex inhibits the activation of TOR kinase through Rheb.  Rheb has also been shown to induce the formation of large cytoplasmic vacuoles in a process that is dependent on the GTPase cycle of Rheb, but independent of the TOR kinase, suggesting Rheb plays a role in endocytic trafficking that le
Probab=98.65  E-value=4.3e-08  Score=57.10  Aligned_cols=34  Identities=26%  Similarity=0.391  Sum_probs=28.3

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      .|++++|++|||||+|+.+      +....+...+.||+.
T Consensus         2 ~kv~l~G~~g~GKTtl~~~------~~~~~~~~~~~~t~~   35 (180)
T cd04137           2 RKIAVLGSRSVGKSSLTVQ------FVEGHFVESYYPTIE   35 (180)
T ss_pred             eEEEEECCCCCCHHHHHHH------HHhCCCccccCcchh
Confidence            6899999999999999997      776777666777664


No 108
>cd00154 Rab Rab family.  Rab GTPases form the largest family within the Ras superfamily.  There are at least 60 Rab genes in the human genome, and a number of Rab GTPases are conserved from yeast to humans. Rab GTPases are small, monomeric proteins that function as molecular switches to regulate vesicle trafficking pathways.  The different Rab GTPases are localized to the cytosolic face of specific intracellular membranes, where they regulate distinct steps in membrane traffic pathways. In the GTP-bound form, Rab GTPases recruit specific sets of effector proteins onto membranes. Through their effectors, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide di
Probab=98.63  E-value=1e-07  Score=53.39  Aligned_cols=34  Identities=29%  Similarity=0.369  Sum_probs=28.3

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +|++++|+.++|||||+.+      +....+...+.+|.+
T Consensus         1 ~~i~~~G~~~~GKStl~~~------l~~~~~~~~~~~t~~   34 (159)
T cd00154           1 FKIVLIGDSGVGKTSLLLR------FVDGKFDENYKSTIG   34 (159)
T ss_pred             CeEEEECCCCCCHHHHHHH------HHhCcCCCccCCcee
Confidence            4899999999999999997      777777766667766


No 109
>cd04158 ARD1 ARD1 subfamily.  ARD1 (ADP-ribosylation factor domain protein 1) is an unusual member of the Arf family.  In addition to the C-terminal Arf domain, ARD1 has an additional 46-kDa N-terminal domain that contains a RING finger domain, two predicted B-Boxes, and a coiled-coil protein interaction motif.  This domain belongs to the TRIM (tripartite motif) or RBCC (RING, B-Box, coiled-coil) family.  Like most Arfs, the ARD1 Arf domain lacks detectable GTPase activity.  However, unlike most Arfs, the full-length ARD1 protein has significant GTPase activity due to the GAP (GTPase-activating protein) activity exhibited by the 46-kDa N-terminal domain.  The GAP domain of ARD1 is specific for its own Arf domain and does not bind other Arfs.  The rate of GDP dissociation from the ARD1 Arf domain is slowed by the adjacent 15 amino acids, which act as a GDI (GDP-dissociation inhibitor) domain.  ARD1 is ubiquitously expressed in cells and localizes to the Golgi and to the lysosomal membra
Probab=98.63  E-value=5.2e-08  Score=56.62  Aligned_cols=32  Identities=22%  Similarity=0.481  Sum_probs=26.3

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      |++++|+.+||||+|+.+      +..+.+.. +.||++
T Consensus         1 ~vvlvG~~~~GKTsl~~~------l~~~~~~~-~~~T~~   32 (169)
T cd04158           1 RVVTLGLDGAGKTTILFK------LKQDEFMQ-PIPTIG   32 (169)
T ss_pred             CEEEECCCCCCHHHHHHH------HhcCCCCC-cCCcCc
Confidence            689999999999999997      66666654 678876


No 110
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily.  Arl4 (Arf-like 4) is highly expressed in testicular germ cells, and is found in the nucleus and nucleolus.  In mice, Arl4 is developmentally expressed during embryogenesis, and a role in somite formation and central nervous system differentiation has been proposed.  Arl7 has been identified as the only Arf/Arl protein to be induced by agonists of liver X-receptor and retinoid X-receptor and by cholesterol loading in human macrophages.  Arl7 is proposed to play a role in transport between a perinuclear compartment and the plasma membrane, apparently linked to the ABCA1-mediated cholesterol secretion pathway.  Older literature suggests that Arl6 is a part of the Arl4/Arl7 subfamily, but analyses based on more recent sequence data place Arl6 in its own subfamily.
Probab=98.62  E-value=5.9e-08  Score=57.24  Aligned_cols=34  Identities=26%  Similarity=0.457  Sum_probs=27.1

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      .+|++++|++|||||||+.+      +..+.|... .||++
T Consensus         3 ~~kv~~vG~~~~GKTsli~~------~~~~~~~~~-~~t~~   36 (183)
T cd04152           3 SLHIVMLGLDSAGKTTVLYR------LKFNEFVNT-VPTKG   36 (183)
T ss_pred             ceEEEEECCCCCCHHHHHHH------HhcCCcCCc-CCccc
Confidence            58999999999999999997      666666543 56665


No 111
>cd01863 Rab18 Rab18 subfamily.  Mammalian Rab18 is implicated in endocytic transport and is expressed most highly in polarized epithelial cells. However, trypanosomal Rab, TbRAB18, is upregulated in the BSF (Blood Stream Form) stage and localized predominantly to elements of the Golgi complex.  In human and mouse cells, Rab18 has been identified in lipid droplets, organelles that store neutral lipids. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of mos
Probab=98.62  E-value=8.1e-08  Score=54.80  Aligned_cols=34  Identities=24%  Similarity=0.387  Sum_probs=28.2

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +|++++|+.++|||+|+.+      +....+...+.|+++
T Consensus         1 ~ki~v~G~~~~GKSsli~~------l~~~~~~~~~~~~~~   34 (161)
T cd01863           1 LKILLIGDSGVGKSSLLLR------FTDDTFDPDLAATIG   34 (161)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHcCCCCcccCCccc
Confidence            5899999999999999997      666666666677776


No 112
>cd04159 Arl10_like Arl10-like subfamily.  Arl9/Arl10 was identified from a human cancer-derived EST dataset.  No functional information about the subfamily is available at the current time, but crystal structures of human Arl10b and Arl10c have been solved.
Probab=98.61  E-value=5.4e-08  Score=54.59  Aligned_cols=32  Identities=31%  Similarity=0.396  Sum_probs=27.7

Q ss_pred             EEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         15 CVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +.++|++|+|||||+.+      +....|...+.||++
T Consensus         2 i~i~G~~~~GKssl~~~------l~~~~~~~~~~~t~~   33 (159)
T cd04159           2 ITLVGLQNSGKTTLVNV------IAGGQFSEDTIPTVG   33 (159)
T ss_pred             EEEEcCCCCCHHHHHHH------HccCCCCcCccCCCC
Confidence            68999999999999997      777777777888876


No 113
>cd01893 Miro1 Miro1 subfamily.  Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs.  Genes encoding Miro-like proteins were found in several eukaryotic organisms.  This CD represents the N-terminal GTPase domain of Miro proteins.  These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis.  Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature.
Probab=98.61  E-value=6.2e-08  Score=56.00  Aligned_cols=28  Identities=29%  Similarity=0.513  Sum_probs=22.9

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccc
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTH   47 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~   47 (65)
                      |++++|+++||||+|+.+      +..+.|...+
T Consensus         2 kv~ivG~~~vGKTsl~~~------l~~~~~~~~~   29 (166)
T cd01893           2 RIVLIGDEGVGKSSLIMS------LVSEEFPENV   29 (166)
T ss_pred             EEEEECCCCCCHHHHHHH------HHhCcCCccC
Confidence            899999999999999997      6666665443


No 114
>cd04157 Arl6 Arl6 subfamily.  Arl6 (Arf-like 6) forms a subfamily of the Arf family of small GTPases.  Arl6 expression is limited to the brain and kidney in adult mice, but it is expressed in the neural plate and somites during embryogenesis, suggesting a possible role for Arl6 in early development.  Arl6 is also believed to have a role in cilia or flagella function.  Several proteins have been identified that bind Arl6, including Arl6 interacting protein (Arl6ip), and SEC61beta, a subunit of the heterotrimeric conducting channel SEC61p.  Based on Arl6 binding to these effectors, Arl6 is also proposed to play a role in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation.  At least three specific homozygous Arl6 mutations in humans have been found to cause Bardet-Biedl syndrome, a disorder characterized by obesity, retinopathy, polydactyly, renal and cardiac malformations, learning disabilities, and hypogenitalism.  Older literature suggests that A
Probab=98.58  E-value=7.4e-08  Score=54.85  Aligned_cols=33  Identities=33%  Similarity=0.339  Sum_probs=26.6

Q ss_pred             EEEEECCCCChHHHHHhHhhhcccccccc-ccccccceEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQ-LLTTHVPTVW   52 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~-~~~~~~~ti~   52 (65)
                      +|+++|+++||||+|+.+      +.... +...+.||++
T Consensus         1 ~i~~vG~~~~GKTsl~~~------l~~~~~~~~~~~~t~g   34 (162)
T cd04157           1 NILVVGLDNSGKTTIINQ------LKPENAQSQIIVPTVG   34 (162)
T ss_pred             CEEEECCCCCCHHHHHHH------HcccCCCcceecCccc
Confidence            478999999999999997      66654 4566778876


No 115
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases. Ran is involved in the active transport of proteins through nuclear pores.
Probab=98.57  E-value=9.2e-08  Score=57.81  Aligned_cols=35  Identities=23%  Similarity=0.285  Sum_probs=29.9

Q ss_pred             ECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         18 VGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        18 lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      +|+.|||||||+.|      |..+.|...|.||++ +++++.
T Consensus         1 vG~~~vGKTsLi~r------~~~~~f~~~~~~Tig-~~~~~~   35 (200)
T smart00176        1 VGDGGTGKTTFVKR------HLTGEFEKKYVATLG-VEVHPL   35 (200)
T ss_pred             CCCCCCCHHHHHHH------HhcCCCCCCCCCcee-EEEEEE
Confidence            59999999999998      888889888999998 566544


No 116
>cd00876 Ras Ras family.  The Ras family of the Ras superfamily includes classical N-Ras, H-Ras, and K-Ras, as well as R-Ras, Rap, Ral, Rheb, Rhes, ARHI, RERG, Rin/Rit, RSR1, RRP22, Ras2, Ras-dva, and RGK proteins.  Ras proteins regulate cell growth, proliferation and differentiation.  Ras is activated by guanine nucleotide exchange factors (GEFs) that release GDP and allow GTP binding.  Many RasGEFs have been identified.  These are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active GTP-bound Ras interacts with several effector proteins: among the best characterized are the Raf kinases, phosphatidylinositol 3-kinase (PI3K), RalGEFs and NORE/MST1.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of m
Probab=98.56  E-value=8.8e-08  Score=54.16  Aligned_cols=33  Identities=27%  Similarity=0.378  Sum_probs=25.4

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      |++++|+.++|||+|+.+      +....+...+.|+..
T Consensus         1 ki~i~G~~~~GKTsli~~------l~~~~~~~~~~~~~~   33 (160)
T cd00876           1 KVVVLGAGGVGKSAITIQ------FVKGTFVEEYDPTIE   33 (160)
T ss_pred             CEEEECCCCCCHHHHHHH------HHhCCCCcCcCCChh
Confidence            689999999999999997      555556555655554


No 117
>cd04123 Rab21 Rab21 subfamily.  The localization and function of Rab21 are not clearly defined, with conflicting data reported.  Rab21 has been reported to localize in the ER in human intestinal epithelial cells, with partial colocalization with alpha-glucosidase, a late endosomal/lysosomal marker.  More recently, Rab21 was shown to colocalize with and affect the morphology of early endosomes. In Dictyostelium, GTP-bound Rab21, together with two novel LIM domain proteins, LimF and ChLim, has been shown to regulate phagocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site
Probab=98.55  E-value=1.9e-07  Score=52.84  Aligned_cols=34  Identities=29%  Similarity=0.386  Sum_probs=26.3

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +|++++|++|+|||+|+.+      +..+.+...+.+++.
T Consensus         1 ~ki~i~G~~~~GKStli~~------l~~~~~~~~~~~~~~   34 (162)
T cd04123           1 FKVVLLGEGRVGKTSLVLR------YVENKFNEKHESTTQ   34 (162)
T ss_pred             CEEEEECCCCCCHHHHHHH------HHhCCCCCCcCCccc
Confidence            5899999999999999997      666656555555553


No 118
>PF08477 Miro:  Miro-like protein;  InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases. They have a unique domain organisation, with tandem GTP-binding domains and two EF hand domains (IPR002048 from INTERPRO), that may bind calcium. They are also larger than classical small GTPases. It has been proposed that they are involved in mitochondrial homeostasis and apoptosis []. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction, 0005622 intracellular; PDB: 2IWR_A 2BMJ_A 3IHW_A 2ZEJ_A 3D6T_B 3DPU_A.
Probab=98.51  E-value=2.6e-07  Score=50.59  Aligned_cols=18  Identities=61%  Similarity=0.828  Sum_probs=17.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ||+++|+.|+|||+|+.+
T Consensus         1 kI~V~G~~g~GKTsLi~~   18 (119)
T PF08477_consen    1 KIVVLGDSGVGKTSLIRR   18 (119)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             CEEEECcCCCCHHHHHHH
Confidence            799999999999999996


No 119
>cd04154 Arl2 Arl2 subfamily.  Arl2 (Arf-like 2) GTPases are members of the Arf family that bind GDP and GTP with very low affinity.  Unlike most Arf family proteins, Arl2 is not myristoylated at its N-terminal helix.  The protein PDE-delta, first identified in photoreceptor rod cells, binds specifically to Arl2 and is structurally very similar to RhoGDI.  Despite the high structural similarity between Arl2 and Rho proteins and between PDE-delta and RhoGDI, the interactions between the GTPases and their effectors are very different.  In its GTP bound form, Arl2 interacts with the protein Binder of Arl2 (BART), and the complex is believed to play a role in mitochondrial adenine nucleotide transport.  In its GDP bound form, Arl2 interacts with tubulin- folding Cofactor D; this interaction is believed to play a role in regulation of microtubule dynamics that impact the cytoskeleton, cell division, and cytokinesis.
Probab=98.50  E-value=2.1e-07  Score=54.06  Aligned_cols=37  Identities=19%  Similarity=0.300  Sum_probs=27.7

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ....+|++++|++++|||+|+.+      +....+ ..+.||++
T Consensus        11 ~~~~~kv~ivG~~~~GKTsL~~~------l~~~~~-~~~~~t~g   47 (173)
T cd04154          11 KEREMRILILGLDNAGKTTILKK------LLGEDI-DTISPTLG   47 (173)
T ss_pred             CCCccEEEEECCCCCCHHHHHHH------HccCCC-CCcCCccc
Confidence            34568999999999999999997      554433 35667765


No 120
>cd04155 Arl3 Arl3 subfamily.  Arl3 (Arf-like 3) is an Arf family protein that differs from most Arf family members in the N-terminal extension.  In is inactive, GDP-bound form, the N-terminal extension forms an elongated loop that is hydrophobically anchored into the membrane surface; however, it has been proposed that this region might form a helix in the GTP-bound form.  The delta subunit of the rod-specific cyclic GMP phosphodiesterase type 6 (PDEdelta) is an Arl3 effector.  Arl3 binds microtubules in a regulated manner to alter specific aspects of cytokinesis via interactions with retinitis pigmentosa 2 (RP2).  It has been proposed that RP2 functions in concert with Arl3 to link the cell membrane and the cytoskeleton in photoreceptors as part of the cell signaling or vesicular transport machinery.  In mice, the absence of Arl3 is associated with abnormal epithelial cell proliferation and cyst formation.
Probab=98.49  E-value=1.1e-07  Score=54.96  Aligned_cols=22  Identities=23%  Similarity=0.374  Sum_probs=19.7

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++++++|++|+|||+|+.+
T Consensus        12 ~~~~~v~i~G~~g~GKStLl~~   33 (173)
T cd04155          12 SEEPRILILGLDNAGKTTILKQ   33 (173)
T ss_pred             CCccEEEEEccCCCCHHHHHHH
Confidence            3468999999999999999986


No 121
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily.  Arl2l1 (Arl2-like protein 1) and Arl13 form a subfamily of the Arf family of small GTPases.  Arl2l1 was identified in human cells during a search for the gene(s) responsible for Bardet-Biedl syndrome (BBS).  Like Arl6, the identified BBS gene, Arl2l1 is proposed to have cilia-specific functions.  Arl13 is found on the X chromosome, but its expression has not been confirmed; it may be a pseudogene.
Probab=98.48  E-value=1.6e-07  Score=54.61  Aligned_cols=32  Identities=31%  Similarity=0.355  Sum_probs=26.3

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +++++|+++||||+|+.+      +... +...+.||++
T Consensus         1 ~i~~~G~~~~GKTsl~~~------l~~~-~~~~~~~t~g   32 (167)
T cd04161           1 TLLTVGLDNAGKTTLVSA------LQGE-IPKKVAPTVG   32 (167)
T ss_pred             CEEEECCCCCCHHHHHHH------HhCC-CCccccCccc
Confidence            478999999999999986      5544 6677888887


No 122
>TIGR00231 small_GTP small GTP-binding protein domain. This model recognizes a large number of small GTP-binding proteins and related domains in larger proteins. Note that the alpha chains of heterotrimeric G proteins are larger proteins in which the NKXD motif is separated from the GxxxxGK[ST] motif (P-loop) by a long insert and are not easily detected by this model.
Probab=98.48  E-value=4.7e-07  Score=50.23  Aligned_cols=34  Identities=32%  Similarity=0.482  Sum_probs=26.8

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +||+++|++|+|||+|+.+      +....+...+.++++
T Consensus         2 ~ki~~~G~~~~GKstl~~~------l~~~~~~~~~~~~~~   35 (161)
T TIGR00231         2 IKIVIVGDPNVGKSTLLNR------LLGNKFITEYKPGTT   35 (161)
T ss_pred             eEEEEECCCCCCHHHHHHH------HhCCCCcCcCCCCce
Confidence            6999999999999999997      555556555655554


No 123
>cd04151 Arl1 Arl1 subfamily.  Arl1 (Arf-like 1) localizes to the Golgi complex, where it is believed to recruit effector proteins to the trans-Golgi network.  Like most members of the Arf family, Arl1 is myristoylated at its N-terminal helix and mutation of the myristoylation site disrupts Golgi targeting.  In humans, the Golgi-localized proteins golgin-97 and golgin-245 have been identified as Arl1 effectors.  Golgins are large coiled-coil proteins found in the Golgi, and these golgins contain a C-terminal GRIP domain, which is the site of Arl1 binding.  Additional Arl1 effectors include the GARP (Golgi-associated retrograde protein)/VFT (Vps53) vesicle-tethering complex and Arfaptin 2.  Arl1 is not required for exocytosis, but appears necessary for trafficking from the endosomes to the Golgi.  In Drosophila zygotes, mutation of Arl1 is lethal, and in the host-bloodstream form of Trypanosoma brucei, Arl1 is essential for viability.
Probab=98.46  E-value=2.2e-07  Score=53.15  Aligned_cols=32  Identities=25%  Similarity=0.558  Sum_probs=24.3

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      |++++|+.++|||+|+.+      +..+.+.. +.||++
T Consensus         1 kv~lvG~~~~GKTsl~~~------l~~~~~~~-~~~t~~   32 (158)
T cd04151           1 RILILGLDNAGKTTILYR------LQLGEVVT-TIPTIG   32 (158)
T ss_pred             CEEEECCCCCCHHHHHHH------HccCCCcC-cCCccC
Confidence            689999999999999997      55444443 456665


No 124
>smart00178 SAR Sar1p-like members of the Ras-family  of small GTPases. Yeast SAR1 is an essential gene required for transport of secretory proteins from the endoplasmic reticulum to the Golgi apparatus.
Probab=98.43  E-value=4.8e-07  Score=53.46  Aligned_cols=22  Identities=27%  Similarity=0.383  Sum_probs=19.7

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+|++++|++|+||||++.+
T Consensus        15 ~~~~~i~ivG~~~~GKTsli~~   36 (184)
T smart00178       15 NKHAKILFLGLDNAGKTTLLHM   36 (184)
T ss_pred             cccCEEEEECCCCCCHHHHHHH
Confidence            3458999999999999999996


No 125
>PRK04213 GTP-binding protein; Provisional
Probab=98.39  E-value=1.1e-06  Score=52.07  Aligned_cols=34  Identities=24%  Similarity=0.359  Sum_probs=25.1

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccc
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVP   49 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~   49 (65)
                      ...++++++|+++||||||+.+      +....+...+.|
T Consensus         7 ~~~~~i~i~G~~~~GKSsLin~------l~~~~~~~~~~~   40 (201)
T PRK04213          7 DRKPEIVFVGRSNVGKSTLVRE------LTGKKVRVGKRP   40 (201)
T ss_pred             CCCCEEEEECCCCCCHHHHHHH------HhCCCCccCCCC
Confidence            3457999999999999999996      554444443444


No 126
>cd04160 Arfrp1 Arfrp1 subfamily.  Arfrp1 (Arf-related protein 1), formerly known as ARP, is a membrane-associated Arf family member that lacks the N-terminal myristoylation motif.  Arfrp1 is mainly associated with the trans-Golgi compartment and the trans-Golgi network, where it regulates the targeting of Arl1 and the GRIP domain-containing proteins, golgin-97 and golgin-245, onto Golgi membranes.  It is also involved in the anterograde transport of the vesicular stomatitis virus G protein from the Golgi to the plasma membrane, and in the retrograde transport of TGN38 and Shiga toxin from endosomes to the trans-Golgi network.  Arfrp1 also inhibits Arf/Sec7-dependent activation of phospholipase D.  Deletion of Arfrp1 in mice causes embryonic lethality at the gastrulation stage and apoptosis of mesodermal cells, indicating its importance in development.
Probab=98.38  E-value=5.7e-07  Score=51.55  Aligned_cols=38  Identities=18%  Similarity=0.114  Sum_probs=24.4

Q ss_pred             EEEEECCCCChHHHHHhHhhhcccc-ccccccccccceEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQV-SLSQLLTTHVPTVW   52 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~-~~~~~~~~~~~ti~   52 (65)
                      +++++|+.|+|||+|+.+ ++.... ....+...+.||++
T Consensus         1 ~i~~vG~~~~GKstLi~~-l~~~~~~~~~~~~~~~~~t~~   39 (167)
T cd04160           1 SVLILGLDNAGKTTFLEQ-LKTLFSKYKGLPPSKITPTVG   39 (167)
T ss_pred             CEEEEecCCCCHHHHHHH-HhhhcccccCCcccccCCccc
Confidence            578999999999999986 222111 11233445667765


No 127
>cd04156 ARLTS1 ARLTS1 subfamily.  ARLTS1 (Arf-like tumor suppressor gene 1), also known as Arl11, is a member of the Arf family of small GTPases that is believed to play a major role in apoptotic signaling.  ARLTS1 is widely expressed and functions as a tumor suppressor gene in several human cancers.  ARLTS1 is a low-penetrance suppressor that accounts for a small percentage of familial melanoma or familial chronic lymphocytic leukemia (CLL).  ARLTS1 inactivation seems to occur most frequently through biallelic down-regulation by hypermethylation of the promoter.  In breast cancer, ARLTS1 alterations were typically a combination of a hypomorphic polymorphism plus loss of heterozygosity.  In a case of thyroid adenoma, ARLTS1 alterations were polymorphism plus promoter hypermethylation.  The nonsense polymorphism Trp149Stop occurs with significantly greater frequency in familial cancer cases than in sporadic cancer cases, and the Cys148Arg polymorphism is associated with an increase in h
Probab=98.38  E-value=4.9e-07  Score=51.49  Aligned_cols=32  Identities=28%  Similarity=0.533  Sum_probs=24.6

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      +++++|++|||||+|+.+      +..+.+.. +.||++
T Consensus         1 ~i~i~G~~~~GKTsl~~~------~~~~~~~~-~~~t~~   32 (160)
T cd04156           1 QVLLLGLDSAGKSTLLYK------LKHAELVT-TIPTVG   32 (160)
T ss_pred             CEEEEcCCCCCHHHHHHH------HhcCCccc-ccCccC
Confidence            588999999999999997      66665543 356664


No 128
>PRK00454 engB GTP-binding protein YsxC; Reviewed
Probab=98.36  E-value=7.3e-07  Score=52.43  Aligned_cols=24  Identities=33%  Similarity=0.486  Sum_probs=21.1

Q ss_pred             CCceeeEEEEECCCCChHHHHHhH
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+...+++++|++|+|||||+.+
T Consensus        20 ~~~~~~~v~ivG~~~~GKSsli~~   43 (196)
T PRK00454         20 PPDDGPEIAFAGRSNVGKSSLINA   43 (196)
T ss_pred             CCCCCCEEEEEcCCCCCHHHHHHH
Confidence            445678999999999999999996


No 129
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily.  Arl5 (Arf-like 5) and Arl8, like Arl4 and Arl7, are localized to the nucleus and nucleolus.  Arl5 is developmentally regulated during embryogenesis in mice.  Human Arl5 interacts with the heterochromatin protein 1-alpha (HP1alpha), a nonhistone chromosomal protein that is associated with heterochromatin and telomeres, and prevents telomere fusion.  Arl5 may also play a role in embryonic nuclear dynamics and/or signaling cascades. Arl8 was identified from a fetal cartilage cDNA library.  It is found in brain, heart, lung, cartilage, and kidney.  No function has been assigned for Arl8 to date.
Probab=98.34  E-value=6.4e-07  Score=52.29  Aligned_cols=34  Identities=26%  Similarity=0.428  Sum_probs=27.4

Q ss_pred             eeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         12 LVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      .+|++++|++++|||+|+.+      +..+.+.. +.||++
T Consensus        15 ~~kv~~~G~~~~GKTsl~~~------l~~~~~~~-~~~t~~   48 (174)
T cd04153          15 EYKVIIVGLDNAGKTTILYQ------FLLGEVVH-TSPTIG   48 (174)
T ss_pred             ccEEEEECCCCCCHHHHHHH------HccCCCCC-cCCccc
Confidence            57999999999999999997      66555554 467776


No 130
>cd00879 Sar1 Sar1 subfamily.  Sar1 is an essential component of COPII vesicle coats involved in export of cargo from the ER.  The GTPase activity of Sar1 functions as a molecular switch to control protein-protein and protein-lipid interactions that direct vesicle budding from the ER.  Activation of the GDP to the GTP-bound form of Sar1 involves the membrane-associated guanine nucleotide exchange factor (GEF) Sec12.  Sar1 is unlike all Ras superfamily GTPases that use either myristoyl or prenyl groups to direct membrane association and function, in that Sar1 lacks such modification.  Instead, Sar1 contains a unique nine-amino-acid N-terminal extension.  This extension contains an evolutionarily conserved cluster of bulky hydrophobic amino acids, referred to as the Sar1-N-terminal activation recruitment (STAR) motif.  The STAR motif mediates the recruitment of Sar1 to ER membranes and facilitates its interaction with mammalian Sec12 GEF leading to activation.
Probab=98.33  E-value=4.2e-07  Score=53.37  Aligned_cols=36  Identities=31%  Similarity=0.441  Sum_probs=26.0

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ...+|++++|++|+|||||+.+      +..+.+. .+.||++
T Consensus        17 ~~~~ki~ilG~~~~GKStLi~~------l~~~~~~-~~~~T~~   52 (190)
T cd00879          17 NKEAKILFLGLDNAGKTTLLHM------LKDDRLA-QHVPTLH   52 (190)
T ss_pred             cCCCEEEEECCCCCCHHHHHHH------HhcCCCc-ccCCccC
Confidence            3468999999999999999996      5544442 3445543


No 131
>KOG0096|consensus
Probab=98.31  E-value=8.3e-07  Score=54.11  Aligned_cols=42  Identities=24%  Similarity=0.209  Sum_probs=37.8

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYR   58 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~   58 (65)
                      -..+|++++||.|.|||+...|      ...++|...|.||+| ++.+.
T Consensus         8 ~~~fklvlvGdgg~gKtt~vkr------~ltgeFe~~y~at~G-v~~~p   49 (216)
T KOG0096|consen    8 GLTFKLVLVGDGGTGKTTFVKR------HLTGEFEKTYPATLG-VEVHP   49 (216)
T ss_pred             cceEEEEEecCCcccccchhhh------hhcccceecccCcce-eEEee
Confidence            4679999999999999999998      999999999999999 66554


No 132
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases.  Arf proteins are activators of phospholipase D isoforms.  Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated.  Arfs are N-terminally myristoylated.  Members of the Arf family are regulators of vesicle formation in intracellular traffic that interact reversibly with membranes of the secretory and endocytic compartments in a GTP-dependent manner.  They depart from other small GTP-binding proteins by a unique structural device, interswitch toggle, that implements front-back communication from N-terminus to the nucleotide binding site.  Arf-like (Arl) proteins are close relatives of the Arf, but only Arl1 has been shown to function in membrane traffic like the Arf proteins.  Arl2 has an unrelated function in the folding of native tubulin, and Arl4 may function in the nucleus.  Most other Arf family proteins are so far relatively poorly characterized.  Thu
Probab=98.30  E-value=9.3e-07  Score=50.32  Aligned_cols=32  Identities=25%  Similarity=0.549  Sum_probs=23.5

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      |++++|+.|+|||||+.+      +..+. ...+.||++
T Consensus         1 ki~iiG~~~~GKssli~~------~~~~~-~~~~~~t~~   32 (158)
T cd00878           1 RILILGLDGAGKTTILYK------LKLGE-VVTTIPTIG   32 (158)
T ss_pred             CEEEEcCCCCCHHHHHHH------HhcCC-CCCCCCCcC
Confidence            689999999999999996      54443 233455555


No 133
>cd01878 HflX HflX subfamily.  A distinct conserved domain with a glycine-rich segment N-terminal of the GTPase domain characterizes the HflX subfamily.  The E. coli HflX has been implicated in the control of the lambda cII repressor proteolysis, but the actual biological functions of these GTPases remain unclear.  HflX is widespread, but not universally represented in all three superkingdoms.
Probab=98.22  E-value=2.8e-06  Score=50.54  Aligned_cols=21  Identities=33%  Similarity=0.452  Sum_probs=19.0

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++++|++|||||||+.+
T Consensus        40 ~~~~I~iiG~~g~GKStLl~~   60 (204)
T cd01878          40 GIPTVALVGYTNAGKSTLFNA   60 (204)
T ss_pred             CCCeEEEECCCCCCHHHHHHH
Confidence            357999999999999999985


No 134
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB. Members of this protein family are a GTPase associated with ribosome biogenesis, typified by YsxC from Bacillus subutilis. The family is widely but not universally distributed among bacteria. Members commonly are called EngB based on homology to EngA, one of several other GTPases of ribosome biogenesis. Cutoffs as set find essentially all bacterial members, but also identify large numbers of eukaryotic (probably organellar) sequences. This protein is found in about 80 percent of bacterial genomes.
Probab=98.21  E-value=2.6e-06  Score=49.97  Aligned_cols=23  Identities=30%  Similarity=0.397  Sum_probs=20.6

Q ss_pred             CceeeEEEEECCCCChHHHHHhH
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .....+++++|++|+|||||+.+
T Consensus        15 ~~~~~~i~ivG~~~~GKStlin~   37 (179)
T TIGR03598        15 PDDGPEIAFAGRSNVGKSSLINA   37 (179)
T ss_pred             CCCCCEEEEEcCCCCCHHHHHHH
Confidence            35678999999999999999996


No 135
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta).  SR-beta and SR-alpha form the heterodimeric signal recognition particle (SRP or SR) receptor that binds SRP to regulate protein translocation across the ER membrane.  Nascent polypeptide chains are synthesized with an N-terminal hydrophobic signal sequence that binds SRP54, a component of the SRP.  SRP directs targeting of the ribosome-nascent chain complex (RNC) to the ER membrane via interaction with the SR, which is localized to the ER membrane.  The RNC is then transferred to the protein-conducting channel, or translocon, which facilitates polypeptide translation across the ER membrane or integration into the ER membrane.  SR-beta is found only in eukaryotes; it is believed to control the release of the signal sequence from SRP54 upon binding of the ribosome to the translocon.  High expression of SR-beta has been observed in human colon cancer, suggesting it may play a role in the development of this typ
Probab=98.19  E-value=3.8e-06  Score=50.66  Aligned_cols=31  Identities=19%  Similarity=0.334  Sum_probs=24.2

Q ss_pred             EEEEECCCCChHHHHHhHhhhccccccccccccccce
Q psy15257         14 KCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPT   50 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~t   50 (65)
                      .++++|++++|||+|+.+      +..+.+...+.++
T Consensus         2 ~vll~G~~~sGKTsL~~~------l~~~~~~~t~~s~   32 (203)
T cd04105           2 TVLLLGPSDSGKTALFTK------LTTGKYRSTVTSI   32 (203)
T ss_pred             eEEEEcCCCCCHHHHHHH------HhcCCCCCccCcE
Confidence            589999999999999997      6666665555444


No 136
>KOG0083|consensus
Probab=98.14  E-value=3.6e-07  Score=53.47  Aligned_cols=33  Identities=33%  Similarity=0.459  Sum_probs=28.1

Q ss_pred             EECCCCChHHHHHhHhhhcccccccccc-ccccceEEEEee
Q psy15257         17 VVGDTAVGKTRLICARACNKQVSLSQLL-TTHVPTVWAIDQ   56 (65)
Q Consensus        17 ~lG~~gvGKTsl~~~~~~~~~~~~~~~~-~~~~~ti~~vd~   56 (65)
                      ++||+++|||||+.|      |..+.|. .++.+|+| ||+
T Consensus         2 llgds~~gktcllir------~kdgafl~~~fistvg-id~   35 (192)
T KOG0083|consen    2 LLGDSCTGKTCLLIR------FKDGAFLAGNFISTVG-IDF   35 (192)
T ss_pred             ccccCccCceEEEEE------eccCceecCceeeeee-ecc
Confidence            689999999999998      8888876 57889998 554


No 137
>PF00025 Arf:  ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins;  InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases. This superfamily contains proteins that control a vast number of important processes and possess a common, structurally preserved GTP-binding domain [, ]. Sequence comparisons of small G proteins from various species have revealed that they are conserved in primary structures at the level of 30-55% similarity []. Crystallographic analysis of various small G proteins revealed the presence of a 20 kDa catalytic domain that is unique for the whole superfamily [, ]. The domain is built of five alpha helices (A1-A5), six beta-strands (B1-B6) and five polypeptide loops (G1-G5). A structural comparison of the GTP- and GDP-bound form, allows one to distinguish two functional loop regions: switch I and switch II that surround the gamma-phosphate group of the nucleotide. The G1 loop (also called the P-loop) that connects the B1 strand and the A1 helix is responsible for the binding of the phosphate groups. The G3 loop provides residues for Mg(2+) and phosphate binding and is located at the N terminus of the A2 helix. The G1 and G3 loops are sequentially similar to Walker A and Walker B boxes that are found in other nucleotide binding motifs. The G2 loop connects the A1 helix and the B2 strand and contains a conserved Thr residue responsible for Mg(2+) binding. The guanine base is recognised by the G4 and G5 loops. The consensus sequence NKXD of the G4 loop contains Lys and Asp residues directly interacting with the nucleotide. Part of the G5 loop located between B6 and A5 acts as a recognition site for the guanine base []. The small GTPase superfamily can be divided into at least 8 different families, including:  Arf small GTPases. GTP-binding proteins involved in protein trafficking by modulating vesicle budding and uncoating within the Golgi apparatus. Ran small GTPases. GTP-binding proteins involved in nucleocytoplasmic transport. Required for the import of proteins into the nucleus and also for RNA export. Rab small GTPases. GTP-binding proteins involved in vesicular traffic. Rho small GTPases. GTP-binding proteins that control cytoskeleton reorganisation. Ras small GTPases. GTP-binding proteins involved in signalling pathways. Sar1 small GTPases. Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). Mitochondrial Rho (Miro). Small GTPase domain found in mitochondrial proteins involved in mitochondrial trafficking. Roc small GTPases domain. Small GTPase domain always found associated with the COR domain.  This entry represents a branch of the small GTPase superfamily that includes the ADP ribosylation factor Arf, Arl (Arf-like), Arp (Arf-related proteins) and the remotely related Sar (Secretion-associated and Ras-related) proteins. Arf proteins are major regulators of vesicle biogenesis in intracellular traffic []. They cycle between inactive GDP-bound and active GTP-bound forms that bind selectively to effectors. The classical structural GDP/GTP switch is characterised by conformational changes at the so-called switch 1 and switch 2 regions, which bind tightly to the gamma-phosphate of GTP but poorly or not at all to the GDP nucleotide. Structural studies of Arf1 and Arf6 have revealed that although these proteins feature the switch 1 and 2 conformational changes, they depart from other small GTP-binding proteins in that they use an additional, unique switch to propagate structural information from one side of the protein to the other.   The GDP/GTP structural cycles of human Arf1 and Arf6 feature a unique conformational change that affects the beta2-beta3 strands connecting switch 1 and switch 2 (interswitch) and also the amphipathic helical N terminus. In GDP-bound Arf1 and Arf6, the interswitch is retracted and forms a pocket to which the N-terminal helix binds, the latter serving as a molecular hasp to maintain the inactive conformation. In the GTP-bound form of these proteins, the interswitch undergoes a two-residue register shift that pulls switch 1 and switch 2 up, restoring an active conformation that can bind GTP. In this conformation, the interswitch projects out of the protein and extrudes the N-terminal hasp by occluding its binding pocket.; GO: 0005525 GTP binding; PDB: 2H57_B 2W83_B 3N5C_B 2J5X_A 3LVR_E 2BAO_A 3LVQ_E 2A5F_A 3PCR_B 1E0S_A ....
Probab=98.13  E-value=3.2e-06  Score=49.78  Aligned_cols=36  Identities=22%  Similarity=0.409  Sum_probs=27.7

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ....||+++|..++|||+++.+      +..+.+.. ..||+|
T Consensus        12 ~~~~~ililGl~~sGKTtll~~------l~~~~~~~-~~pT~g   47 (175)
T PF00025_consen   12 KKEIKILILGLDGSGKTTLLNR------LKNGEISE-TIPTIG   47 (175)
T ss_dssp             TSEEEEEEEESTTSSHHHHHHH------HHSSSEEE-EEEESS
T ss_pred             CcEEEEEEECCCccchHHHHHH------hhhccccc-cCcccc
Confidence            5678999999999999999996      55444333 667765


No 138
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans.  NOG1 is functionally linked to ribosome biogenesis and found in association with the nuclear pore complexes and identified in many preribosomal complexes.  Thus, defects in NOG1 can lead to defects in 60S biogenesis.  The S. cerevisiae NOG1 gene is essential for cell viability, and mutations in the predicted G motifs abrogate function.  It is a member of the ODN family of GTP-binding proteins that also includes the bacterial Obg and DRG proteins.
Probab=98.11  E-value=9.2e-06  Score=46.53  Aligned_cols=18  Identities=33%  Similarity=0.523  Sum_probs=17.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|++++|||||+.+
T Consensus         2 ~i~~~G~~~~GKssli~~   19 (168)
T cd01897           2 TLVIAGYPNVGKSSLVNK   19 (168)
T ss_pred             eEEEEcCCCCCHHHHHHH
Confidence            789999999999999996


No 139
>KOG1673|consensus
Probab=98.08  E-value=1.9e-06  Score=51.52  Aligned_cols=49  Identities=16%  Similarity=0.160  Sum_probs=40.3

Q ss_pred             CCceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEEe
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKDT   63 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~i   63 (65)
                      .....+|+-++||..+|||+++.+      |..+++..++.-+.| +.+..+++.|
T Consensus        16 ~n~Vslkv~llGD~qiGKTs~mvk------YV~~~~de~~~q~~G-vN~mdkt~~i   64 (205)
T KOG1673|consen   16 SNLVSLKVGLLGDAQIGKTSLMVK------YVQNEYDEEYTQTLG-VNFMDKTVSI   64 (205)
T ss_pred             ccceEEEEEeecccccCceeeehh------hhcchhHHHHHHHhC-ccceeeEEEe
Confidence            445679999999999999999999      999988888888887 6666655543


No 140
>cd01850 CDC_Septin CDC/Septin.  Septins are a conserved family of GTP-binding proteins associated with diverse processes in dividing and non-dividing cells.  They were first discovered in the budding yeast S. cerevisiae as a set of genes (CDC3, CDC10, CDC11 and CDC12) required for normal bud morphology. Septins are also present in metazoan cells, where they are required for cytokinesis in some systems, and implicated in a variety of other processes involving organization of the cell cortex and exocytosis.  In humans, 12 septin genes generate dozens of polypeptides, many of which comprise heterooligomeric complexes. Since septin mutants are commonly defective in cytokinesis and formation of the neck formation of the neck filaments/septin rings, septins have been considered to be the primary constituents of the neck filaments.  Septins belong to the GTPase superfamily for their conserved GTPase motifs and enzymatic activities.
Probab=98.08  E-value=1.2e-05  Score=50.72  Aligned_cols=21  Identities=29%  Similarity=0.504  Sum_probs=19.2

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++++|++|+|||||+.+
T Consensus         3 ~~f~I~vvG~sg~GKSTliN~   23 (276)
T cd01850           3 FQFNIMVVGESGLGKSTFINT   23 (276)
T ss_pred             cEEEEEEEcCCCCCHHHHHHH
Confidence            358999999999999999996


No 141
>cd01876 YihA_EngB The YihA (EngB) subfamily.  This subfamily of GTPases is typified by the E. coli YihA, an essential protein involved in cell division control.  YihA and its orthologs are small proteins that typically contain less than 200 amino acid residues and consists of the GTPase domain only (some of the eukaryotic homologs contain an N-terminal extension of about 120 residues that might be involved in organellar targeting).  Homologs of yihA are found in most Gram-positive and Gram-negative pathogenic bacteria, with the exception of Mycobacterium tuberculosis.  The broad-spectrum nature of YihA and its essentiality for cell viability in bacteria make it an attractive antibacterial target.
Probab=98.03  E-value=6.5e-06  Score=46.41  Aligned_cols=18  Identities=39%  Similarity=0.575  Sum_probs=16.4

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|++|+|||||+.+
T Consensus         1 ~i~l~G~~g~GKTtL~~~   18 (170)
T cd01876           1 EIAFAGRSNVGKSSLINA   18 (170)
T ss_pred             CEEEEcCCCCCHHHHHHH
Confidence            478999999999999996


No 142
>cd01898 Obg Obg subfamily.  The Obg nucleotide binding protein subfamily has been implicated in stress response, chromosome partitioning, replication initiation, mycelium development, and sporulation.  Obg proteins are among a large group of GTP binding proteins conserved from bacteria to humans.  The E. coli homolog, ObgE is believed to function in ribosomal biogenesis.  Members of the subfamily contain two equally and highly conserved domains, a C-terminal GTP binding domain and an N-terminal glycine-rich domain.
Probab=98.02  E-value=9.5e-06  Score=46.47  Aligned_cols=18  Identities=33%  Similarity=0.469  Sum_probs=16.5

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|+.++|||||+.+
T Consensus         2 ~v~ivG~~~~GKStl~~~   19 (170)
T cd01898           2 DVGLVGLPNAGKSTLLSA   19 (170)
T ss_pred             CeEEECCCCCCHHHHHHH
Confidence            578999999999999985


No 143
>KOG4423|consensus
Probab=97.96  E-value=3.8e-07  Score=55.66  Aligned_cols=41  Identities=29%  Similarity=0.329  Sum_probs=36.6

Q ss_pred             CceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEee
Q psy15257          9 HQELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQ   56 (65)
Q Consensus         9 ~~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~   56 (65)
                      ....+|+.++|+.|+|||+++.|      |....|+.+|..||| +|+
T Consensus        22 r~hL~k~lVig~~~vgkts~i~r------yv~~nfs~~yRAtIg-vdf   62 (229)
T KOG4423|consen   22 REHLFKVLVIGDLGVGKTSSIKR------YVHQNFSYHYRATIG-VDF   62 (229)
T ss_pred             hhhhhhhheeeeccccchhHHHH------HHHHHHHHHHHHHHh-HHH
Confidence            35679999999999999999998      999999999999999 554


No 144
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]
Probab=97.94  E-value=7e-07  Score=59.21  Aligned_cols=20  Identities=35%  Similarity=0.408  Sum_probs=17.7

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-.+.++||+|||||+.+.+
T Consensus       203 ~~vi~LVGPTGVGKTTTlAK  222 (407)
T COG1419         203 KRVIALVGPTGVGKTTTLAK  222 (407)
T ss_pred             CcEEEEECCCCCcHHHHHHH
Confidence            45788999999999999987


No 145
>cd04104 p47_IIGP_like p47 (47-kDa) family.  The p47 GTPase family consists of several highly homologous proteins, including IGTP, TGTP/Mg21, IRG-47, GTPI, LRG-47, and IIGP1.  They are found in higher eukaryotes where they play a role in immune resistance against intracellular pathogens.  p47 proteins exist at low resting levels in mouse cells, but are strongly induced by Type II interferon (IFN-gamma).  ITGP is critical for resistance to Toxoplasma gondii infection and in involved in inhibition of Coxsackievirus-B3-induced apoptosis.  TGTP was shown to limit vesicular stomatitis virus (VSV) infection of fibroblasts in vitro.  IRG-47 is involved in resistance to T. gondii infection.  LRG-47 has been implicated in resistance to T. gondii, Listeria monocytogenes, Leishmania, and mycobacterial infections.  IIGP1 has been shown to localize to the ER and to the Golgi membranes in IFN-induced cells and inflamed tissues.  In macrophages, IIGP1 interacts with hook3, a microtubule binding protei
Probab=97.88  E-value=1.3e-05  Score=47.98  Aligned_cols=19  Identities=32%  Similarity=0.599  Sum_probs=17.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      +|++++|++|+|||||+..
T Consensus         2 ~kI~i~G~~g~GKSSLin~   20 (197)
T cd04104           2 LNIAVTGESGAGKSSFINA   20 (197)
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            6899999999999999986


No 146
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins.  GTPases act as molecular switches regulating diverse cellular processes.  DRG2 and DRG1 comprise the DRG subfamily in eukaryotes.  In view of their widespread expression in various tissues and high conservation among distantly related species in eukaryotes and archaea, DRG proteins may regulate fundamental cellular processes.  It is proposed that the DRG subfamily proteins play their physiological roles through RNA binding.
Probab=97.85  E-value=4.9e-05  Score=46.87  Aligned_cols=18  Identities=33%  Similarity=0.599  Sum_probs=16.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|++++|||+|+.+
T Consensus         2 ~v~lvG~~~~GKStLl~~   19 (233)
T cd01896           2 RVALVGFPSVGKSTLLSK   19 (233)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            688999999999999985


No 147
>KOG1707|consensus
Probab=97.82  E-value=2.1e-05  Score=54.28  Aligned_cols=31  Identities=32%  Similarity=0.512  Sum_probs=24.5

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhcccccccccccc
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTT   46 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~   46 (65)
                      ....+|+++||.|||||||+..      ....+|.++
T Consensus         7 ~kdVRIvliGD~G~GKtSLImS------L~~eef~~~   37 (625)
T KOG1707|consen    7 LKDVRIVLIGDEGVGKTSLIMS------LLEEEFVDA   37 (625)
T ss_pred             ccceEEEEECCCCccHHHHHHH------HHhhhcccc
Confidence            4568999999999999999997      555555543


No 148
>cd04171 SelB SelB subfamily.  SelB is an elongation factor needed for the co-translational incorporation of selenocysteine.  Selenocysteine is coded by a UGA stop codon in combination with a specific downstream mRNA hairpin.  In bacteria, the C-terminal part of SelB recognizes this hairpin, while the N-terminal part binds GTP and tRNA in analogy with elongation factor Tu (EF-Tu).  It specifically recognizes the selenocysteine charged tRNAsec, which has a UCA anticodon, in an EF-Tu like manner. This allows insertion of selenocysteine at in-frame UGA stop codons.  In E. coli SelB binds GTP, selenocysteyl-tRNAsec, and a stem-loop structure immediately downstream of the UGA codon (the SECIS sequence).  The absence of active SelB prevents the participation of selenocysteyl-tRNAsec in translation.  Archaeal and animal mechanisms of selenocysteine incorporation are more complex.  Although the SECIS elements have different secondary structures and conserved elements between archaea and eukaryo
Probab=97.81  E-value=4.3e-05  Score=43.28  Aligned_cols=18  Identities=39%  Similarity=0.324  Sum_probs=16.5

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|+++||||||+.+
T Consensus         2 ~i~i~G~~~~GKssl~~~   19 (164)
T cd04171           2 IIGTAGHIDHGKTTLIKA   19 (164)
T ss_pred             EEEEEecCCCCHHHHHHH
Confidence            578999999999999996


No 149
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily.  BipA is a protein belonging to the ribosome-binding family of GTPases and is widely distributed in bacteria and plants.  BipA was originally described as a protein that is induced in Salmonella typhimurium after exposure to bactericidal/permeability-inducing protein (a cationic antimicrobial protein produced by neutrophils), and has since been identified in E. coli as well.  The properties thus far described for BipA are related to its role in the process of pathogenesis by enteropathogenic E. coli.  It appears to be involved in the regulation of several processes important for infection, including rearrangements of the cytoskeleton of the host, bacterial resistance to host defense peptides, flagellum-mediated cell motility, and expression of K5 capsular genes.  It has been proposed that BipA may utilize a novel mechanism to regulate the expression of target genes.  In addition, BipA from enteropathogenic E. co
Probab=97.80  E-value=3.7e-05  Score=45.57  Aligned_cols=19  Identities=26%  Similarity=0.370  Sum_probs=17.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++++|+.++|||||+.+
T Consensus         3 r~i~ivG~~~~GKTsL~~~   21 (194)
T cd01891           3 RNIAIIAHVDHGKTTLVDA   21 (194)
T ss_pred             cEEEEEecCCCCHHHHHHH
Confidence            4899999999999999997


No 150
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes.  It controls modification of the uridine at the wobble position (U34) of tRNAs that read codons ending with A or G in the mixed codon family boxes.  TrmE contains a GTPase domain that forms a canonical Ras-like fold.  It functions a molecular switch GTPase, and apparently uses a conformational change associated with GTP hydrolysis to promote the tRNA modification reaction, in which the conserved cysteine in the C-terminal domain is thought to function as a catalytic residue.  In bacteria that are able to survive in extremely low pH conditions, TrmE regulates glutamate-dependent acid resistance.
Probab=97.76  E-value=7.9e-05  Score=41.74  Aligned_cols=19  Identities=47%  Similarity=0.789  Sum_probs=17.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ++++++|++|+|||+++.+
T Consensus         2 ~~i~l~G~~~~GKstli~~   20 (157)
T cd04164           2 IKVVIVGKPNVGKSSLLNA   20 (157)
T ss_pred             cEEEEECCCCCCHHHHHHH
Confidence            5899999999999999985


No 151
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily.  IF2/eIF5B contribute to ribosomal subunit joining and function as GTPases that are maximally activated by the presence of both ribosomal subunits.  As seen in other GTPases, IF2/IF5B undergoes conformational changes between its GTP- and GDP-bound states.  Eukaryotic IF2/eIF5Bs possess three characteristic segments, including a divergent N-terminal region followed by conserved central and C-terminal segments.  This core region is conserved among all known eukaryotic and archaeal IF2/eIF5Bs and eubacterial IF2s.
Probab=97.72  E-value=7.2e-05  Score=42.63  Aligned_cols=18  Identities=33%  Similarity=0.433  Sum_probs=16.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++++|||||+.+
T Consensus         2 ~i~iiG~~~~GKtsli~~   19 (168)
T cd01887           2 VVTVMGHVDHGKTTLLDK   19 (168)
T ss_pred             EEEEEecCCCCHHHHHHH
Confidence            488999999999999996


No 152
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE, also called MnmE and previously designated ThdF (thiophene and furan oxidation protein), is a GTPase involved in tRNA modification to create 5-methylaminomethyl-2-thiouridine in the wobble position of some tRNAs. This protein and GidA form an alpha2/beta2 heterotetramer.
Probab=97.71  E-value=9.6e-05  Score=49.53  Aligned_cols=21  Identities=38%  Similarity=0.564  Sum_probs=19.2

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+|++++|+++||||||+.+
T Consensus       202 ~g~kVvIvG~~nvGKSSLiN~  222 (442)
T TIGR00450       202 DGFKLAIVGSPNVGKSSLLNA  222 (442)
T ss_pred             cCCEEEEECCCCCcHHHHHHH
Confidence            457999999999999999996


No 153
>TIGR03156 GTP_HflX GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like).
Probab=97.69  E-value=9.6e-05  Score=48.21  Aligned_cols=21  Identities=33%  Similarity=0.491  Sum_probs=18.9

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++++|.+++|||||+.+
T Consensus       188 ~~~~ValvG~~NvGKSSLln~  208 (351)
T TIGR03156       188 DVPTVALVGYTNAGKSTLFNA  208 (351)
T ss_pred             CCcEEEEECCCCCCHHHHHHH
Confidence            347999999999999999996


No 154
>PRK15494 era GTPase Era; Provisional
Probab=97.69  E-value=9.9e-05  Score=47.82  Aligned_cols=21  Identities=24%  Similarity=0.480  Sum_probs=19.1

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+++++|+++||||||+.+
T Consensus        51 k~~kV~ivG~~nvGKSTLin~   71 (339)
T PRK15494         51 KTVSVCIIGRPNSGKSTLLNR   71 (339)
T ss_pred             ceeEEEEEcCCCCCHHHHHHH
Confidence            456999999999999999996


No 155
>PF00448 SRP54:  SRP54-type protein, GTPase domain;  InterPro: IPR000897  The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]. SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. This entry represents the GTPase domain of the 54 kDa SRP54 component, a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 of the signal recognition particle has a three-domain structure: an N-terminal helical bundle domain, a GTPase domain, and the M-domain that binds the 7s RNA and also binds the signal sequence. The extreme C-terminal region is glycine-rich and lower in complexity and poorly conserved between species. The GTPase domain is evolutionary related to P-loop NTPase domains found in a variety of other proteins []. These proteins include Escherichia coli and Bacillus subtilis ffh protein (P48), which seems to be the prokaryotic counterpart of SRP54; signal recognition particle receptor alpha subunit (docking protein), an integral membrane GTP-binding protein which ensures, in conjunction with SRP, the correct targeting of nascent secretory proteins to the endoplasmic reticulum membrane; bacterial FtsY protein, which is believed to play a similar role to that of the docking protein in eukaryotes; the pilA protein from Neisseria gonorrhoeae, the homologue of ftsY; and bacterial flagellar biosynthesis protein flhF.; GO: 0005525 GTP binding, 0006614 SRP-dependent cotranslational protein targeting to membrane; PDB: 2OG2_A 3B9Q_A 3DM9_B 3DMD_B 3E70_C 3DM5_B 2XXA_C 2J28_9 1ZU5_B 1ZU4_A ....
Probab=97.67  E-value=2.2e-05  Score=47.48  Aligned_cols=19  Identities=42%  Similarity=0.492  Sum_probs=17.0

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|++|||||+.+.+
T Consensus         2 ~vi~lvGptGvGKTTt~aK   20 (196)
T PF00448_consen    2 KVIALVGPTGVGKTTTIAK   20 (196)
T ss_dssp             EEEEEEESTTSSHHHHHHH
T ss_pred             EEEEEECCCCCchHhHHHH
Confidence            3678999999999999987


No 156
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase).
Probab=97.66  E-value=0.00016  Score=46.85  Aligned_cols=22  Identities=23%  Similarity=0.400  Sum_probs=19.9

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++|+++|.+||||||++.+
T Consensus        36 ~~~~rIllvGktGVGKSSliNs   57 (313)
T TIGR00991        36 VSSLTILVMGKGGVGKSSTVNS   57 (313)
T ss_pred             ccceEEEEECCCCCCHHHHHHH
Confidence            4568999999999999999986


No 157
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1.  Four of these groups (Obg, DRG, YyaF/YchF, and Ygr210) are characterized by a distinct glycine-rich motif immediately following the Walker B motif (G3 box).  Obg/CgtA is an essential gene that is involved in the initiation of sporulation and DNA replication in the bacteria Caulobacter and Bacillus, but its exact molecular role is unknown.  Furthermore, several OBG family members possess a C-terminal RNA-binding domain, the TGS domain, which is also present in threonyl-tRNA synthetase and in bacterial guanosine polyphosphatase SpoT.  Nog1 is a nucleolar protein that might function in ribosome assembly.  The DRG and Nog1 subfamilies are ubiquitous in archaea and eukaryotes, the Ygr210 subfamily is present in archaea and fungi, and the Obg and YyaF/YchF subfamilies are ubiquitous in bacteria and eukaryotes. The Obg/Nog1 and DRG subfamilies appear to 
Probab=97.65  E-value=4.4e-05  Score=43.74  Aligned_cols=15  Identities=47%  Similarity=0.656  Sum_probs=13.6

Q ss_pred             EECCCCChHHHHHhH
Q psy15257         17 VVGDTAVGKTRLICA   31 (65)
Q Consensus        17 ~lG~~gvGKTsl~~~   31 (65)
                      ++|++++|||||+.+
T Consensus         1 iiG~~~~GKStll~~   15 (176)
T cd01881           1 LVGLPNVGKSTLLNA   15 (176)
T ss_pred             CCCCCCCcHHHHHHH
Confidence            479999999999985


No 158
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts).  This family contains several Toc proteins, including Toc34, Toc33, Toc120, Toc159, Toc86, Toc125, and Toc90.  The Toc complex at the outer envelope membrane of chloroplasts is a molecular machine of ~500 kDa that contains a single Toc159 protein, four Toc75 molecules, and four or five copies of Toc34. Toc64 and Toc12 are associated with the translocon, but do not appear to be part of the core complex.  The Toc translocon initiates the import of nuclear-encoded preproteins from the cytosol into the organelle.  Toc34 and Toc159 are both GTPases, while Toc75 is a beta-barrel integral membrane protein.  Toc159 is equally distributed between a soluble cytoplasmic form and a membrane-inserted form, suggesting that assembly of the Toc complex is dynamic.  Toc34 and Toc75 act sequentially to mediate docking and insertion of Toc159 resulting in assembly of the functional translocon.
Probab=97.64  E-value=0.00014  Score=45.46  Aligned_cols=22  Identities=32%  Similarity=0.445  Sum_probs=19.8

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++|+++|.+||||||++.+
T Consensus        29 ~~~~~IllvG~tGvGKSSliNa   50 (249)
T cd01853          29 DFSLTILVLGKTGVGKSSTINS   50 (249)
T ss_pred             cCCeEEEEECCCCCcHHHHHHH
Confidence            4568999999999999999986


No 159
>PRK11058 GTPase HflX; Provisional
Probab=97.61  E-value=0.00012  Score=48.93  Aligned_cols=19  Identities=32%  Similarity=0.392  Sum_probs=17.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++++|.+++|||||+.+
T Consensus       198 p~ValVG~~NaGKSSLlN~  216 (426)
T PRK11058        198 PTVSLVGYTNAGKSTLFNR  216 (426)
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            5899999999999999996


No 160
>PF10662 PduV-EutP:  Ethanolamine utilisation - propanediol utilisation;  InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways. Both pathways require coenzyme B12 (adenosylcobalamin, AdoCbl). Bacteria that harbour these pathways can use ethanolamine as a source of carbon and nitrogen, or propanediol as a sole carbon and energy source, respectively. The exact roles of the EutP and PduV proteins in these respective pathways are not yet determined. Members of this family contain P-loop consensus motifs in the N-terminal part, and are distantly related to various GTPases and ATPases, including ATPase components of transport systems. Propanediol degradation is thought to be important for the natural Salmonella populations, since propanediol is produced by the fermentation of the common plant sugars rhamnose and fucose [, ]. More than 1% of the Salmonella enterica genome is devoted to the utilisation of propanediol and cobalamin biosynthesis. In vivo expression technology has indicated that propanediol utilisation (pdu) genes may be important for growth in host tissues, and competitive index studies with mice have shown that pdu mutations confer a virulence defect [, ]. The pdu operon is contiguous and co-regulated with the cobalamin (B12) biosynthesis cob operon, indicating that propanediol catabolism may be the primary reason for de novo B12 synthesis in Salmonella [, , ]. Please see IPR003207 from INTERPRO, IPR003208 from INTERPRO, IPR009204 from INTERPRO, IPR009191 from INTERPRO, IPR009192 from INTERPRO for more details on the propanediol utilisation pathway and the pdu operon.; GO: 0005524 ATP binding, 0006576 cellular biogenic amine metabolic process
Probab=97.60  E-value=0.00013  Score=42.59  Aligned_cols=19  Identities=32%  Similarity=0.503  Sum_probs=17.5

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .|++++|++|+|||+|+.+
T Consensus         2 krimliG~~g~GKTTL~q~   20 (143)
T PF10662_consen    2 KRIMLIGPSGSGKTTLAQA   20 (143)
T ss_pred             ceEEEECCCCCCHHHHHHH
Confidence            4899999999999999986


No 161
>cd04163 Era Era subfamily.  Era (E. coli Ras-like protein) is a multifunctional GTPase found in all bacteria except some eubacteria.  It binds to the 16S ribosomal RNA (rRNA) of the 30S subunit and appears to play a role in the assembly of the 30S subunit, possibly by chaperoning the 16S rRNA.  It also contacts several assembly elements of the 30S subunit.  Era couples cell growth with cytokinesis and plays a role in cell division and energy metabolism.  Homologs have also been found in eukaryotes. Era contains two domains: the N-terminal GTPase domain and a C-terminal domain KH domain that is critical for RNA binding.  Both domains are important for Era function.  Era is functionally able to compensate for deletion of RbfA, a cold-shock adaptation protein that is required for efficient processing of the 16S rRNA.
Probab=97.59  E-value=7.8e-05  Score=41.78  Aligned_cols=20  Identities=35%  Similarity=0.433  Sum_probs=18.4

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++++|+.|+||||++.+
T Consensus         3 ~~~i~~~G~~g~GKttl~~~   22 (168)
T cd04163           3 SGFVAIVGRPNVGKSTLLNA   22 (168)
T ss_pred             eeEEEEECCCCCCHHHHHHH
Confidence            57899999999999999986


No 162
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily.  E. coli has an iron(II) transport system, known as feo, which may make an important contribution to the iron supply of the cell under anaerobic conditions.  FeoB has been identified as part of this transport system.  FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent.
Probab=97.56  E-value=5.6e-05  Score=42.63  Aligned_cols=15  Identities=53%  Similarity=0.775  Sum_probs=13.7

Q ss_pred             EECCCCChHHHHHhH
Q psy15257         17 VVGDTAVGKTRLICA   31 (65)
Q Consensus        17 ~lG~~gvGKTsl~~~   31 (65)
                      ++|+++||||||+.+
T Consensus         1 l~G~~~~GKssl~~~   15 (158)
T cd01879           1 LVGNPNVGKTTLFNA   15 (158)
T ss_pred             CCCCCCCCHHHHHHH
Confidence            479999999999996


No 163
>KOG3883|consensus
Probab=97.52  E-value=0.00018  Score=43.02  Aligned_cols=46  Identities=28%  Similarity=0.253  Sum_probs=35.5

Q ss_pred             eeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEEEEE
Q psy15257         11 ELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRIYKD   62 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~~~~   62 (65)
                      ...|++++|--+||||+++.+.++.    +.....++.|||.  |.|...++
T Consensus         8 k~~kVvVcG~k~VGKTaileQl~yg----~~~~~~e~~pTiE--DiY~~sve   53 (198)
T KOG3883|consen    8 KVCKVVVCGMKSVGKTAILEQLLYG----NHVPGTELHPTIE--DIYVASVE   53 (198)
T ss_pred             cceEEEEECCccccHHHHHHHHHhc----cCCCCCccccchh--hheeEeee
Confidence            4579999999999999999873322    3344567889999  88887765


No 164
>cd01895 EngA2 EngA2 subfamily.  This CD represents the second GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains.  Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family.  Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability. A recent report suggests that E. coli Der functions in ribosome assembly and stability.
Probab=97.48  E-value=9.9e-05  Score=41.82  Aligned_cols=20  Identities=30%  Similarity=0.617  Sum_probs=18.3

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++++|+.|+||||++.+
T Consensus         2 ~~~i~i~G~~~~GKstli~~   21 (174)
T cd01895           2 PIRIAIIGRPNVGKSSLVNA   21 (174)
T ss_pred             CcEEEEEcCCCCCHHHHHHH
Confidence            36899999999999999986


No 165
>TIGR02729 Obg_CgtA Obg family GTPase CgtA. This model describes a univeral, mostly one-gene-per-genome GTP-binding protein that associates with ribosomal subunits and appears to play a role in ribosomal RNA maturation. This GTPase, related to the nucleolar protein Obg, is designated CgtA in bacteria. Mutations in this gene are pleiotropic, but it appears that effects on cellular functions such as chromosome partition may be secondary to the effect on ribosome structure. Recent work done in Vibrio cholerae shows an essential role in the stringent response, in which RelA-dependent ability to synthesize the alarmone ppGpp is required for deletion of this GTPase to be lethal.
Probab=97.47  E-value=0.00032  Score=45.41  Aligned_cols=52  Identities=21%  Similarity=0.183  Sum_probs=31.1

Q ss_pred             eEEEEECCCCChHHHHHhHhhhcccccc-ccccccccceEEEEeeEE-EEEEecC
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSL-SQLLTTHVPTVWAIDQYR-IYKDTLE   65 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~-~~~~~~~~~ti~~vd~~~-~~~~i~~   65 (65)
                      ..|.++|.+++|||||+.+ ++...... +...++..|+++.++.-. ..+.++|
T Consensus       158 adV~lvG~pnaGKSTLl~~-lt~~~~~va~y~fTT~~p~ig~v~~~~~~~~~i~D  211 (329)
T TIGR02729       158 ADVGLVGLPNAGKSTLISA-VSAAKPKIADYPFTTLVPNLGVVRVDDGRSFVIAD  211 (329)
T ss_pred             ccEEEEcCCCCCHHHHHHH-HhcCCccccCCCCCccCCEEEEEEeCCceEEEEEe
Confidence            4578999999999999995 33322111 111234678888443322 4555655


No 166
>PF03193 DUF258:  Protein of unknown function, DUF258;  InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis. RsgA is an unusual circulary permuted GTPase that catalyzes rapid hydrolysis of GTP with a slow catalytic turnover. It is dispensible for viability, but important for overall fitness. The intrinsic GTPase activity is stimulated by the presence of 30S (160-fold increase in kcat) or 70S (96 fold increase in kcat) ribosomes []. The GTPase is inhibited by aminoglycoside antibiotics such as neomycin and paromycin [] streptomycin and spectinomycin []. This inhibition is not due to competition for binding sites on the 30S or 70S ribosome []. ; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 2YKR_W 2YV5_A 1T9H_A 2RCN_A 4A2I_V 1U0L_B.
Probab=97.46  E-value=0.00011  Score=43.55  Aligned_cols=18  Identities=44%  Similarity=0.737  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -++++|++|||||||+..
T Consensus        37 ~~vl~G~SGvGKSSLiN~   54 (161)
T PF03193_consen   37 TSVLLGQSGVGKSSLINA   54 (161)
T ss_dssp             EEEEECSTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478899999999999985


No 167
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]
Probab=97.43  E-value=0.0001  Score=48.16  Aligned_cols=17  Identities=29%  Similarity=0.587  Sum_probs=15.3

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      ++++||||||||+++.-
T Consensus        32 ~vllGPSGcGKSTlLr~   48 (338)
T COG3839          32 VVLLGPSGCGKSTLLRM   48 (338)
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            78899999999999974


No 168
>cd01889 SelB_euk SelB subfamily.  SelB is an elongation factor needed for the co-translational incorporation of selenocysteine.  Selenocysteine is coded by a UGA stop codon in combination with a specific downstream mRNA hairpin.  In bacteria, the C-terminal part of SelB recognizes this hairpin, while the N-terminal part binds GTP and tRNA in analogy with elongation factor Tu (EF-Tu).  It specifically recognizes the selenocysteine charged tRNAsec, which has a UCA anticodon, in an EF-Tu like manner.  This allows insertion of selenocysteine at in-frame UGA stop codons.  In E. coli SelB binds GTP, selenocysteyl-tRNAsec and a stem-loop structure immediately downstream of the UGA codon (the SECIS sequence).  The absence of active SelB prevents the participation of selenocysteyl-tRNAsec in translation.  Archaeal and animal mechanisms of selenocysteine incorporation are more complex.  Although the SECIS elements have different secondary structures and conserved elements between archaea and euk
Probab=97.42  E-value=0.00024  Score=42.04  Aligned_cols=19  Identities=42%  Similarity=0.469  Sum_probs=17.4

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ++++++|+.++|||||+.+
T Consensus         1 ~~i~i~G~~~~GKstLi~~   19 (192)
T cd01889           1 VNVGVLGHVDSGKTSLAKA   19 (192)
T ss_pred             CeEEEEecCCCCHHHHHHH
Confidence            4789999999999999986


No 169
>PF02421 FeoB_N:  Ferrous iron transport protein B;  InterPro: IPR011619  Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions. FeoB has been identified as part of this transport system and may play a role in the transport of ferrous iron. FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent [].; GO: 0005525 GTP binding, 0015093 ferrous iron transmembrane transporter activity, 0015684 ferrous iron transport, 0016021 integral to membrane; PDB: 3TAH_B 3B1X_A 3SS8_A 3B1W_C 3B1V_A 3LX5_A 3B1Y_A 3LX8_A 3B1Z_A 3K53_B ....
Probab=97.41  E-value=0.00027  Score=41.63  Aligned_cols=31  Identities=23%  Similarity=0.399  Sum_probs=21.5

Q ss_pred             eEEEEECCCCChHHHHHhHhhhcccccccccc
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLL   44 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~   44 (65)
                      .+|.++|.++||||+|+.+ +++.......++
T Consensus         1 i~ialvG~PNvGKStLfN~-Ltg~~~~v~n~p   31 (156)
T PF02421_consen    1 IRIALVGNPNVGKSTLFNA-LTGAKQKVGNWP   31 (156)
T ss_dssp             -EEEEEESTTSSHHHHHHH-HHTTSEEEEEST
T ss_pred             CEEEEECCCCCCHHHHHHH-HHCCCceecCCC
Confidence            4789999999999999995 444333333333


No 170
>PF01926 MMR_HSR1:  50S ribosome-binding GTPase;  InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse. These proteins represent a new subfamily of GTP-binding proteins that has both prokaryote and eukaryote members [].; GO: 0005525 GTP binding, 0005622 intracellular; PDB: 2DWQ_B 2DBY_A 3CNN_A 3CNO_A 3CNL_A 3IBY_A 1PUI_B 1WXQ_A 1LNZ_A 3GEE_A ....
Probab=97.40  E-value=0.00013  Score=39.89  Aligned_cols=18  Identities=39%  Similarity=0.708  Sum_probs=16.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +|+++|.+++|||||+.+
T Consensus         1 ~V~iiG~~~~GKSTlin~   18 (116)
T PF01926_consen    1 RVAIIGRPNVGKSTLINA   18 (116)
T ss_dssp             EEEEEESTTSSHHHHHHH
T ss_pred             CEEEECCCCCCHHHHHHH
Confidence            588999999999999985


No 171
>cd01899 Ygr210 Ygr210 subfamily.  Ygr210 is a member of Obg-like family and present in archaea and fungi.  They are characterized by a distinct glycine-rich motif immediately following the Walker B motif.  The Ygr210 and YyaF/YchF subfamilies appear to form one major branch of the Obg-like family.  Among eukaryotes, the Ygr210 subfamily is represented only in fungi.  These fungal proteins form a tight cluster with their archaeal orthologs, which suggests the possibility of horizontal transfer from archaea to fungi.
Probab=97.40  E-value=0.00027  Score=45.68  Aligned_cols=37  Identities=30%  Similarity=0.319  Sum_probs=25.1

Q ss_pred             EEEECCCCChHHHHHhHhhhcccccccccc-ccccceEE
Q psy15257         15 CVVVGDTAVGKTRLICARACNKQVSLSQLL-TTHVPTVW   52 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~~~~~~~~~~~~~~-~~~~~ti~   52 (65)
                      +.++|.++||||||+.+ +++.......|+ ..+.|++|
T Consensus         1 i~ivG~pnvGKStLfn~-lt~~~~~~~~~pftT~~p~~g   38 (318)
T cd01899           1 IGLVGKPNAGKSTFFNA-ATLADVEIANYPFTTIDPNVG   38 (318)
T ss_pred             CEEECCCCCCHHHHHHH-HhCCCCcccCCCCccccceeE
Confidence            46899999999999995 444433222222 45678887


No 172
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=97.39  E-value=0.00013  Score=45.98  Aligned_cols=18  Identities=22%  Similarity=0.447  Sum_probs=15.5

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+.++|+||||||+|+.-
T Consensus        31 fvsilGpSGcGKSTLLri   48 (248)
T COG1116          31 FVAILGPSGCGKSTLLRL   48 (248)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367889999999999974


No 173
>PRK08118 topology modulation protein; Reviewed
Probab=97.38  E-value=0.00017  Score=42.47  Aligned_cols=19  Identities=26%  Similarity=0.454  Sum_probs=17.2

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+|+++|++|+|||+++.+
T Consensus         2 ~rI~I~G~~GsGKSTlak~   20 (167)
T PRK08118          2 KKIILIGSGGSGKSTLARQ   20 (167)
T ss_pred             cEEEEECCCCCCHHHHHHH
Confidence            3799999999999999985


No 174
>cd01894 EngA1 EngA1 subfamily.  This CD represents the first GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains.  Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family. Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability.  A recent report suggests that E. coli Der functions in ribosome assembly and stability.
Probab=97.36  E-value=0.00026  Score=39.69  Aligned_cols=16  Identities=38%  Similarity=0.621  Sum_probs=14.4

Q ss_pred             EEECCCCChHHHHHhH
Q psy15257         16 VVVGDTAVGKTRLICA   31 (65)
Q Consensus        16 v~lG~~gvGKTsl~~~   31 (65)
                      +++|++|+|||||+.+
T Consensus         1 ~l~G~~~~GKssl~~~   16 (157)
T cd01894           1 AIVGRPNVGKSTLFNR   16 (157)
T ss_pred             CccCCCCCCHHHHHHH
Confidence            3689999999999996


No 175
>PRK09602 translation-associated GTPase; Reviewed
Probab=97.34  E-value=0.00057  Score=45.38  Aligned_cols=39  Identities=31%  Similarity=0.358  Sum_probs=26.2

Q ss_pred             eEEEEECCCCChHHHHHhHhhhcccccccccc-ccccceEE
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSLSQLL-TTHVPTVW   52 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~-~~~~~ti~   52 (65)
                      +|+.++|.++||||+|+.+ +++..+....++ .+..|++|
T Consensus         2 ~kigivG~pnvGKSTlfn~-Lt~~~~~~~~y~f~t~~p~~g   41 (396)
T PRK09602          2 ITIGLVGKPNVGKSTFFNA-ATLADVEIANYPFTTIDPNVG   41 (396)
T ss_pred             cEEEEECCCCCCHHHHHHH-HhCCcccccCCCCcceeeeee
Confidence            5899999999999999995 444333222222 23367777


No 176
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily. The Ras-like superfamily of small GTPases consists of several families with an extremely high degree of structural and functional similarity. The Ras superfamily is divided into at least four families in eukaryotes: the Ras, Rho, Rab, and Sar1/Arf families.  This superfamily also includes proteins like the GTP translation factors, Era-like GTPases, and G-alpha chain of the heterotrimeric G proteins.  Members of the Ras superfamily regulate a wide variety of cellular functions: the Ras family regulates gene expression, the Rho family regulates cytoskeletal reorganization and gene expression, the Rab and Sar1/Arf families regulate vesicle trafficking, and the Ran family regulates nucleocytoplasmic transport and microtubule organization. The GTP translation factor family regulate initiation, elongation, termination, and release in translation, and the Era-like GTPase family regulates cell division, sporulation, and DNA replication. Memb
Probab=97.33  E-value=0.00017  Score=39.19  Aligned_cols=15  Identities=60%  Similarity=0.888  Sum_probs=13.6

Q ss_pred             EECCCCChHHHHHhH
Q psy15257         17 VVGDTAVGKTRLICA   31 (65)
Q Consensus        17 ~lG~~gvGKTsl~~~   31 (65)
                      ++|+.|+|||+|+.+
T Consensus         1 iiG~~~~GKStl~~~   15 (157)
T cd00882           1 VVGDSGVGKTSLLNR   15 (157)
T ss_pred             CCCcCCCcHHHHHHH
Confidence            479999999999986


No 177
>PF13207 AAA_17:  AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A ....
Probab=97.33  E-value=0.00018  Score=39.48  Aligned_cols=18  Identities=22%  Similarity=0.361  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +|++.|++|+|||+++.+
T Consensus         1 vI~I~G~~gsGKST~a~~   18 (121)
T PF13207_consen    1 VIIISGPPGSGKSTLAKE   18 (121)
T ss_dssp             EEEEEESTTSSHHHHHHH
T ss_pred             CEEEECCCCCCHHHHHHH
Confidence            478999999999999985


No 178
>cd04165 GTPBP1_like GTPBP1-like.  Mammalian GTP binding protein 1 (GTPBP1), GTPBP2, and nematode homologs AGP-1 and CGP-1 are GTPases whose specific functions remain unknown.  In mouse, GTPBP1 is expressed in macrophages, in smooth muscle cells of various tissues and in some neurons of the cerebral cortex; GTPBP2 tissue distribution appears to overlap that of GTPBP1.  In human leukemia and macrophage cell lines, expression of both GTPBP1 and GTPBP2 is enhanced by interferon-gamma (IFN-gamma).  The chromosomal location of both genes has been identified in humans, with GTPBP1 located in chromosome 22q12-13.1 and GTPBP2 located in chromosome 6p21-12.  Human glioblastoma multiforme (GBM), a highly-malignant astrocytic glioma and the most common cancer in the central nervous system, has been linked to chromosomal deletions and a translocation on chromosome 6.  The GBM translocation results in a fusion of GTPBP2 and PTPRZ1, a protein involved in oligodendrocyte differentiation, recovery, and
Probab=97.33  E-value=0.00016  Score=44.45  Aligned_cols=18  Identities=33%  Similarity=0.634  Sum_probs=16.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      |++++|+.++|||||+.+
T Consensus         1 ~v~~~G~~~~GKttl~~~   18 (224)
T cd04165           1 RVAVVGNVDAGKSTLLGV   18 (224)
T ss_pred             CEEEECCCCCCHHHHHHH
Confidence            588999999999999996


No 179
>PRK00093 GTP-binding protein Der; Reviewed
Probab=97.31  E-value=0.00046  Score=45.54  Aligned_cols=19  Identities=32%  Similarity=0.462  Sum_probs=17.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ++|+++|+++||||||+.+
T Consensus         2 ~~I~ivG~~~vGKStL~n~   20 (435)
T PRK00093          2 PVVAIVGRPNVGKSTLFNR   20 (435)
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            5899999999999999996


No 180
>PRK07261 topology modulation protein; Provisional
Probab=97.30  E-value=0.00023  Score=42.01  Aligned_cols=18  Identities=28%  Similarity=0.462  Sum_probs=16.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|++|+|||+++..
T Consensus         2 ri~i~G~~GsGKSTla~~   19 (171)
T PRK07261          2 KIAIIGYSGSGKSTLARK   19 (171)
T ss_pred             EEEEEcCCCCCHHHHHHH
Confidence            789999999999999985


No 181
>PRK03003 GTP-binding protein Der; Reviewed
Probab=97.30  E-value=0.00041  Score=46.63  Aligned_cols=21  Identities=29%  Similarity=0.460  Sum_probs=19.3

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...|++++|+++||||||+.+
T Consensus       210 ~~~kI~iiG~~nvGKSSLin~  230 (472)
T PRK03003        210 GPRRVALVGKPNVGKSSLLNK  230 (472)
T ss_pred             cceEEEEECCCCCCHHHHHHH
Confidence            458999999999999999996


No 182
>TIGR00436 era GTP-binding protein Era. Era is an essential GTPase in Escherichia coli and many other bacteria. It plays a role in ribosome biogenesis. Few bacteria lack this protein.
Probab=97.26  E-value=0.00061  Score=42.61  Aligned_cols=18  Identities=28%  Similarity=0.503  Sum_probs=16.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|+++||||||+.+
T Consensus         2 ~V~liG~pnvGKSTLln~   19 (270)
T TIGR00436         2 FVAILGRPNVGKSTLLNQ   19 (270)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            688999999999999996


No 183
>cd00881 GTP_translation_factor GTP translation factor family.  This family consists primarily of translation initiation, elongation, and release factors, which play specific roles in protein translation.  In addition, the family includes Snu114p, a component of the U5 small nuclear riboprotein particle which is a component of the spliceosome and is involved in excision of introns, TetM, a tetracycline resistance gene that protects the ribosome from tetracycline binding, and the unusual subfamily CysN/ATPS, which has an unrelated function (ATP sulfurylase) acquired through lateral transfer of the EF1-alpha gene and development of a new function.
Probab=97.26  E-value=0.00022  Score=41.14  Aligned_cols=18  Identities=28%  Similarity=0.322  Sum_probs=16.4

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +|+++|+.|+|||+|+.+
T Consensus         1 ~v~v~G~~~~GKStlln~   18 (189)
T cd00881           1 NVGIAGHVDHGKTTLTER   18 (189)
T ss_pred             CEEEEeCCCCCHHHHHHH
Confidence            478999999999999986


No 184
>PF09439 SRPRB:  Signal recognition particle receptor beta subunit;  InterPro: IPR019009  The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]. SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. The SR receptor is a monomer consisting of the loosely membrane-associated SR-alpha homologue FtsY, while the eukaryotic SR receptor is a heterodimer of SR-alpha (70 kDa) and SR-beta (25 kDa), both of which contain a GTP-binding domain []. SR-alpha regulates the targeting of SRP-ribosome-nascent polypeptide complexes to the translocon []. SR-alpha binds to the SRP54 subunit of the SRP complex. The SR-beta subunit is a transmembrane GTPase that anchors the SR-alpha subunit (a peripheral membrane GTPase) to the ER membrane []. SR-beta interacts with the N-terminal SRX-domain of SR-alpha, which is not present in the bacterial FtsY homologue. SR-beta also functions in recruiting the SRP-nascent polypeptide to the protein-conducting channel.   The beta subunit of the signal recognition particle receptor (SRP) is a transmembrane GTPase, which anchors the alpha subunit to the endoplasmic reticulum membrane []. ; PDB: 2GED_B 1NRJ_B 2GO5_2 2FH5_B.
Probab=97.25  E-value=0.00022  Score=42.96  Aligned_cols=19  Identities=32%  Similarity=0.506  Sum_probs=15.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      --++++|++|.|||+|..+
T Consensus         4 ~~vlL~Gps~SGKTaLf~~   22 (181)
T PF09439_consen    4 PTVLLVGPSGSGKTALFSQ   22 (181)
T ss_dssp             -EEEEE-STTSSHHHHHHH
T ss_pred             ceEEEEcCCCCCHHHHHHH
Confidence            3588999999999999996


No 185
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed
Probab=97.25  E-value=0.00058  Score=45.81  Aligned_cols=21  Identities=43%  Similarity=0.616  Sum_probs=19.1

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+|++++|++++|||||+.+
T Consensus       214 ~~~kV~ivG~~nvGKSSLln~  234 (449)
T PRK05291        214 EGLKVVIAGRPNVGKSSLLNA  234 (449)
T ss_pred             cCCEEEEECCCCCCHHHHHHH
Confidence            347999999999999999996


No 186
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]
Probab=97.24  E-value=0.00023  Score=42.60  Aligned_cols=18  Identities=22%  Similarity=0.482  Sum_probs=16.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|++|+|||+++.+
T Consensus         2 riiilG~pGaGK~T~A~~   19 (178)
T COG0563           2 RILILGPPGAGKSTLAKK   19 (178)
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            789999999999999986


No 187
>PF00735 Septin:  Septin;  InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments []. Members of the family were first identified by genetic screening for Saccharomyces cerevisiae (Baker's yeast) mutants defective in cytokinesis []. Temperature-sensitive mutations in four genes, CDC3, CDC10, CDC11 and CDC12, were found to cause cell-cycle arrest and defects in bud growth and cytokinesis. The protein products of these genes localise at the division plane between mother and daughter cells, indicating a role in mother-daughter separation during cytokinesis []. Members of the family were therefore termed septins to reflect their role in septation and cell division. The identification of septin homologues in higher eukaryotes, which localise to the cleavage furrow in dividing cells, supports an orthologous function in cytokinesis. Septins have since been identified in most eukaryotes, except plants []. Septins are approximately 40-50 kDa in molecular mass, and typically comprise a conserved central core domain (more than 35% sequence identity between mammalian and yeast homologues) flanked by more divergent N- and C-termini. Most septins possess a P-loop motif in their N-terminal domain (which is characteristic of GTP-binding proteins), and a predicted C-terminal coiled-coil domain []. A number of septin interaction partners have been identified in yeast, many of which are components of the budding site selection machinery, kinase cascades or of the ubiquitination pathway. It has been proposed that septins may act as a scaffold that provides an interaction matrix for other proteins [, ]. In mammals, septins have been shown to regulate vesicle dynamics []. Mammalian septins have also been implicated in a variety of other cellular processes, including apoptosis, carcinogenesis and neurodegeneration []. This entry represents a variety of septins and homologous sequences involved in the cell division process.; GO: 0005525 GTP binding, 0007049 cell cycle; PDB: 2QAG_B 3FTQ_D 2QA5_A 2QNR_B 3TW4_A 3T5D_C.
Probab=97.23  E-value=0.00026  Score=45.04  Aligned_cols=21  Identities=33%  Similarity=0.498  Sum_probs=19.1

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..|+++++|++|+|||+++..
T Consensus         3 ~~fnImVvG~sG~GKTTFInt   23 (281)
T PF00735_consen    3 FNFNIMVVGESGLGKTTFINT   23 (281)
T ss_dssp             EEEEEEEEECTTSSHHHHHHH
T ss_pred             ceEEEEEECCCCCCHHHHHHH
Confidence            368999999999999999985


No 188
>cd01856 YlqF YlqF.  Proteins of the YlqF family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases. The YlqF subfamily is represented in a phylogenetically diverse array of bacteria (including gram-positive bacteria, proteobacteria, Synechocystis, Borrelia, and Thermotoga) and in all eukaryotes.
Probab=97.22  E-value=0.0008  Score=39.38  Aligned_cols=21  Identities=38%  Similarity=0.531  Sum_probs=18.8

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++++|.++||||+++.+
T Consensus       114 ~~~~~~~~G~~~vGKstlin~  134 (171)
T cd01856         114 RGIRAMVVGIPNVGKSTLINR  134 (171)
T ss_pred             CCeEEEEECCCCCCHHHHHHH
Confidence            447899999999999999985


No 189
>PRK10078 ribose 1,5-bisphosphokinase; Provisional
Probab=97.20  E-value=0.00035  Score=41.46  Aligned_cols=18  Identities=28%  Similarity=0.442  Sum_probs=16.4

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++|+|||+++..
T Consensus         4 ~i~l~G~sGsGKsTl~~~   21 (186)
T PRK10078          4 LIWLMGPSGSGKDSLLAA   21 (186)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578999999999999985


No 190
>cd01890 LepA LepA subfamily.  LepA belongs to the GTPase family of and exhibits significant homology to the translation factors EF-G and EF-Tu, indicating its possible involvement in translation and association with the ribosome.  LepA is ubiquitous in bacteria and eukaryota (e.g. yeast GUF1p), but is missing from archaea.  This pattern of phyletic distribution suggests that LepA evolved through a duplication of the EF-G gene in bacteria, followed by early transfer into the eukaryotic lineage, most likely from the promitochondrial endosymbiont.  Yeast GUF1p is not essential and mutant cells did not reveal any marked phenotype.
Probab=97.20  E-value=0.00022  Score=41.18  Aligned_cols=18  Identities=17%  Similarity=0.255  Sum_probs=16.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ++.++|+.++|||||+.+
T Consensus         2 ni~~vG~~~~GKssL~~~   19 (179)
T cd01890           2 NFSIIAHIDHGKSTLADR   19 (179)
T ss_pred             cEEEEeecCCCHHHHHHH
Confidence            688999999999999996


No 191
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]
Probab=97.19  E-value=0.00027  Score=46.42  Aligned_cols=17  Identities=29%  Similarity=0.540  Sum_probs=15.0

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.++||||||||+++.-
T Consensus        34 ~~lLGPSGcGKTTlLR~   50 (352)
T COG3842          34 VTLLGPSGCGKTTLLRM   50 (352)
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            56889999999999974


No 192
>PF04548 AIG1:  AIG1 family;  InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria. The Arabidopsis disease resistance gene RPS2 is involved in recognition of bacterial pathogens carrying the avirulence gene avrRpt2. AIG1 (avrRpt2-induced gene) exhibits RPS2- and avrRpt2-dependent induction early after infection with Pseudomonas syringae carrying avrRpt2 [].  The domain is also apparently found in a number of mammalian proteins, for example the rat immune-associated nucleotide 4 protein. ; GO: 0005525 GTP binding; PDB: 3LXX_A 3BB4_A 3DEF_A 3BB3_A 2J3E_A 3V70_B 3BB1_A 1H65_B 2XTP_A 3P1J_C ....
Probab=97.19  E-value=0.00074  Score=40.98  Aligned_cols=19  Identities=26%  Similarity=0.489  Sum_probs=17.3

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ++|+++|.+|+|||++...
T Consensus         1 l~IlllG~tGsGKSs~~N~   19 (212)
T PF04548_consen    1 LRILLLGKTGSGKSSLGNS   19 (212)
T ss_dssp             EEEEEECSTTSSHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            4799999999999999985


No 193
>smart00382 AAA ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.
Probab=97.19  E-value=0.00041  Score=37.45  Aligned_cols=19  Identities=37%  Similarity=0.433  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+++..
T Consensus         3 ~~~~l~G~~G~GKTtl~~~   21 (148)
T smart00382        3 EVILIVGPPGSGKTTLARA   21 (148)
T ss_pred             CEEEEECCCCCcHHHHHHH
Confidence            3678999999999999985


No 194
>cd01857 HSR1_MMR1 HSR1/MMR1.  Human HSR1, is localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse. These proteins represent a new subfamily of GTP-binding proteins that has only eukaryote members. This subfamily shows a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with sequence NKXD) are relocated to the N terminus.
Probab=97.16  E-value=0.00042  Score=39.38  Aligned_cols=18  Identities=44%  Similarity=0.512  Sum_probs=16.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|.++||||+++.+
T Consensus        85 ~~~~~G~~~vGKstlin~  102 (141)
T cd01857          85 TIGLVGYPNVGKSSLINA  102 (141)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            899999999999999985


No 195
>PRK15467 ethanolamine utilization protein EutP; Provisional
Probab=97.15  E-value=0.00043  Score=40.13  Aligned_cols=18  Identities=39%  Similarity=0.553  Sum_probs=17.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +|+++|++++|||+|+.+
T Consensus         3 ~i~~iG~~~~GKstl~~~   20 (158)
T PRK15467          3 RIAFVGAVGAGKTTLFNA   20 (158)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            799999999999999985


No 196
>PRK12296 obgE GTPase CgtA; Reviewed
Probab=97.15  E-value=0.001  Score=45.54  Aligned_cols=52  Identities=21%  Similarity=0.198  Sum_probs=30.0

Q ss_pred             eEEEEECCCCChHHHHHhHhhhccccc-cccccccccceEEEEeeEEEEEEecC
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVS-LSQLLTTHVPTVWAIDQYRIYKDTLE   65 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~-~~~~~~~~~~ti~~vd~~~~~~~i~~   65 (65)
                      .+|.++|.+++|||||+.+ ++..... .+...++..|.++.++.-...+.++|
T Consensus       160 adV~LVG~PNAGKSTLln~-Ls~akpkIadypfTTl~P~lGvv~~~~~~f~laD  212 (500)
T PRK12296        160 ADVGLVGFPSAGKSSLISA-LSAAKPKIADYPFTTLVPNLGVVQAGDTRFTVAD  212 (500)
T ss_pred             ceEEEEEcCCCCHHHHHHH-HhcCCccccccCcccccceEEEEEECCeEEEEEE
Confidence            5689999999999999985 3322111 11111233466664444344555554


No 197
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK, Der) is a ribosome-associated essential GTPase with a duplication of its GTP-binding domain. It is broadly to universally distributed among bacteria. It appears to function in ribosome biogenesis or stability.
Probab=97.13  E-value=0.00078  Score=44.28  Aligned_cols=18  Identities=33%  Similarity=0.521  Sum_probs=16.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|+++||||||+.+
T Consensus         1 ~i~ivG~~nvGKStL~n~   18 (429)
T TIGR03594         1 VVAIVGRPNVGKSTLFNR   18 (429)
T ss_pred             CEEEECCCCCCHHHHHHH
Confidence            588999999999999996


No 198
>KOG0070|consensus
Probab=97.13  E-value=0.00034  Score=42.23  Aligned_cols=36  Identities=33%  Similarity=0.575  Sum_probs=30.9

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ....+|+++|=-+.|||+++.+      +..+++... .||||
T Consensus        15 ~~e~~IlmlGLD~AGKTTILyk------Lk~~E~vtt-vPTiG   50 (181)
T KOG0070|consen   15 KKEMRILMVGLDAAGKTTILYK------LKLGEIVTT-VPTIG   50 (181)
T ss_pred             cceEEEEEEeccCCCceeeeEe------eccCCcccC-CCccc
Confidence            4568999999999999999998      777777766 89987


No 199
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]
Probab=97.12  E-value=0.00042  Score=43.29  Aligned_cols=17  Identities=29%  Similarity=0.599  Sum_probs=15.5

Q ss_pred             EEEEECCCCChHHHHHh
Q psy15257         14 KCVVVGDTAVGKTRLIC   30 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~   30 (65)
                      .++++||||+|||+|++
T Consensus        30 vv~iiGpSGSGKSTlLR   46 (240)
T COG1126          30 VVVIIGPSGSGKSTLLR   46 (240)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            57899999999999996


No 200
>PRK14738 gmk guanylate kinase; Provisional
Probab=97.12  E-value=0.00079  Score=40.74  Aligned_cols=21  Identities=24%  Similarity=0.463  Sum_probs=17.8

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....++++|++|+|||+|+.+
T Consensus        12 ~~~~ivi~GpsG~GK~tl~~~   32 (206)
T PRK14738         12 KPLLVVISGPSGVGKDAVLAR   32 (206)
T ss_pred             CCeEEEEECcCCCCHHHHHHH
Confidence            445678899999999999985


No 201
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=97.12  E-value=0.00055  Score=42.64  Aligned_cols=18  Identities=39%  Similarity=0.562  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -++++|+||||||+|+.-
T Consensus        33 ~vv~lGpSGcGKTTLLnl   50 (259)
T COG4525          33 LVVVLGPSGCGKTTLLNL   50 (259)
T ss_pred             EEEEEcCCCccHHHHHHH
Confidence            378899999999999973


No 202
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1).  This represents Arabidoposis protein AIG1 that appears to be involved in plant resistance to bacteria.  The Arabidopsis disease resistance gene RPS2 is involved in recognition of bacterial pathogens carrying the avirulence gene avrRpt2.  AIG1 exhibits RPS2- and avrRpt1-dependent induction early after infection with Pseudomonas syringae carrying avrRpt2. This subfamily also includes IAN-4 protein, which has GTP-binding activity and shares sequence homology with a novel family of putative GTP-binding proteins: the immuno-associated nucleotide (IAN) family.  The evolutionary conservation of the IAN family provides a unique example of a plant pathogen response gene conserved in animals. The IAN/IMAP subfamily has been proposed to regulate apoptosis in vertebrates and angiosperm plants, particularly in relation to cancer, diabetes, and infections.  The human IAN genes were renamed GIMAP (GTPase of the immunity associated proteins).
Probab=97.12  E-value=0.0013  Score=39.09  Aligned_cols=19  Identities=32%  Similarity=0.448  Sum_probs=17.2

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+|+++|.+|+|||+++..
T Consensus         1 ~~i~lvG~~g~GKSsl~N~   19 (196)
T cd01852           1 LRLVLVGKTGAGKSATGNT   19 (196)
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            3689999999999999986


No 203
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=97.11  E-value=0.00047  Score=41.14  Aligned_cols=19  Identities=37%  Similarity=0.513  Sum_probs=16.5

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.+.++|++|+|||+|+..
T Consensus        22 ~~~~l~G~nG~GKSTLl~~   40 (176)
T cd03238          22 VLVVVTGVSGSGKSTLVNE   40 (176)
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            3578999999999999974


No 204
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed
Probab=97.10  E-value=0.00076  Score=47.47  Aligned_cols=20  Identities=35%  Similarity=0.591  Sum_probs=18.6

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..|++++|+++||||||+.+
T Consensus       450 ~~kI~ivG~~nvGKSSLin~  469 (712)
T PRK09518        450 LRRVALVGRPNVGKSSLLNQ  469 (712)
T ss_pred             CcEEEEECCCCCCHHHHHHH
Confidence            47999999999999999996


No 205
>PF00004 AAA:  ATPase family associated with various cellular activities (AAA);  InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport. Some of them function as molecular chaperones, subunits of proteolytic complexes or independent proteases (FtsH, Lon). They also act as DNA helicases and transcription factors []. AAA ATPases belong to the AAA+ superfamily of ringshaped P-loop NTPases, which act via the energy-dependent unfolding of macromolecules [, ]. There are six major clades of AAA domains (proteasome subunits, metalloproteases, domains D1 and D2 of ATPases with two AAA domains, the MSP1/katanin/spastin group and BCS1 and it homologues), as well as a number of deeply branching minor clades []. They assemble into oligomeric assemblies (often hexamers) that form a ring-shaped structure with a central pore. These proteins produce a molecular motor that couples ATP binding and hydrolysis to changes in conformational states that act upon a target substrate, either translocating or remodelling it []. They are found in all living organisms and share the common feature of the presence of a highly conserved AAA domain called the AAA module. This domain is responsible for ATP binding and hydrolysis. It contains 200-250 residues, among them there are two classical motifs, Walker A (GX4GKT) and Walker B (HyDE) []. The functional variety seen between AAA ATPases is in part due to their extensive number of accessory domains and factors, and to their variable organisation within oligomeric assemblies, in addition to changes in key functional residues within the ATPase domain itself. More information about these proteins can be found at Protein of the Month: AAA ATPases [].; GO: 0005524 ATP binding; PDB: 3H4M_A 1NSF_A 1D2N_A 1HQY_E 1DO0_E 1DO2_C 1G4B_E 1HT1_F 1G4A_F 1HT2_G ....
Probab=97.08  E-value=0.00052  Score=37.66  Aligned_cols=17  Identities=35%  Similarity=0.442  Sum_probs=15.3

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +++.|+.|+|||+++..
T Consensus         1 ill~G~~G~GKT~l~~~   17 (132)
T PF00004_consen    1 ILLHGPPGTGKTTLARA   17 (132)
T ss_dssp             EEEESSTTSSHHHHHHH
T ss_pred             CEEECcCCCCeeHHHHH
Confidence            57899999999999975


No 206
>PF07728 AAA_5:  AAA domain (dynein-related subfamily);  InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []. The highly conserved nature of this module across taxa suggests that it has a key cellular role. Members of the family are involved in diverse cellular functions including gene expression, peroxisome assembly and vesicle mediated transport. Although the role of this ATPase AAA domain is not, as yet, clear, the AAA+ superfamily of proteins to which the AAA ATPases belong has a chaperone-like function in the assembly, operation or disassembly of proteins []. This ATPase domain includes some proteins not detected by the IPR003959 from INTERPRO model.; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NBX_X 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A.
Probab=97.07  E-value=0.00033  Score=39.44  Aligned_cols=17  Identities=35%  Similarity=0.522  Sum_probs=15.7

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      ++++|++|+|||+++..
T Consensus         2 vlL~G~~G~GKt~l~~~   18 (139)
T PF07728_consen    2 VLLVGPPGTGKTTLARE   18 (139)
T ss_dssp             EEEEESSSSSHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            78999999999999985


No 207
>PF13671 AAA_33:  AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B ....
Probab=97.06  E-value=0.00042  Score=38.85  Aligned_cols=17  Identities=24%  Similarity=0.397  Sum_probs=15.7

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      ++++|++|+|||+++.+
T Consensus         2 ii~~G~pgsGKSt~a~~   18 (143)
T PF13671_consen    2 IILCGPPGSGKSTLAKR   18 (143)
T ss_dssp             EEEEESTTSSHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            68899999999999986


No 208
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), also known as guanylate kinase (GKase), catalyzes the reversible phosphoryl transfer from adenosine triphosphate (ATP) to guanosine monophosphate (GMP) to yield adenosine diphosphate (ADP) and guanosine diphosphate (GDP). It plays an essential role in the biosynthesis of guanosine triphosphate (GTP). This enzyme is also important for the activation of some antiviral and anticancer agents, such as acyclovir, ganciclovir, carbovir, and thiopurines.
Probab=97.06  E-value=0.00054  Score=39.11  Aligned_cols=17  Identities=35%  Similarity=0.567  Sum_probs=15.3

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      ++++|++|+|||+++.+
T Consensus         2 i~i~GpsGsGKstl~~~   18 (137)
T cd00071           2 IVLSGPSGVGKSTLLKR   18 (137)
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            57889999999999985


No 209
>PRK03003 GTP-binding protein Der; Reviewed
Probab=97.06  E-value=0.0013  Score=44.19  Aligned_cols=20  Identities=40%  Similarity=0.546  Sum_probs=18.5

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+|+++|+++||||||+.+
T Consensus        38 ~~~V~IvG~~nvGKSSL~nr   57 (472)
T PRK03003         38 LPVVAVVGRPNVGKSTLVNR   57 (472)
T ss_pred             CCEEEEEcCCCCCHHHHHHH
Confidence            46899999999999999996


No 210
>cd01859 MJ1464 MJ1464.  This family represents archaeal GTPase typified by the protein MJ1464 from Methanococcus jannaschii. The members of this family show a circular permutation of the GTPase signature motifs so that C-terminal strands 5, 6, and 7 (strands 6 contain the NKxD motif) are relocated to the N terminus.
Probab=97.06  E-value=0.0014  Score=37.58  Aligned_cols=21  Identities=43%  Similarity=0.434  Sum_probs=18.5

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+++++|.+++|||+++.+
T Consensus       100 ~~~~~~~ig~~~~Gkssl~~~  120 (156)
T cd01859         100 KEGKVGVVGYPNVGKSSIINA  120 (156)
T ss_pred             CCcEEEEECCCCCCHHHHHHH
Confidence            346889999999999999986


No 211
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]
Probab=97.05  E-value=0.00049  Score=42.83  Aligned_cols=18  Identities=28%  Similarity=0.466  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++||||+|||+|+.-
T Consensus        33 ~vaI~GpSGSGKSTLLni   50 (226)
T COG1136          33 FVAIVGPSGSGKSTLLNL   50 (226)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            378899999999999974


No 212
>PRK09554 feoB ferrous iron transport protein B; Reviewed
Probab=97.05  E-value=0.0017  Score=46.41  Aligned_cols=20  Identities=25%  Similarity=0.385  Sum_probs=18.3

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++.++|.++||||+|..+
T Consensus         3 ~~~IaLvG~pNvGKSTLfN~   22 (772)
T PRK09554          3 KLTIGLIGNPNSGKTTLFNQ   22 (772)
T ss_pred             ceEEEEECCCCCCHHHHHHH
Confidence            46899999999999999996


No 213
>PRK14737 gmk guanylate kinase; Provisional
Probab=97.05  E-value=0.00054  Score=41.08  Aligned_cols=19  Identities=21%  Similarity=0.244  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-++++||+|+|||+|+.+
T Consensus         5 ~~ivl~GpsG~GK~tl~~~   23 (186)
T PRK14737          5 KLFIISSVAGGGKSTIIQA   23 (186)
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            3478999999999999985


No 214
>PF13191 AAA_16:  AAA ATPase domain; PDB: 2V1U_A.
Probab=97.05  E-value=0.00042  Score=40.16  Aligned_cols=19  Identities=32%  Similarity=0.532  Sum_probs=13.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-+++.|++|+|||+++.+
T Consensus        25 ~~~ll~G~~G~GKT~ll~~   43 (185)
T PF13191_consen   25 RNLLLTGESGSGKTSLLRA   43 (185)
T ss_dssp             --EEE-B-TTSSHHHHHHH
T ss_pred             cEEEEECCCCCCHHHHHHH
Confidence            5688999999999999985


No 215
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN. Members of this family resemble PhnN of phosphonate utilization operons, where different such operons confer the ability to use somewhat different profiles of C-P bond-containing compounds (see PubMed:15231805), including phosphites as well as phosphonates. PhnN in E. coli shows considerable homology to guanylate kinases (EC 2.7.4.8), and has actually been shown to act as a ribose 1,5-bisphosphokinase (PRPP forming). This suggests an analogous kinase reaction for phosphonate metabolism, converting 5-phosphoalpha-1-(methylphosphono)ribose to methylphosphono-PRPP.
Probab=97.03  E-value=0.00059  Score=39.95  Aligned_cols=18  Identities=33%  Similarity=0.399  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++|+|||+++..
T Consensus         3 ~~~i~G~sGsGKttl~~~   20 (179)
T TIGR02322         3 LIYVVGPSGAGKDTLLDY   20 (179)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974


No 216
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism]
Probab=97.02  E-value=0.00065  Score=41.34  Aligned_cols=19  Identities=37%  Similarity=0.560  Sum_probs=16.3

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-+++.||||||||+++.+
T Consensus         5 ~l~vlsgPSG~GKsTl~k~   23 (191)
T COG0194           5 LLIVLSGPSGVGKSTLVKA   23 (191)
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            3467889999999999985


No 217
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP  or GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity.  PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity (the ATP-, and GTP-dependent groups).HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of HPr and its dephosphorylation by phosphorolysis. PEPCK and the C-terminal catalytic domain of HprK/P are structural
Probab=97.01  E-value=0.00059  Score=38.02  Aligned_cols=18  Identities=33%  Similarity=0.641  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+..
T Consensus        17 ~v~I~GpSGsGKSTLl~~   34 (107)
T cd00820          17 GVLITGDSGIGKTELALE   34 (107)
T ss_pred             EEEEEcCCCCCHHHHHHH
Confidence            478899999999999974


No 218
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.
Probab=97.00  E-value=0.00069  Score=37.00  Aligned_cols=19  Identities=32%  Similarity=0.389  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+++..
T Consensus        20 ~~v~i~G~~G~GKT~l~~~   38 (151)
T cd00009          20 KNLLLYGPPGTGKTTLARA   38 (151)
T ss_pred             CeEEEECCCCCCHHHHHHH
Confidence            3588999999999999985


No 219
>KOG0073|consensus
Probab=96.99  E-value=0.0018  Score=39.01  Aligned_cols=36  Identities=22%  Similarity=0.274  Sum_probs=28.0

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVW   52 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~   52 (65)
                      ...+.|+++|..+.|||+++.+      +.... .+...||.|
T Consensus        14 erE~riLiLGLdNsGKTti~~k------l~~~~-~~~i~pt~g   49 (185)
T KOG0073|consen   14 EREVRILILGLDNSGKTTIVKK------LLGED-TDTISPTLG   49 (185)
T ss_pred             hheeEEEEEecCCCCchhHHHH------hcCCC-ccccCCccc
Confidence            4579999999999999999997      65433 455567766


No 220
>TIGR03263 guanyl_kin guanylate kinase. Members of this family are the enzyme guanylate kinase, also called GMP kinase. This enzyme transfers a phosphate from ATP to GMP, yielding ADP and GDP.
Probab=96.98  E-value=0.00069  Score=39.56  Aligned_cols=18  Identities=39%  Similarity=0.582  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++|+|||+++..
T Consensus         3 ii~l~G~~GsGKsTl~~~   20 (180)
T TIGR03263         3 LIVISGPSGVGKSTLVKA   20 (180)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999985


No 221
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK, Der) is a ribosome-associated essential GTPase with a duplication of its GTP-binding domain. It is broadly to universally distributed among bacteria. It appears to function in ribosome biogenesis or stability.
Probab=96.97  E-value=0.0027  Score=41.72  Aligned_cols=21  Identities=33%  Similarity=0.583  Sum_probs=19.2

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+|++++|++++|||||+.+
T Consensus       171 ~~~~v~ivG~~~~GKSsLin~  191 (429)
T TIGR03594       171 GPIKIAIIGRPNVGKSTLVNA  191 (429)
T ss_pred             CceEEEEECCCCCCHHHHHHH
Confidence            458999999999999999986


No 222
>PF13521 AAA_28:  AAA domain; PDB: 1LW7_A.
Probab=96.96  E-value=0.00069  Score=39.22  Aligned_cols=18  Identities=44%  Similarity=0.658  Sum_probs=14.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ||++.|..++|||+|+.+
T Consensus         1 rI~i~G~~stGKTTL~~~   18 (163)
T PF13521_consen    1 RIVITGGPSTGKTTLIEA   18 (163)
T ss_dssp             -EEEE--TTSHHHHHHHH
T ss_pred             CEEEECCCCCCHHHHHHH
Confidence            789999999999999986


No 223
>PRK12297 obgE GTPase CgtA; Reviewed
Probab=96.95  E-value=0.0023  Score=42.96  Aligned_cols=18  Identities=33%  Similarity=0.479  Sum_probs=16.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .|.++|.++||||||+.+
T Consensus       160 dVglVG~pNaGKSTLLn~  177 (424)
T PRK12297        160 DVGLVGFPNVGKSTLLSV  177 (424)
T ss_pred             cEEEEcCCCCCHHHHHHH
Confidence            588999999999999985


No 224
>TIGR03499 FlhF flagellar biosynthetic protein FlhF.
Probab=96.95  E-value=0.00067  Score=43.01  Aligned_cols=20  Identities=35%  Similarity=0.348  Sum_probs=17.3

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+.++|++|+|||+++.+
T Consensus       194 ~~vi~~vGptGvGKTTt~~k  213 (282)
T TIGR03499       194 GGVIALVGPTGVGKTTTLAK  213 (282)
T ss_pred             CeEEEEECCCCCCHHHHHHH
Confidence            34678999999999999986


No 225
>PF13555 AAA_29:  P-loop containing region of AAA domain
Probab=96.95  E-value=0.0008  Score=34.13  Aligned_cols=18  Identities=28%  Similarity=0.477  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++.|++|+|||+++-.
T Consensus        25 ~tli~G~nGsGKSTllDA   42 (62)
T PF13555_consen   25 VTLITGPNGSGKSTLLDA   42 (62)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            378889999999999965


No 226
>PF00005 ABC_tran:  ABC transporter This structure is on hold until Dec 1999;  InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). On the basis of sequence similarities a family of related ATP-binding proteins has been characterised [, , , , ].  The proteins belonging to this family also contain one or two copies of the 'A' consensus sequence [] or the 'P-loop' [] (see IPR001687 from INTERPRO).; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NHB_A 3NH9_A 3NHA_A 3NH6_A 1VCI_A 1V43_A 2YZ2_B 2PMK_A 2FFA_A 1XEF_D ....
Probab=96.95  E-value=0.00065  Score=37.94  Aligned_cols=18  Identities=33%  Similarity=0.517  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+..
T Consensus        13 ~~~i~G~nGsGKStLl~~   30 (137)
T PF00005_consen   13 IVAIVGPNGSGKSTLLKA   30 (137)
T ss_dssp             EEEEEESTTSSHHHHHHH
T ss_pred             EEEEEccCCCccccceee
Confidence            578999999999999974


No 227
>PF13401 AAA_22:  AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B.
Probab=96.95  E-value=0.00044  Score=38.17  Aligned_cols=18  Identities=39%  Similarity=0.447  Sum_probs=14.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|++|+|||+++.+
T Consensus         6 ~~~i~G~~G~GKT~~~~~   23 (131)
T PF13401_consen    6 ILVISGPPGSGKTTLIKR   23 (131)
T ss_dssp             -EEEEE-TTSSHHHHHHH
T ss_pred             ccEEEcCCCCCHHHHHHH
Confidence            467889999999999986


No 228
>PRK06217 hypothetical protein; Validated
Probab=96.94  E-value=0.00087  Score=39.65  Aligned_cols=19  Identities=26%  Similarity=0.405  Sum_probs=17.3

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+|+++|.+|+|||++..+
T Consensus         2 ~~I~i~G~~GsGKSTla~~   20 (183)
T PRK06217          2 MRIHITGASGSGTTTLGAA   20 (183)
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            4799999999999999986


No 229
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=96.93  E-value=0.00085  Score=45.16  Aligned_cols=19  Identities=32%  Similarity=0.501  Sum_probs=17.5

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .++.++|++|+|||+++.+
T Consensus       242 ~vI~LVGptGvGKTTTiaK  260 (436)
T PRK11889        242 QTIALIGPTGVGKTTTLAK  260 (436)
T ss_pred             cEEEEECCCCCcHHHHHHH
Confidence            5789999999999999986


No 230
>PF05729 NACHT:  NACHT domain
Probab=96.92  E-value=0.00067  Score=38.44  Aligned_cols=17  Identities=24%  Similarity=0.436  Sum_probs=15.6

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +++.|+.|+|||+++.+
T Consensus         3 l~I~G~~G~GKStll~~   19 (166)
T PF05729_consen    3 LWISGEPGSGKSTLLRK   19 (166)
T ss_pred             EEEECCCCCChHHHHHH
Confidence            68899999999999985


No 231
>PRK00089 era GTPase Era; Reviewed
Probab=96.91  E-value=0.0013  Score=41.31  Aligned_cols=21  Identities=33%  Similarity=0.431  Sum_probs=18.5

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....|.++|+.|+|||||+.+
T Consensus         4 ~~g~V~iiG~pn~GKSTLin~   24 (292)
T PRK00089          4 KSGFVAIVGRPNVGKSTLLNA   24 (292)
T ss_pred             eeEEEEEECCCCCCHHHHHHH
Confidence            456789999999999999985


No 232
>PF04665 Pox_A32:  Poxvirus A32 protein;  InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein. This is thought to be an ATPase involved in viral DNA packaging [].
Probab=96.89  E-value=0.00083  Score=42.13  Aligned_cols=22  Identities=32%  Similarity=0.605  Sum_probs=19.1

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++++++|.+|+|||+++..
T Consensus        11 ~~~fr~viIG~sGSGKT~li~~   32 (241)
T PF04665_consen   11 KDPFRMVIIGKSGSGKTTLIKS   32 (241)
T ss_pred             CCCceEEEECCCCCCHHHHHHH
Confidence            4468999999999999998874


No 233
>COG1162 Predicted GTPases [General function prediction only]
Probab=96.88  E-value=0.00081  Score=43.43  Aligned_cols=18  Identities=44%  Similarity=0.685  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -.+++|.||||||||+.+
T Consensus       166 ~svl~GqSGVGKSSLiN~  183 (301)
T COG1162         166 ITVLLGQSGVGKSTLINA  183 (301)
T ss_pred             eEEEECCCCCcHHHHHHh
Confidence            467889999999999986


No 234
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=96.86  E-value=0.00074  Score=42.32  Aligned_cols=17  Identities=24%  Similarity=0.561  Sum_probs=14.7

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      -.++||||||||+++.-
T Consensus        36 TAlIGPSGcGKST~LR~   52 (253)
T COG1117          36 TALIGPSGCGKSTLLRC   52 (253)
T ss_pred             EEEECCCCcCHHHHHHH
Confidence            46889999999999963


No 235
>PRK00300 gmk guanylate kinase; Provisional
Probab=96.85  E-value=0.00093  Score=39.83  Aligned_cols=19  Identities=32%  Similarity=0.503  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|++|+|||+|+..
T Consensus         6 ~~i~i~G~sGsGKstl~~~   24 (205)
T PRK00300          6 LLIVLSGPSGAGKSTLVKA   24 (205)
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            3578999999999999974


No 236
>cd01858 NGP_1 NGP-1.  Autoantigen NGP-1 (Nucleolar G-protein gene 1) has been shown to localize in the nucleolus and nucleolar organizers in all cell types analyzed, which is indicative of a function in ribosomal assembly. NGP-1 and its homologs show a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with NKXD motif) are relocated to the N terminus.
Probab=96.84  E-value=0.0011  Score=38.12  Aligned_cols=20  Identities=25%  Similarity=0.421  Sum_probs=17.9

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+.++|.++||||||+.+
T Consensus       102 ~~~v~~~G~~nvGKStliN~  121 (157)
T cd01858         102 QISVGFIGYPNVGKSSIINT  121 (157)
T ss_pred             ceEEEEEeCCCCChHHHHHH
Confidence            46788999999999999986


No 237
>PRK12288 GTPase RsgA; Reviewed
Probab=96.82  E-value=0.001  Score=43.51  Aligned_cols=17  Identities=47%  Similarity=0.771  Sum_probs=15.8

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      ++++|.+|||||||+.+
T Consensus       208 ~~~vG~sgVGKSTLiN~  224 (347)
T PRK12288        208 SIFVGQSGVGKSSLINA  224 (347)
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            68899999999999986


No 238
>PF13173 AAA_14:  AAA domain
Probab=96.81  E-value=0.00095  Score=37.39  Aligned_cols=18  Identities=33%  Similarity=0.505  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|+.+||||+++.+
T Consensus         4 ~~~l~G~R~vGKTtll~~   21 (128)
T PF13173_consen    4 IIILTGPRGVGKTTLLKQ   21 (128)
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            467889999999999986


No 239
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]
Probab=96.79  E-value=0.0011  Score=42.05  Aligned_cols=17  Identities=24%  Similarity=0.444  Sum_probs=15.0

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.++||+|+|||+|+..
T Consensus        31 ~~iiGpNG~GKSTLLk~   47 (258)
T COG1120          31 TGILGPNGSGKSTLLKC   47 (258)
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            56889999999999974


No 240
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=96.78  E-value=0.0016  Score=41.17  Aligned_cols=17  Identities=24%  Similarity=0.610  Sum_probs=15.4

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.++|++|+|||+|++.
T Consensus        33 VaiIG~SGaGKSTLLR~   49 (258)
T COG3638          33 VAIIGPSGAGKSTLLRS   49 (258)
T ss_pred             EEEECCCCCcHHHHHHH
Confidence            78899999999999964


No 241
>PF03266 NTPase_1:  NTPase;  InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency []. It includes proteins from bacteria to human, and the function was determined first in a hyperthermophilic bacterium to be an NTPase []. The structure of one member-sequence represents a variation of the RecA fold, and implies that the function might be that of a DNA/RNA modifying enzyme []. The sequence carries both a Walker A and Walker B motif which together are characteristic of ATPases or GTPases. The protein exhibits an increased expression profile in human liver cholangiocarcinoma when compared to normal tissue [].; GO: 0005524 ATP binding, 0016740 transferase activity, 0019204 nucleotide phosphatase activity; PDB: 1YE8_A 2I3B_A.
Probab=96.78  E-value=0.0014  Score=38.87  Aligned_cols=18  Identities=33%  Similarity=0.525  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ++++-|+.|+|||+++.+
T Consensus         1 ~i~iTG~pG~GKTTll~k   18 (168)
T PF03266_consen    1 HIFITGPPGVGKTTLLKK   18 (168)
T ss_dssp             EEEEES-TTSSHHHHHHH
T ss_pred             CEEEECcCCCCHHHHHHH
Confidence            688999999999999986


No 242
>PF01637 Arch_ATPase:  Archaeal ATPase;  InterPro: IPR011579  This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP.; GO: 0005524 ATP binding; PDB: 2FNA_A 2QEN_A.
Probab=96.77  E-value=0.00082  Score=39.92  Aligned_cols=19  Identities=26%  Similarity=0.384  Sum_probs=16.3

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-+++.|+.|+|||+|+..
T Consensus        21 ~~~~l~G~rg~GKTsLl~~   39 (234)
T PF01637_consen   21 QHILLYGPRGSGKTSLLKE   39 (234)
T ss_dssp             SEEEEEESTTSSHHHHHHH
T ss_pred             cEEEEEcCCcCCHHHHHHH
Confidence            3577889999999999985


No 243
>PRK05541 adenylylsulfate kinase; Provisional
Probab=96.77  E-value=0.0023  Score=37.41  Aligned_cols=20  Identities=25%  Similarity=0.145  Sum_probs=17.4

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..-+++.|.+|+|||+++..
T Consensus         7 ~~~I~i~G~~GsGKst~a~~   26 (176)
T PRK05541          7 GYVIWITGLAGSGKTTIAKA   26 (176)
T ss_pred             CCEEEEEcCCCCCHHHHHHH
Confidence            35789999999999999974


No 244
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional
Probab=96.77  E-value=0.0011  Score=44.35  Aligned_cols=20  Identities=30%  Similarity=0.400  Sum_probs=17.3

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++++|++|||||+++.+
T Consensus       206 ~~ii~lvGptGvGKTTt~ak  225 (407)
T PRK12726        206 HRIISLIGQTGVGKTTTLVK  225 (407)
T ss_pred             CeEEEEECCCCCCHHHHHHH
Confidence            34678999999999999986


No 245
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE).  They are clustered together phylogenetically.  MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all.  An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport.  The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.
Probab=96.76  E-value=0.0013  Score=39.56  Aligned_cols=18  Identities=28%  Similarity=0.473  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        32 ~~~l~G~nGsGKSTLl~~   49 (218)
T cd03255          32 FVAIVGPSGSGKSTLLNI   49 (218)
T ss_pred             EEEEEcCCCCCHHHHHHH
Confidence            467999999999999974


No 246
>PRK12299 obgE GTPase CgtA; Reviewed
Probab=96.76  E-value=0.0037  Score=40.72  Aligned_cols=52  Identities=19%  Similarity=0.141  Sum_probs=29.1

Q ss_pred             eEEEEECCCCChHHHHHhHhhhcccccc-ccccccccceEEEEee-EEEEEEecC
Q psy15257         13 VKCVVVGDTAVGKTRLICARACNKQVSL-SQLLTTHVPTVWAIDQ-YRIYKDTLE   65 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~~~~~~~~~~-~~~~~~~~~ti~~vd~-~~~~~~i~~   65 (65)
                      ..|.++|.+++|||||+.+ +++..... +...++..|.++.++. -...+.++|
T Consensus       159 adVglVG~PNaGKSTLln~-ls~a~~~va~ypfTT~~p~~G~v~~~~~~~~~i~D  212 (335)
T PRK12299        159 ADVGLVGLPNAGKSTLISA-VSAAKPKIADYPFTTLHPNLGVVRVDDYKSFVIAD  212 (335)
T ss_pred             CCEEEEcCCCCCHHHHHHH-HHcCCCccCCCCCceeCceEEEEEeCCCcEEEEEe
Confidence            3478999999999999985 33221111 1112345677774332 113455554


No 247
>PRK05480 uridine/cytidine kinase; Provisional
Probab=96.75  E-value=0.0019  Score=38.81  Aligned_cols=21  Identities=19%  Similarity=0.322  Sum_probs=18.4

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....+.+.|++|+|||+|+..
T Consensus         5 ~~~iI~I~G~sGsGKTTl~~~   25 (209)
T PRK05480          5 KPIIIGIAGGSGSGKTTVAST   25 (209)
T ss_pred             CCEEEEEECCCCCCHHHHHHH
Confidence            457899999999999999975


No 248
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF. Members of this protein family are GTP-binding proteins involved in ribosome biogenesis, including the essential YlqF protein of Bacillus subtilis, which is an essential protein. They are related to Era, EngA, and other GTPases of ribosome biogenesis, but are circularly permuted. This family is not universal, and is not present in Escherichia coli, and so is not as well studied as some other GTPases. This model is built for bacterial members.
Probab=96.75  E-value=0.0033  Score=39.60  Aligned_cols=21  Identities=33%  Similarity=0.559  Sum_probs=18.8

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.++|.++|||||++.+
T Consensus       117 ~~~~~~~vG~~nvGKSslin~  137 (276)
T TIGR03596       117 RPIRAMIVGIPNVGKSTLINR  137 (276)
T ss_pred             CCeEEEEECCCCCCHHHHHHH
Confidence            357899999999999999985


No 249
>PF04670 Gtr1_RagA:  Gtr1/RagA G protein conserved region;  InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1. RCC1 catalyzes guanine nucleotide exchange on Ran, a well characterised nuclear Ras-like small G protein that plays an essential role in the import and export of proteins and RNAs across the nuclear membrane through the nuclear pore complex. RCC1 is located inside the nucleus, bound to chromatin. The concentration of GTP within the cell is ~30 times higher than the concentration of GDP, thus resulting in the preferential production of the GTP form of Ran by RCC1 within the nucleus. Gtr1p is located within both the cytoplasm and the nucleus and has been reported to play a role in cell growth. Biochemical analysis revealed that Gtr1 is in fact a G protein of the Ras family. The RagA/B proteins are the human homologues of Gtr1 and Rag A and Gtr1p belong to the sixth subfamily of the Ras-like small GTPase superfamily []. ; GO: 0005525 GTP binding, 0005634 nucleus, 0005737 cytoplasm; PDB: 3R7W_B 2Q3F_B 3LLU_A.
Probab=96.74  E-value=0.0024  Score=39.80  Aligned_cols=18  Identities=28%  Similarity=0.447  Sum_probs=16.2

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      |++++|++++||||+..-
T Consensus         1 KiLLmG~~~SGKTSi~~v   18 (232)
T PF04670_consen    1 KILLMGPRRSGKTSIRSV   18 (232)
T ss_dssp             EEEEEESTTSSHHHHHHH
T ss_pred             CEEEEcCCCCChhhHHHH
Confidence            799999999999998853


No 250
>TIGR00487 IF-2 translation initiation factor IF-2. This model discriminates eubacterial (and mitochondrial) translation initiation factor 2 (IF-2), encoded by the infB gene in bacteria, from similar proteins in the Archaea and Eukaryotes. In the bacteria and in organelles, the initiator tRNA is charged with N-formyl-Met instead of Met. This translation factor acts in delivering the initator tRNA to the ribosome. It is one of a number of GTP-binding translation factors recognized by the pfam model GTP_EFTU.
Probab=96.73  E-value=0.0043  Score=43.15  Aligned_cols=21  Identities=24%  Similarity=0.332  Sum_probs=19.0

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++.++|+.++|||||+.+
T Consensus        86 r~p~V~I~Ghvd~GKTSLl~~  106 (587)
T TIGR00487        86 RPPVVTIMGHVDHGKTSLLDS  106 (587)
T ss_pred             CCCEEEEECCCCCCHHHHHHH
Confidence            457899999999999999996


No 251
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional
Probab=96.72  E-value=0.002  Score=42.83  Aligned_cols=19  Identities=42%  Similarity=0.545  Sum_probs=17.1

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|++|||||+++.+
T Consensus       175 ~vi~lvGptGvGKTTT~aK  193 (388)
T PRK12723        175 RVFILVGPTGVGKTTTIAK  193 (388)
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            4788999999999999986


No 252
>PHA00729 NTP-binding motif containing protein
Probab=96.72  E-value=0.0018  Score=40.34  Aligned_cols=19  Identities=32%  Similarity=0.468  Sum_probs=17.4

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++.|++|+|||+++.+
T Consensus        18 ~nIlItG~pGvGKT~LA~a   36 (226)
T PHA00729         18 VSAVIFGKQGSGKTTYALK   36 (226)
T ss_pred             EEEEEECCCCCCHHHHHHH
Confidence            4799999999999999986


No 253
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family. This model represents a subfamily of proteins that includes thermoresistant and thermosensitve isozymes of gluconate kinase (gluconokinase) in E. coli and other related proteins; members of this family are often named by similarity to the thermostable isozyme. These proteins show homology to shikimate kinases and adenylate kinases but not to gluconate kinases from the FGGY family of carbohydrate kinases.
Probab=96.71  E-value=0.0012  Score=38.16  Aligned_cols=17  Identities=29%  Similarity=0.499  Sum_probs=14.9

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      ++++|++|+|||++...
T Consensus         1 i~l~G~~GsGKSTla~~   17 (163)
T TIGR01313         1 FVLMGVAGSGKSTIASA   17 (163)
T ss_pred             CEEECCCCCCHHHHHHH
Confidence            46889999999999875


No 254
>PF00625 Guanylate_kin:  Guanylate kinase;  InterPro: IPR008144 Guanylate kinase (2.7.4.8 from EC) (GK) [] catalyzes the ATP-dependent phosphorylation of GMP into GDP. It is essential for recycling GMP and indirectly, cGMP. In prokaryotes (such as Escherichia coli), lower eukaryotes (such as yeast) and in vertebrates, GK is a highly conserved monomeric protein of about 200 amino acids. GK has been shown [, , ] to be structurally similar to protein A57R (or SalG2R) from various strains of Vaccinia virus. Proteins containing one or more copies of the DHR domain, an SH3 domain as well as a C-terminal GK-like domain, are collectively termed MAGUKs (membrane-associated guanylate kinase homologs) [], and include Drosophila lethal(1)discs large-1 tumor suppressor protein (gene dlg1); mammalian tight junction protein Zo-1; a family of mammalian synaptic proteins that seem to interact with the cytoplasmic tail of NMDA receptor subunits (SAP90/PSD-95, CHAPSYN-110/PSD-93, SAP97/DLG1 and SAP102); vertebrate 55kDa erythrocyte membrane protein (p55); Caenorhabditis elegans protein lin-2; rat protein CASK; and human proteins DLG2 and DLG3. There is an ATP-binding site (P-loop) in the N-terminal section of GK, which is not conserved in the GK-like domain of the above proteins. However these proteins retain the residues known, in GK, to be involved in the binding of GMP.; GO: 0005515 protein binding; PDB: 3UAT_A 3KFV_A 2ANC_F 2F3T_E 2ANB_A 2AN9_A 1S96_A 2F3R_B 3TR0_A 1LVG_A ....
Probab=96.71  E-value=0.0015  Score=38.55  Aligned_cols=18  Identities=33%  Similarity=0.458  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -++++||+|+||++|..+
T Consensus         4 ~ivl~Gpsg~GK~~l~~~   21 (183)
T PF00625_consen    4 PIVLVGPSGSGKSTLAKR   21 (183)
T ss_dssp             EEEEESSTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            368899999999999985


No 255
>smart00072 GuKc Guanylate kinase homologues. Active enzymes catalyze ATP-dependent phosphorylation of GMP to GDP. Structure resembles that of adenylate kinase. So-called membrane-associated guanylate kinase homologues (MAGUKs) do not possess guanylate kinase activities; instead at least some possess protein-binding functions.
Probab=96.70  E-value=0.0015  Score=38.68  Aligned_cols=18  Identities=33%  Similarity=0.549  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -++++|++|+||++++.+
T Consensus         4 ~ivl~Gpsg~GK~tl~~~   21 (184)
T smart00072        4 PIVLSGPSGVGKGTLLAE   21 (184)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999985


No 256
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein.
Probab=96.70  E-value=0.0016  Score=39.21  Aligned_cols=18  Identities=22%  Similarity=0.462  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        31 ~~~i~G~nGsGKSTLl~~   48 (216)
T TIGR00960        31 MVFLVGHSGAGKSTFLKL   48 (216)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            468999999999999973


No 257
>TIGR00157 ribosome small subunit-dependent GTPase A. The Aquifex aeolicus ortholog is split into consecutive open reading frames. Consequently, this model was build in fragment mode (-f option).
Probab=96.70  E-value=0.0015  Score=40.72  Aligned_cols=18  Identities=44%  Similarity=0.634  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++|.+|||||||+.+
T Consensus       122 ~~~~~G~sgvGKStLiN~  139 (245)
T TIGR00157       122 ISVFAGQSGVGKSSLINA  139 (245)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578899999999999986


No 258
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=96.70  E-value=0.0016  Score=38.93  Aligned_cols=18  Identities=28%  Similarity=0.346  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKSTLl~~   45 (205)
T cd03226          28 IIALTGKNGAGKTTLAKI   45 (205)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974


No 259
>PRK10416 signal recognition particle-docking protein FtsY; Provisional
Probab=96.69  E-value=0.0015  Score=42.20  Aligned_cols=20  Identities=40%  Similarity=0.403  Sum_probs=17.4

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+.++|++|+|||+++.+
T Consensus       114 ~~vi~lvGpnGsGKTTt~~k  133 (318)
T PRK10416        114 PFVILVVGVNGVGKTTTIGK  133 (318)
T ss_pred             CeEEEEECCCCCcHHHHHHH
Confidence            35678999999999999986


No 260
>PF07724 AAA_2:  AAA domain (Cdc48 subfamily);  InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []. The highly conserved nature of this module across taxa suggests that it has a key cellular role. Members of the family are involved in diverse cellular functions including gene expression, peroxisome assembly and vesicle mediated transport. Although the role of ATPase AAA-2 domain is not, as yet, clear, the AAA+ superfamily of proteins to which the AAA ATPases belong has a chaperone-like function in the assembly, operation or disassembly of proteins []. Some of these ATPases function as a chaperone subunit of a proteasome-like degradation complex. This ATPase family includes some proteins not detected by IPR003959 from INTERPRO.; GO: 0005524 ATP binding; PDB: 1R6B_X 1KSF_X 3PXI_C 1KYI_T 1G3I_S 1OFH_B 1OFI_A 1G41_A 1IM2_A 1HQY_E ....
Probab=96.69  E-value=0.002  Score=38.23  Aligned_cols=20  Identities=35%  Similarity=0.458  Sum_probs=17.4

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++++||+|||||.++..
T Consensus         3 ~~~~ll~GpsGvGKT~la~~   22 (171)
T PF07724_consen    3 KSNFLLAGPSGVGKTELAKA   22 (171)
T ss_dssp             SEEEEEESSTTSSHHHHHHH
T ss_pred             EEEEEEECCCCCCHHHHHHH
Confidence            35789999999999999875


No 261
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]
Probab=96.68  E-value=0.0014  Score=42.14  Aligned_cols=17  Identities=29%  Similarity=0.417  Sum_probs=14.9

Q ss_pred             EEEEECCCCChHHHHHh
Q psy15257         14 KCVVVGDTAVGKTRLIC   30 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~   30 (65)
                      -++++|+||+|||+++.
T Consensus        29 f~vliGpSGsGKTTtLk   45 (309)
T COG1125          29 FLVLIGPSGSGKTTTLK   45 (309)
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            36788999999999996


No 262
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein. Phosphonates are a class of phosphorus-containing organic compound with a stable direct C-P bond rather than a C-O-P linkage. A number of bacterial species have operons, typically about 14 genes in size, with genes for ATP-dependent transport of phosphonates, degradation, and regulation of the expression of the system. Members of this protein family are the ATP-binding cassette component of tripartite ABC transporters of phosphonates.
Probab=96.68  E-value=0.0017  Score=39.71  Aligned_cols=18  Identities=22%  Similarity=0.505  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        30 ~~~l~G~nGsGKSTLl~~   47 (243)
T TIGR02315        30 FVAIIGPSGAGKSTLLRC   47 (243)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477999999999999974


No 263
>PF13238 AAA_18:  AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C ....
Probab=96.67  E-value=0.0014  Score=35.78  Aligned_cols=17  Identities=24%  Similarity=0.225  Sum_probs=15.2

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      |++.|.+|+|||+++..
T Consensus         1 I~i~G~~GsGKtTia~~   17 (129)
T PF13238_consen    1 IGISGIPGSGKTTIAKE   17 (129)
T ss_dssp             EEEEESTTSSHHHHHHH
T ss_pred             CEEECCCCCCHHHHHHH
Confidence            57889999999999984


No 264
>cd04167 Snu114p Snu114p subfamily.  Snu114p is one of several proteins that make up the U5 small nuclear ribonucleoprotein (snRNP) particle.  U5 is a component of the spliceosome, which catalyzes the splicing of pre-mRNA to remove introns.  Snu114p is homologous to EF-2, but typically contains an additional N-terminal domain not found in Ef-2.  This protein is part of the GTP translation factor family and the Ras superfamily, characterized by five G-box motifs.
Probab=96.67  E-value=0.0013  Score=39.68  Aligned_cols=18  Identities=28%  Similarity=0.409  Sum_probs=16.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|+.++|||+|+.+
T Consensus         2 nv~iiG~~~~GKTtL~~~   19 (213)
T cd04167           2 NVAIAGHLHHGKTSLLDM   19 (213)
T ss_pred             cEEEEcCCCCCHHHHHHH
Confidence            688999999999999986


No 265
>TIGR00101 ureG urease accessory protein UreG. This model represents UreG, a GTP hydrolase that acts in the assembly of the nickel metallocenter of urease. It is found only in urease-positive species, although some urease-positive species (e.g. Bacillus subtilis) lack this protein. A similar protein, hypB, is an accessory protein for expression of hydrogenase, which also uses nickel.
Probab=96.66  E-value=0.002  Score=39.00  Aligned_cols=19  Identities=47%  Similarity=0.503  Sum_probs=17.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      +++.++|+.|+|||+++.+
T Consensus         2 ~~i~i~G~~GsGKTTll~~   20 (199)
T TIGR00101         2 LKIGVAGPVGSGKTALIEA   20 (199)
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            6899999999999999985


No 266
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=96.66  E-value=0.0018  Score=38.80  Aligned_cols=18  Identities=28%  Similarity=0.471  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        29 ~~~l~G~nGsGKSTLl~~   46 (211)
T cd03225          29 FVLIVGPNGSGKSTLLRL   46 (211)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 267
>cd04178 Nucleostemin_like Nucleostemin-like.  Nucleostemin (NS) is a nucleolar protein that functions as a regulator of cell growth and proliferation in stem cells and in several types of cancer cells, but is not expressed in the differentiated cells of most mammalian adult tissues.  NS shuttles between the nucleolus and nucleoplasm bidirectionally at a rate that is fast and independent of cell type.  Lowering GTP levels decreases the nucleolar retention of NS, and expression of NS is abruptly down-regulated during differentiation prior to terminal cell division.  Found only in eukaryotes, NS consists of an N-terminal basic domain, a coiled-coil domain, a GTP-binding domain, an intermediate domain, and a C-terminal acidic domain.  Experimental evidence indicates that NS uses its GTP-binding property as a molecular switch to control the transition between the nucleolus and nucleoplasm, and this process involves interaction between the basic, GTP-binding, and intermediate domains of the 
Probab=96.66  E-value=0.0039  Score=36.99  Aligned_cols=20  Identities=40%  Similarity=0.473  Sum_probs=18.2

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.++|.++||||||+.+
T Consensus       117 ~~~~~~vG~pnvGKSslin~  136 (172)
T cd04178         117 SITVGVVGFPNVGKSSLINS  136 (172)
T ss_pred             CcEEEEEcCCCCCHHHHHHH
Confidence            36899999999999999986


No 268
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component.  The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.65  E-value=0.0016  Score=39.11  Aligned_cols=18  Identities=28%  Similarity=0.390  Sum_probs=16.2

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        27 ~~~i~G~nGsGKSTLl~~   44 (211)
T cd03264          27 MYGLLGPNGAGKTTLMRI   44 (211)
T ss_pred             cEEEECCCCCCHHHHHHH
Confidence            678999999999999974


No 269
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity.  In eubacteria and archaea, the typical organization consists of one ABC and one or two IMs.  Eukaryote systems of the ABCA subfamily display ABC domains strongly similar to this family.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.65  E-value=0.0018  Score=38.79  Aligned_cols=18  Identities=28%  Similarity=0.303  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKSTLl~~   45 (210)
T cd03269          28 IFGLLGPNGAGKTTTIRM   45 (210)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 270
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.
Probab=96.65  E-value=0.0017  Score=40.03  Aligned_cols=18  Identities=33%  Similarity=0.519  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.|++|+|||+++.+
T Consensus        45 ~~~l~G~~G~GKTtl~~~   62 (269)
T TIGR03015        45 FILITGEVGAGKTTLIRN   62 (269)
T ss_pred             EEEEEcCCCCCHHHHHHH
Confidence            578999999999999985


No 271
>TIGR00235 udk uridine kinase. Model contains a number of longer eukaryotic proteins and starts bringing in phosphoribulokinase hits at scores of 160 and below
Probab=96.64  E-value=0.0026  Score=38.31  Aligned_cols=20  Identities=20%  Similarity=0.172  Sum_probs=17.4

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..-+.+.|++|+|||+|+..
T Consensus         6 g~vi~I~G~sGsGKSTl~~~   25 (207)
T TIGR00235         6 GIIIGIGGGSGSGKTTVARK   25 (207)
T ss_pred             eEEEEEECCCCCCHHHHHHH
Confidence            35688999999999999975


No 272
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane.  The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring.
Probab=96.63  E-value=0.0019  Score=38.70  Aligned_cols=18  Identities=28%  Similarity=0.444  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        29 ~~~i~G~nGsGKSTLl~~   46 (214)
T cd03292          29 FVFLVGPSGAGKSTLLKL   46 (214)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973


No 273
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids.  The  E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.
Probab=96.63  E-value=0.0019  Score=38.94  Aligned_cols=18  Identities=28%  Similarity=0.477  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKSTLl~~   45 (222)
T cd03224          28 IVALLGRNGAGKTTLLKT   45 (222)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999973


No 274
>PF12775 AAA_7:  P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A.
Probab=96.63  E-value=0.002  Score=40.80  Aligned_cols=19  Identities=37%  Similarity=0.522  Sum_probs=17.2

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|++|+|||.++..
T Consensus        34 ~pvLl~G~~GtGKT~li~~   52 (272)
T PF12775_consen   34 RPVLLVGPSGTGKTSLIQN   52 (272)
T ss_dssp             EEEEEESSTTSSHHHHHHH
T ss_pred             CcEEEECCCCCchhHHHHh
Confidence            5689999999999999986


No 275
>PRK13695 putative NTPase; Provisional
Probab=96.63  E-value=0.002  Score=37.72  Aligned_cols=19  Identities=37%  Similarity=0.539  Sum_probs=17.2

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      +|+++.|++|+|||+++..
T Consensus         1 ~~i~ltG~~G~GKTTll~~   19 (174)
T PRK13695          1 MKIGITGPPGVGKTTLVLK   19 (174)
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            4789999999999999985


No 276
>PRK12289 GTPase RsgA; Reviewed
Probab=96.63  E-value=0.0016  Score=42.77  Aligned_cols=17  Identities=47%  Similarity=0.675  Sum_probs=15.9

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      ++++|++|||||||+.+
T Consensus       175 ~v~iG~SgVGKSSLIN~  191 (352)
T PRK12289        175 TVVAGPSGVGKSSLINR  191 (352)
T ss_pred             EEEEeCCCCCHHHHHHH
Confidence            68999999999999986


No 277
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=96.62  E-value=0.0019  Score=42.78  Aligned_cols=20  Identities=30%  Similarity=0.267  Sum_probs=17.6

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-.++++|++|||||+++.+
T Consensus       137 g~ii~lvGptGvGKTTtiak  156 (374)
T PRK14722        137 GGVFALMGPTGVGKTTTTAK  156 (374)
T ss_pred             CcEEEEECCCCCCHHHHHHH
Confidence            34678999999999999987


No 278
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE).  The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE).  The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis.  The molecular mechanism of nickel uptake in many bacteria and most archaea is not known.  Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides.  The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF.
Probab=96.62  E-value=0.002  Score=38.95  Aligned_cols=18  Identities=33%  Similarity=0.469  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        33 ~~~i~G~nGsGKSTLl~~   50 (228)
T cd03257          33 TLGLVGESGSGKSTLARA   50 (228)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999973


No 279
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit. This model describes the ATP binding subunit of the multisubunit cobalt transporter in bacteria and its equivalents in archaea. The model is restricted to ATP subunit that is a part of the cobalt transporter, which belongs to the ABC transporter superfamily (ATP Binding Cassette). The model excludes ATP binding subunit that are associated with other transporters belonging to ABC transporter superfamily. This superfamily includes two groups, one which catalyze the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drive the both the process of uptake and efflux.
Probab=96.61  E-value=0.0018  Score=38.30  Aligned_cols=18  Identities=22%  Similarity=0.436  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        20 ~~~i~G~nGsGKSTLl~~   37 (190)
T TIGR01166        20 VLALLGANGAGKSTLLLH   37 (190)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            468999999999999973


No 280
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.61  E-value=0.002  Score=39.29  Aligned_cols=18  Identities=22%  Similarity=0.447  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~l~G~nGsGKSTLl~~   45 (235)
T cd03261          28 ILAIIGPSGSGKSTLLRL   45 (235)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            468999999999999974


No 281
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group. A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins.
Probab=96.60  E-value=0.0021  Score=38.34  Aligned_cols=18  Identities=22%  Similarity=0.556  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        26 ~~~i~G~nGsGKSTLl~~   43 (206)
T TIGR03608        26 MYAIIGESGSGKSTLLNI   43 (206)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974


No 282
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively.  Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP.  HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM.  The two HisP subunits form a homodimer within the complex.  The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems.  All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria.  The best-studied member of the PAAT (polar amino acid transport) family is the HisJQM
Probab=96.60  E-value=0.0021  Score=38.54  Aligned_cols=18  Identities=28%  Similarity=0.575  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~l~G~nGsGKSTLl~~   45 (213)
T cd03262          28 VVVIIGPSGSGKSTLLRC   45 (213)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974


No 283
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=96.60  E-value=0.0021  Score=38.36  Aligned_cols=18  Identities=28%  Similarity=0.329  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        27 ~~~l~G~nGsGKSTLl~~   44 (177)
T cd03222          27 VIGIVGPNGTGKTTAVKI   44 (177)
T ss_pred             EEEEECCCCChHHHHHHH
Confidence            578999999999999973


No 284
>PRK06893 DNA replication initiation factor; Validated
Probab=96.58  E-value=0.0019  Score=39.68  Aligned_cols=18  Identities=28%  Similarity=0.381  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.|++|+|||+|+..
T Consensus        41 ~l~l~G~~G~GKThL~~a   58 (229)
T PRK06893         41 FFYIWGGKSSGKSHLLKA   58 (229)
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            478899999999999974


No 285
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient.  The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes.  The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system.  PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein.  PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).
Probab=96.58  E-value=0.0022  Score=38.89  Aligned_cols=18  Identities=22%  Similarity=0.460  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKSTLl~~   45 (227)
T cd03260          28 ITALIGPSGCGKSTLLRL   45 (227)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 286
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup.  This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.   ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.58  E-value=0.0022  Score=38.53  Aligned_cols=18  Identities=28%  Similarity=0.414  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKSTLl~~   45 (213)
T cd03259          28 FLALLGPSGCGKTTLLRL   45 (213)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477999999999999974


No 287
>TIGR02673 FtsE cell division ATP-binding protein FtsE. This model describes FtsE, a member of the ABC transporter ATP-binding protein family. This protein, and its permease partner FtsX, localize to the division site. In a number of species, the ftsEX gene pair is located next to FtsY, the signal recognition particle-docking protein.
Probab=96.58  E-value=0.0022  Score=38.49  Aligned_cols=18  Identities=28%  Similarity=0.372  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        30 ~~~l~G~nGsGKSTLl~~   47 (214)
T TIGR02673        30 FLFLTGPSGAGKTTLLKL   47 (214)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973


No 288
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin.  In addition to DrrA, the complex includes an integral membrane protein called DrrB.  DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called  P-glycoprotein.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.57  E-value=0.0022  Score=38.74  Aligned_cols=18  Identities=28%  Similarity=0.292  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKSTLl~~   45 (220)
T cd03265          28 IFGLLGPNGAGKTTTIKM   45 (220)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 289
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members of this protein family are Hda (Homologous to DnaA). These proteins are about half the length of DnaA and homologous over length of Hda. In the model species Escherichia coli, the initiation of DNA replication requires DnaA bound to ATP rather than ADP; Hda helps facilitate the conversion of DnaA-ATP to DnaA-ADP.
Probab=96.57  E-value=0.0021  Score=38.67  Aligned_cols=19  Identities=26%  Similarity=0.357  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+++..
T Consensus        39 ~~lll~G~~G~GKT~la~~   57 (226)
T TIGR03420        39 RFLYLWGESGSGKSHLLQA   57 (226)
T ss_pred             CeEEEECCCCCCHHHHHHH
Confidence            4688999999999999975


No 290
>PRK09563 rbgA GTPase YlqF; Reviewed
Probab=96.57  E-value=0.0052  Score=38.96  Aligned_cols=21  Identities=29%  Similarity=0.572  Sum_probs=18.9

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++++|.++|||||++.+
T Consensus       120 ~~~~~~~~G~pnvGKSsliN~  140 (287)
T PRK09563        120 RAIRAMIIGIPNVGKSTLINR  140 (287)
T ss_pred             CceEEEEECCCCCCHHHHHHH
Confidence            457899999999999999985


No 291
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters.  This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc.  The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor.  The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri.  Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates.
Probab=96.57  E-value=0.0022  Score=38.51  Aligned_cols=18  Identities=33%  Similarity=0.488  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        27 ~~~l~G~nGsGKSTLl~~   44 (213)
T cd03235          27 FLAIVGPNGAGKSTLLKA   44 (213)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999973


No 292
>PRK05057 aroK shikimate kinase I; Reviewed
Probab=96.55  E-value=0.0025  Score=37.63  Aligned_cols=19  Identities=21%  Similarity=0.281  Sum_probs=17.0

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++++|++|+|||++...
T Consensus         5 ~~I~liG~~GaGKStl~~~   23 (172)
T PRK05057          5 RNIFLVGPMGAGKSTIGRQ   23 (172)
T ss_pred             CEEEEECCCCcCHHHHHHH
Confidence            3699999999999999985


No 293
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily. Members of this family are adenylate kinase, EC 2.7.4.3. This clade is found only in eukaryotes and includes human adenylate kinase isozyme 1 (myokinase). Within the adenylate kinase superfamily, this set appears specifically closely related to a subfamily of eukaryotic UMP-CMP kinases (TIGR01359), rather than to the large clade of bacterial, archaeal, and eukaryotic adenylate kinase family members in TIGR01351.
Probab=96.55  E-value=0.0022  Score=37.43  Aligned_cols=18  Identities=22%  Similarity=0.226  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++|+|||+++.+
T Consensus         5 ii~i~G~~GsGKsTl~~~   22 (188)
T TIGR01360         5 IIFIVGGPGSGKGTQCEK   22 (188)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578899999999999975


No 294
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilus, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of a single ATP-binding protein and a single intergral membrane protein.
Probab=96.55  E-value=0.0023  Score=38.52  Aligned_cols=18  Identities=22%  Similarity=0.294  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        33 ~~~i~G~nGsGKSTLl~~   50 (218)
T cd03266          33 VTGLLGPNGAGKTTTLRM   50 (218)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477999999999999974


No 295
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein. This model represents LolD, a member of the ABC transporter family (pfam00005). LolD is involved in localization of lipoproteins in some bacteria. It works with a transmembrane protein LolC, which in some species is a paralogous pair LolC and LolE. Depending on whether the residue immediately following the new, modified N-terminal Cys residue, the nascent lipoprotein may be carried further by LolA and LolB to the outer membrane, or remain at the inner membrane. The top scoring proteins excluded by this model include homologs from the archaeal genus Methanosarcina.
Probab=96.55  E-value=0.0023  Score=38.59  Aligned_cols=18  Identities=28%  Similarity=0.519  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        33 ~~~i~G~nGsGKSTLl~~   50 (221)
T TIGR02211        33 IVAIVGSSGSGKSTLLHL   50 (221)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 296
>PRK03839 putative kinase; Provisional
Probab=96.55  E-value=0.0024  Score=37.49  Aligned_cols=18  Identities=28%  Similarity=0.348  Sum_probs=16.4

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|.+|+|||++..+
T Consensus         2 ~I~l~G~pGsGKsT~~~~   19 (180)
T PRK03839          2 IIAITGTPGVGKTTVSKL   19 (180)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            589999999999999975


No 297
>PF13479 AAA_24:  AAA domain
Probab=96.54  E-value=0.0026  Score=38.65  Aligned_cols=20  Identities=30%  Similarity=0.486  Sum_probs=18.3

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++++-|++|+|||+++..
T Consensus         3 ~~~~lIyG~~G~GKTt~a~~   22 (213)
T PF13479_consen    3 PIKILIYGPPGSGKTTLAAS   22 (213)
T ss_pred             ceEEEEECCCCCCHHHHHHh
Confidence            47999999999999999985


No 298
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.54  E-value=0.0024  Score=38.59  Aligned_cols=18  Identities=28%  Similarity=0.460  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        32 ~~~i~G~nGsGKSTLl~~   49 (220)
T cd03293          32 FVALVGPSGCGKSTLLRI   49 (220)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367999999999999974


No 299
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine.  MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli  branched-chain amino acid transporter.  MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs.  The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).
Probab=96.54  E-value=0.0023  Score=38.91  Aligned_cols=18  Identities=28%  Similarity=0.359  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~l~G~nGsGKSTLl~~   45 (236)
T cd03219          28 IHGLIGPNGAGKTTLFNL   45 (236)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974


No 300
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system.  Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond.  Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond.  Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.53  E-value=0.0024  Score=38.94  Aligned_cols=18  Identities=22%  Similarity=0.481  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        29 ~~~i~G~nGsGKSTLl~~   46 (241)
T cd03256          29 FVALIGPSGAGKSTLLRC   46 (241)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            468999999999999974


No 301
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids.  The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis.  YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein.  Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli.  The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.
Probab=96.53  E-value=0.0024  Score=38.78  Aligned_cols=18  Identities=22%  Similarity=0.294  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~l~G~nGsGKSTLl~~   45 (232)
T cd03218          28 IVGLLGPNGAGKTTTFYM   45 (232)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477999999999999974


No 302
>PRK09183 transposase/IS protein; Provisional
Probab=96.52  E-value=0.0021  Score=40.37  Aligned_cols=19  Identities=42%  Similarity=0.588  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.++++|++|+|||+|+..
T Consensus       103 ~~v~l~Gp~GtGKThLa~a  121 (259)
T PRK09183        103 ENIVLLGPSGVGKTHLAIA  121 (259)
T ss_pred             CeEEEEeCCCCCHHHHHHH
Confidence            4688999999999999975


No 303
>TIGR01978 sufC FeS assembly ATPase SufC. SufC is part of the SUF system, shown in E. coli to consist of six proteins and believed to act in Fe-S cluster formation during oxidative stress. SufC forms a complex with SufB and SufD. SufC belongs to the ATP-binding cassette transporter family (pfam00005) but is no longer thought to be part of a transporter. The complex is reported as cytosolic (PubMed:12554644) or associated with the membrane (PubMed:11943156). The SUF system also includes a cysteine desulfurase (SufS, enhanced by SufE) and a probable iron-sulfur cluster assembly scaffold protein, SufA.
Probab=96.52  E-value=0.0024  Score=38.94  Aligned_cols=18  Identities=22%  Similarity=0.342  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKSTLl~~   45 (243)
T TIGR01978        28 IHAIMGPNGSGKSTLSKT   45 (243)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974


No 304
>PRK14530 adenylate kinase; Provisional
Probab=96.51  E-value=0.0026  Score=38.47  Aligned_cols=18  Identities=17%  Similarity=0.351  Sum_probs=16.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|++|+|||++..+
T Consensus         5 ~I~i~G~pGsGKsT~~~~   22 (215)
T PRK14530          5 RILLLGAPGAGKGTQSSN   22 (215)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            799999999999999985


No 305
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=96.51  E-value=0.0024  Score=42.85  Aligned_cols=20  Identities=30%  Similarity=0.297  Sum_probs=17.8

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-++.++|++|+|||+++.+
T Consensus       191 g~vi~lvGpnG~GKTTtlak  210 (420)
T PRK14721        191 GGVYALIGPTGVGKTTTTAK  210 (420)
T ss_pred             CcEEEEECCCCCCHHHHHHH
Confidence            35789999999999999986


No 306
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit. The gene pair cydCD encodes an ABC-family transporter in which each gene contains an N-terminal membrane-spanning domain (pfam00664) and a C-terminal ATP-binding domain (pfam00005). In E. coli these genes were discovered as mutants which caused the terminal heme-copper oxidase complex cytochrome bd to fail to assemble. Recent work has shown that the transporter is involved in export of redox-active thiol compounds such as cysteine and glutathione. The linkage to assembly of the cytochrome bd complex is further supported by the conserved operon structure found outside the gammaproteobacteria (cydABCD) containing both the transporter and oxidase genes components. The genes used as the seed members for this model are all either found in the gammproteobacterial context or the CydABCD context. All members of this family scoring above trusted at the time of its creation were from genomes which encode a cytochrome bd complex.
Probab=96.51  E-value=0.0023  Score=43.23  Aligned_cols=19  Identities=21%  Similarity=0.501  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -++.++|++|+|||+|+.-
T Consensus       362 ~~vaIvG~SGsGKSTLl~l  380 (529)
T TIGR02868       362 ERVAILGPSGSGKSTLLML  380 (529)
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            3678999999999999973


No 307
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK), catalyzes the reversible phosphoryl transfer from ATP to uridine or cytidine to yield UMP or CMP. In the primidine nucleotide-salvage pathway, this enzyme combined with nucleoside diphosphate kinases further phosphorylates UMP and CMP to form UTP and CTP. This kinase also catalyzes the phosphorylation of several cytotoxic ribonucleoside analogs such as 5-flurrouridine and cyclopentenyl-cytidine.
Probab=96.51  E-value=0.0025  Score=37.94  Aligned_cols=17  Identities=24%  Similarity=0.327  Sum_probs=15.1

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.+.|++|+|||+++..
T Consensus         2 igi~G~~GsGKSTl~~~   18 (198)
T cd02023           2 IGIAGGSGSGKTTVAEE   18 (198)
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            56889999999999974


No 308
>TIGR00064 ftsY signal recognition particle-docking protein FtsY. There is a weak division between FtsY and SRP54; both are GTPases. In E.coli, ftsY is an essential gene located in an operon with cell division genes ftsE and ftsX, but its apparent function is as the signal recognition particle docking protein.
Probab=96.50  E-value=0.0028  Score=40.12  Aligned_cols=19  Identities=37%  Similarity=0.410  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+.++|++|+|||+++.+
T Consensus        73 ~vi~l~G~~G~GKTTt~ak   91 (272)
T TIGR00064        73 NVILFVGVNGVGKTTTIAK   91 (272)
T ss_pred             eEEEEECCCCCcHHHHHHH
Confidence            5677889999999999986


No 309
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds.  Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders.  The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis.  The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle.  The ABCA genes are not present in yeast.  However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages.
Probab=96.50  E-value=0.0026  Score=38.32  Aligned_cols=18  Identities=22%  Similarity=0.290  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        30 ~~~i~G~nGsGKSTLl~~   47 (220)
T cd03263          30 IFGLLGHNGAGKTTTLKM   47 (220)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477999999999999974


No 310
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional
Probab=96.50  E-value=0.0025  Score=38.62  Aligned_cols=18  Identities=22%  Similarity=0.243  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        15 ~~~l~G~NGsGKSTLlk~   32 (213)
T PRK15177         15 HIGILAAPGSGKTTLTRL   32 (213)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578999999999999973


No 311
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional
Probab=96.50  E-value=0.0026  Score=38.81  Aligned_cols=18  Identities=28%  Similarity=0.516  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        37 ~~~l~G~nGsGKSTLl~~   54 (233)
T PRK11629         37 MMAIVGSSGSGKSTLLHL   54 (233)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973


No 312
>PRK08084 DNA replication initiation factor; Provisional
Probab=96.49  E-value=0.0025  Score=39.27  Aligned_cols=19  Identities=16%  Similarity=0.204  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+|+..
T Consensus        46 ~~l~l~Gp~G~GKThLl~a   64 (235)
T PRK08084         46 GYIYLWSREGAGRSHLLHA   64 (235)
T ss_pred             CeEEEECCCCCCHHHHHHH
Confidence            3688999999999999974


No 313
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK.  ATP binding cassette (ABC) proteins function from bacteria to human, mediating the translocation of substances into and out of cells or organelles.  ABC transporters contain two transmembrane-spanning domains (TMDs) or subunits and two nucleotide binding domains (NBDs) or subunits that couple transport to the hydrolysis of ATP.  In the maltose transport system, the periplasmic maltose binding protein (MBP) stimulates the ATPase activity of the membrane-associated transporter, which consists of two transmembrane subunits, MalF and MalG, and two copies of the ATP binding subunit, MalK, and becomes tightly bound to the transporter in the catalytic transition state, ensuring that maltose is passed to the transporter as ATP is hydrolyzed.
Probab=96.49  E-value=0.0027  Score=38.09  Aligned_cols=18  Identities=28%  Similarity=0.414  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~l~G~nGsGKSTLl~~   45 (213)
T cd03301          28 FVVLLGPSGCGKTTTLRM   45 (213)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367999999999999974


No 314
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional
Probab=96.49  E-value=0.0026  Score=39.53  Aligned_cols=18  Identities=39%  Similarity=0.534  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        29 ~~~i~G~nGsGKSTLl~~   46 (255)
T PRK11248         29 LLVVLGPSGCGKTTLLNL   46 (255)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974


No 315
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional
Probab=96.48  E-value=0.0027  Score=39.69  Aligned_cols=18  Identities=33%  Similarity=0.490  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        40 ~~~I~G~NGsGKSTLlk~   57 (257)
T PRK11247         40 FVAVVGRSGCGKSTLLRL   57 (257)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974


No 316
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars. Members of this family play a wide variety of essential roles in nucleotide metabolism, the biosynthesis of coenzymes and aromatic compounds, as well as the metabolism of sugar and sulfate.
Probab=96.46  E-value=0.0033  Score=31.89  Aligned_cols=17  Identities=18%  Similarity=0.368  Sum_probs=15.1

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.+.|++|+|||++..+
T Consensus         2 i~i~G~~gsGKst~~~~   18 (69)
T cd02019           2 IAITGGSGSGKSTVAKK   18 (69)
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            57889999999999985


No 317
>PRK00098 GTPase RsgA; Reviewed
Probab=96.46  E-value=0.0025  Score=40.64  Aligned_cols=18  Identities=39%  Similarity=0.639  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++|||||||+..
T Consensus       166 ~~~~~G~sgvGKStlin~  183 (298)
T PRK00098        166 VTVLAGQSGVGKSTLLNA  183 (298)
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            578999999999999985


No 318
>PRK13949 shikimate kinase; Provisional
Probab=96.46  E-value=0.0029  Score=37.30  Aligned_cols=18  Identities=39%  Similarity=0.407  Sum_probs=16.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|+.|+|||++...
T Consensus         3 ~I~liG~~GsGKstl~~~   20 (169)
T PRK13949          3 RIFLVGYMGAGKTTLGKA   20 (169)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            799999999999999974


No 319
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=96.45  E-value=0.0029  Score=38.44  Aligned_cols=18  Identities=39%  Similarity=0.564  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~l~G~nGsGKSTLl~~   45 (230)
T TIGR03410        28 VTCVLGRNGVGKTTLLKT   45 (230)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578999999999999974


No 320
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport.  Other members of this system include the MetP permease and  the MetQ substrate binding protein.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.45  E-value=0.0029  Score=38.51  Aligned_cols=18  Identities=28%  Similarity=0.479  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        33 ~~~l~G~nGsGKSTLl~~   50 (233)
T cd03258          33 IFGIIGRSGAGKSTLIRC   50 (233)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 321
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  Pentoses include xylose, arabinose, and ribose.  Important hexoses include glucose, galactose, and fructose.  In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=96.45  E-value=0.003  Score=36.78  Aligned_cols=18  Identities=22%  Similarity=0.466  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~l~G~nGsGKSTLl~~   45 (163)
T cd03216          28 VHALLGENGAGKSTLMKI   45 (163)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 322
>PRK14532 adenylate kinase; Provisional
Probab=96.45  E-value=0.0029  Score=37.29  Aligned_cols=18  Identities=22%  Similarity=0.289  Sum_probs=16.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|+.|+|||++..+
T Consensus         2 ~i~~~G~pGsGKsT~a~~   19 (188)
T PRK14532          2 NLILFGPPAAGKGTQAKR   19 (188)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            689999999999999985


No 323
>PRK06526 transposase; Provisional
Probab=96.45  E-value=0.0023  Score=40.15  Aligned_cols=19  Identities=32%  Similarity=0.461  Sum_probs=17.0

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|++|+|||+|+..
T Consensus        99 ~nlll~Gp~GtGKThLa~a  117 (254)
T PRK06526         99 ENVVFLGPPGTGKTHLAIG  117 (254)
T ss_pred             ceEEEEeCCCCchHHHHHH
Confidence            4789999999999999874


No 324
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance.  Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis.  The synthesis of bacitracin is non-ribosomally catalyzed by a multienzyme complex BcrABC.  Bacitracin has potent antibiotic activity against gram-positive bacteria.  The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin.  The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC.  B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.
Probab=96.45  E-value=0.0026  Score=38.07  Aligned_cols=18  Identities=22%  Similarity=0.237  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKSTLl~~   45 (208)
T cd03268          28 IYGFLGPNGAGKTTTMKI   45 (208)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467899999999999974


No 325
>TIGR02881 spore_V_K stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group.
Probab=96.44  E-value=0.0032  Score=39.20  Aligned_cols=21  Identities=19%  Similarity=0.414  Sum_probs=18.1

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....+++.|++|+|||+++..
T Consensus        41 ~~~~vll~GppGtGKTtlA~~   61 (261)
T TIGR02881        41 QVLHMIFKGNPGTGKTTVARI   61 (261)
T ss_pred             CcceEEEEcCCCCCHHHHHHH
Confidence            346789999999999999964


No 326
>cd01131 PilT Pilus retraction ATPase PilT. PilT is a nucleotide binding protein responsible for the retraction of type IV pili, likely by pili disassembly. This retraction provides the force required for travel of bacteria in low water environments by a mechanism known as twitching motility.
Probab=96.44  E-value=0.0028  Score=38.09  Aligned_cols=17  Identities=35%  Similarity=0.561  Sum_probs=15.4

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +++.|++|+|||+++..
T Consensus         4 ilI~GptGSGKTTll~~   20 (198)
T cd01131           4 VLVTGPTGSGKSTTLAA   20 (198)
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            68899999999999974


No 327
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional
Probab=96.44  E-value=0.0029  Score=38.68  Aligned_cols=18  Identities=22%  Similarity=0.294  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        31 ~~~l~G~nGsGKSTLl~~   48 (241)
T PRK10895         31 IVGLLGPNGAGKTTTFYM   48 (241)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 328
>PRK10908 cell division protein FtsE; Provisional
Probab=96.44  E-value=0.003  Score=38.20  Aligned_cols=18  Identities=22%  Similarity=0.445  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        30 ~~~i~G~nGsGKSTLl~~   47 (222)
T PRK10908         30 MAFLTGHSGAGKSTLLKL   47 (222)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 329
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional
Probab=96.44  E-value=0.0023  Score=43.16  Aligned_cols=19  Identities=37%  Similarity=0.391  Sum_probs=16.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|++|+|||+++.+
T Consensus       224 ~vi~lvGptGvGKTTtaaK  242 (432)
T PRK12724        224 KVVFFVGPTGSGKTTSIAK  242 (432)
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            4578999999999999987


No 330
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional
Probab=96.43  E-value=0.003  Score=37.72  Aligned_cols=18  Identities=28%  Similarity=0.327  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        29 ~~~l~G~nGsGKSTLl~~   46 (200)
T PRK13540         29 LLHLKGSNGAGKTTLLKL   46 (200)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578999999999999973


No 331
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system. Members of this protein family are the ATP-binding subunit of an ABC transporter system that is associated with PQQ biosynthesis and PQQ-dependent alcohol dehydrogenases. While this family shows homology to several efflux ABC transporter subunits, the presence of a periplasmic substrate-binding protein and association with systems for catabolism of alcohols suggests a role in import rather than detoxification.
Probab=96.43  E-value=0.003  Score=38.56  Aligned_cols=18  Identities=22%  Similarity=0.416  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        29 ~~~i~G~nGsGKSTLl~~   46 (236)
T TIGR03864        29 FVALLGPNGAGKSTLFSL   46 (236)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 332
>PRK09087 hypothetical protein; Validated
Probab=96.42  E-value=0.0027  Score=39.11  Aligned_cols=18  Identities=33%  Similarity=0.453  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|++|+|||+|++.
T Consensus        46 ~l~l~G~~GsGKThLl~~   63 (226)
T PRK09087         46 VVVLAGPVGSGKTHLASI   63 (226)
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            378999999999999985


No 333
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters.  PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.42  E-value=0.0031  Score=37.87  Aligned_cols=18  Identities=28%  Similarity=0.427  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        35 ~~~i~G~nGsGKSTLl~~   52 (202)
T cd03233          35 MVLVLGRPGSGCSTLLKA   52 (202)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973


No 334
>COG0218 Predicted GTPase [General function prediction only]
Probab=96.42  E-value=0.0032  Score=38.64  Aligned_cols=24  Identities=38%  Similarity=0.623  Sum_probs=20.1

Q ss_pred             CCceeeEEEEECCCCChHHHHHhH
Q psy15257          8 PHQELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus         8 ~~~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      +.+....|+++|.|.|||||++..
T Consensus        20 P~~~~~EIaF~GRSNVGKSSlIN~   43 (200)
T COG0218          20 PEDDLPEIAFAGRSNVGKSSLINA   43 (200)
T ss_pred             CCCCCcEEEEEccCcccHHHHHHH
Confidence            334557899999999999999985


No 335
>PRK08181 transposase; Validated
Probab=96.41  E-value=0.0025  Score=40.42  Aligned_cols=19  Identities=26%  Similarity=0.427  Sum_probs=17.0

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+|+..
T Consensus       107 ~nlll~Gp~GtGKTHLa~A  125 (269)
T PRK08181        107 ANLLLFGPPGGGKSHLAAA  125 (269)
T ss_pred             ceEEEEecCCCcHHHHHHH
Confidence            4699999999999999975


No 336
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea.  Only very few species lack representatives of the siderophore family transporters.  The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake.  The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA.  The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme.  A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.
Probab=96.41  E-value=0.0033  Score=37.05  Aligned_cols=18  Identities=22%  Similarity=0.412  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        27 ~~~l~G~nGsGKStLl~~   44 (180)
T cd03214          27 IVGILGPNGAGKSTLLKT   44 (180)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            577999999999999973


No 337
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.41  E-value=0.0031  Score=37.93  Aligned_cols=19  Identities=21%  Similarity=0.359  Sum_probs=16.4

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.+.++|++|+|||+|+.-
T Consensus        24 e~~~i~G~nGsGKSTLl~~   42 (214)
T cd03297          24 EVTGIFGASGAGKSTLLRC   42 (214)
T ss_pred             eeEEEECCCCCCHHHHHHH
Confidence            3578999999999999974


No 338
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor.  The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=96.41  E-value=0.0031  Score=39.17  Aligned_cols=18  Identities=28%  Similarity=0.434  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        27 ~~~i~G~NGsGKSTLlk~   44 (246)
T cd03237          27 VIGILGPNGIGKTTFIKM   44 (246)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973


No 339
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.41  E-value=0.0033  Score=36.96  Aligned_cols=18  Identities=22%  Similarity=0.458  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+..
T Consensus        28 ~~~i~G~nGsGKSTLl~~   45 (178)
T cd03229          28 IVALLGPSGSGKSTLLRC   45 (178)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 340
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA. This model describes the cyt c biogenesis protein encoded by ccmA in bacteria. An exception is, an arabidopsis protein. Quite likely this is encoded by an organelle. Bacterial c-type cytocromes are located on the periplasmic side of the cytoplasmic membrane. Several gene products encoded in a locus designated as 'ccm' are implicated in the transport and assembly of the functional cytochrome C. This cluster includes genes: ccmA;B;C;D;E;F;G and H. The posttranslational pathway includes the transport of heme moiety, the secretion of the apoprotein and the covalent attachment of the heme with the apoprotein. The proteins ccmA and B represent an ABC transporter; ccmC and D participate in heme transfer to ccmE, which function as a periplasmic heme chaperone. The presence of ccmF, G and H is suggested to be obligatory for the final functional assembly of cytochrome c.
Probab=96.40  E-value=0.0033  Score=37.47  Aligned_cols=18  Identities=33%  Similarity=0.481  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKSTLl~~   45 (198)
T TIGR01189        28 ALQVTGPNGIGKTTLLRI   45 (198)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477999999999999974


No 341
>PRK08903 DnaA regulatory inactivator Hda; Validated
Probab=96.40  E-value=0.0028  Score=38.45  Aligned_cols=18  Identities=22%  Similarity=0.401  Sum_probs=16.2

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|++|+|||+|+..
T Consensus        44 ~~~l~G~~G~GKT~La~a   61 (227)
T PRK08903         44 FFYLWGEAGSGRSHLLQA   61 (227)
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            578999999999999975


No 342
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import.  Responsible for energy coupling to the transport system.  The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.40  E-value=0.0032  Score=38.52  Aligned_cols=18  Identities=28%  Similarity=0.446  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        30 ~~~i~G~nGsGKSTLl~~   47 (239)
T cd03296          30 LVALLGPSGSGKTTLLRL   47 (239)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367999999999999974


No 343
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP.  Probably responsible for the translocation of thiamine across the membrane. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.40  E-value=0.0033  Score=37.72  Aligned_cols=18  Identities=28%  Similarity=0.479  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        26 ~~~l~G~nGsGKSTLl~~   43 (211)
T cd03298          26 ITAIVGPSGSGKSTLLNL   43 (211)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999973


No 344
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity.  In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins.  Eukaryote systems of the ABCA subfamily display ABC domains that are quite similar to this family.  The ATP-binding domain shows the highest similarity between all members of the ABC transporter family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.39  E-value=0.0035  Score=36.73  Aligned_cols=18  Identities=33%  Similarity=0.394  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKStLl~~   45 (173)
T cd03230          28 IYGLLGPNGAGKTTLIKI   45 (173)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477999999999999973


No 345
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.38  E-value=0.0032  Score=39.30  Aligned_cols=18  Identities=28%  Similarity=0.407  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        29 ~~~i~G~nGsGKSTLl~~   46 (271)
T PRK13638         29 VTGLVGANGCGKSTLFMN   46 (271)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477999999999999973


No 346
>PRK14242 phosphate transporter ATP-binding protein; Provisional
Probab=96.38  E-value=0.0033  Score=38.71  Aligned_cols=18  Identities=17%  Similarity=0.462  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        34 ~~~i~G~nGsGKSTLl~~   51 (253)
T PRK14242         34 VTALIGPSGCGKSTFLRC   51 (253)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 347
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional
Probab=96.38  E-value=0.0034  Score=37.38  Aligned_cols=18  Identities=22%  Similarity=0.372  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~l~G~nGsGKSTLl~~   45 (195)
T PRK13541         28 ITYIKGANGCGKSSLLRM   45 (195)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            568999999999999974


No 348
>cd01120 RecA-like_NTPases RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.
Probab=96.38  E-value=0.0032  Score=35.32  Aligned_cols=17  Identities=41%  Similarity=0.505  Sum_probs=15.2

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +++.|++|+|||+++..
T Consensus         2 ~~i~G~~G~GKT~l~~~   18 (165)
T cd01120           2 ILVFGPTGSGKTTLALQ   18 (165)
T ss_pred             eeEeCCCCCCHHHHHHH
Confidence            57889999999999975


No 349
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=96.38  E-value=0.0029  Score=38.65  Aligned_cols=18  Identities=39%  Similarity=0.608  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++|++|+|||+|+..
T Consensus        25 ~~~i~GpNGsGKStll~a   42 (243)
T cd03272          25 HNVVVGRNGSGKSNFFAA   42 (243)
T ss_pred             cEEEECCCCCCHHHHHHH
Confidence            457889999999999975


No 350
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional
Probab=96.38  E-value=0.0034  Score=38.08  Aligned_cols=18  Identities=22%  Similarity=0.591  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        38 ~~~i~G~nGsGKSTLl~~   55 (228)
T PRK10584         38 TIALIGESGSGKSTLLAI   55 (228)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974


No 351
>PRK02496 adk adenylate kinase; Provisional
Probab=96.38  E-value=0.004  Score=36.65  Aligned_cols=19  Identities=16%  Similarity=0.335  Sum_probs=17.0

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++++|++|+|||++...
T Consensus         2 ~~i~i~G~pGsGKst~a~~   20 (184)
T PRK02496          2 TRLIFLGPPGAGKGTQAVV   20 (184)
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            5799999999999999874


No 352
>PRK08233 hypothetical protein; Provisional
Probab=96.38  E-value=0.0041  Score=36.11  Aligned_cols=19  Identities=21%  Similarity=0.116  Sum_probs=16.5

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      +-|.+.|.+|+|||+++.+
T Consensus         4 ~iI~I~G~~GsGKtTla~~   22 (182)
T PRK08233          4 KIITIAAVSGGGKTTLTER   22 (182)
T ss_pred             eEEEEECCCCCCHHHHHHH
Confidence            5677889999999999985


No 353
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional
Probab=96.37  E-value=0.0034  Score=38.45  Aligned_cols=18  Identities=28%  Similarity=0.545  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        30 ~~~i~G~nGsGKSTLl~~   47 (242)
T PRK11124         30 TLVLLGPSGAGKSSLLRV   47 (242)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974


No 354
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional
Probab=96.37  E-value=0.0034  Score=38.17  Aligned_cols=18  Identities=22%  Similarity=0.390  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        35 ~~~i~G~nGsGKSTLl~~   52 (225)
T PRK10247         35 FKLITGPSGCGKSTLLKI   52 (225)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            468999999999999973


No 355
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK. Members of this family are the PhnK protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated complex. This protein (PhnK) and the adjacent-encoded PhnL resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this complex rather than part of a transporter per se.
Probab=96.37  E-value=0.0033  Score=38.69  Aligned_cols=18  Identities=28%  Similarity=0.495  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        31 ~~~i~G~nGsGKSTLl~~   48 (253)
T TIGR02323        31 VLGIVGESGSGKSTLLGC   48 (253)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999973


No 356
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function.  Barmotin belongs to the SMC protein family.  SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, w
Probab=96.37  E-value=0.003  Score=38.02  Aligned_cols=18  Identities=33%  Similarity=0.510  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+..
T Consensus        24 ~~~i~G~nGsGKStll~a   41 (197)
T cd03278          24 LTAIVGPNGSGKSNIIDA   41 (197)
T ss_pred             cEEEECCCCCCHHHHHHH
Confidence            467899999999999975


No 357
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=96.37  E-value=0.0032  Score=38.92  Aligned_cols=18  Identities=22%  Similarity=0.318  Sum_probs=15.4

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++|++|+|||+|+..
T Consensus        27 ~~~IvG~NGsGKStll~A   44 (251)
T cd03273          27 FNAITGLNGSGKSNILDA   44 (251)
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            356889999999999975


No 358
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters. PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.37  E-value=0.0035  Score=37.30  Aligned_cols=18  Identities=28%  Similarity=0.521  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        35 ~~~l~G~nGsGKSTLl~~   52 (192)
T cd03232          35 LTALMGESGAGKTTLLDV   52 (192)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 359
>PRK08727 hypothetical protein; Validated
Probab=96.36  E-value=0.0031  Score=38.87  Aligned_cols=17  Identities=35%  Similarity=0.436  Sum_probs=15.8

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +++.|++|+|||+|+..
T Consensus        44 l~l~G~~G~GKThL~~a   60 (233)
T PRK08727         44 LYLSGPAGTGKTHLALA   60 (233)
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            88999999999999975


No 360
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional
Probab=96.36  E-value=0.0035  Score=38.56  Aligned_cols=18  Identities=22%  Similarity=0.438  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        31 ~~~i~G~nGsGKSTLl~~   48 (250)
T PRK14247         31 ITALMGPSGSGKSTLLRV   48 (250)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 361
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism]
Probab=96.36  E-value=0.0029  Score=38.57  Aligned_cols=18  Identities=28%  Similarity=0.545  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++||+|.|||+|++-
T Consensus        30 tlvllgpsgagkssllr~   47 (242)
T COG4161          30 TLVLLGPSGAGKSSLLRV   47 (242)
T ss_pred             EEEEECCCCCchHHHHHH
Confidence            478999999999999963


No 362
>cd01849 YlqF_related_GTPase YlqF-related GTPases.  These proteins are found in bacteria, eukaryotes, and archaea.  They all exhibit a circular permutation of the GTPase signature motifs so that the order of the conserved G box motifs is G4-G5-G1-G2-G3, with G4 and G5 being permuted from the C-terminal region of proteins in the Ras superfamily to the N-terminus of YlqF-related GTPases.
Probab=96.36  E-value=0.01  Score=34.14  Aligned_cols=21  Identities=33%  Similarity=0.477  Sum_probs=18.1

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....++++|.++||||+++..
T Consensus        99 ~~~~~~~~G~~~~GKstlin~  119 (155)
T cd01849          99 KSITVGVIGYPNVGKSSVINA  119 (155)
T ss_pred             cCcEEEEEccCCCCHHHHHHH
Confidence            346789999999999999984


No 363
>PRK05642 DNA replication initiation factor; Validated
Probab=96.35  E-value=0.0031  Score=38.91  Aligned_cols=19  Identities=26%  Similarity=0.407  Sum_probs=16.1

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.+++.|++|+|||+|+..
T Consensus        46 ~~l~l~G~~G~GKTHLl~a   64 (234)
T PRK05642         46 SLIYLWGKDGVGRSHLLQA   64 (234)
T ss_pred             CeEEEECCCCCCHHHHHHH
Confidence            3567889999999999874


No 364
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional
Probab=96.35  E-value=0.0036  Score=37.51  Aligned_cols=18  Identities=28%  Similarity=0.381  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        29 ~~~l~G~nGsGKSTLl~~   46 (204)
T PRK13538         29 LVQIEGPNGAGKTSLLRI   46 (204)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            468999999999999973


No 365
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional
Probab=96.35  E-value=0.0036  Score=37.63  Aligned_cols=18  Identities=33%  Similarity=0.458  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        30 ~~~i~G~nGsGKSTLl~~   47 (207)
T PRK13539         30 ALVLTGPNGSGKTTLLRL   47 (207)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973


No 366
>PRK00093 GTP-binding protein Der; Reviewed
Probab=96.35  E-value=0.015  Score=38.45  Aligned_cols=21  Identities=43%  Similarity=0.667  Sum_probs=19.3

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.++|.+++|||||+.+
T Consensus       172 ~~~~v~ivG~~n~GKStlin~  192 (435)
T PRK00093        172 EPIKIAIIGRPNVGKSSLINA  192 (435)
T ss_pred             cceEEEEECCCCCCHHHHHHH
Confidence            468999999999999999986


No 367
>TIGR00475 selB selenocysteine-specific elongation factor SelB. In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor. 3-prime or 5-prime non-coding elements of mRNA have been found as probable structures for directing selenocysteine incorporation. This model describes the elongation factor SelB, a close homolog rf EF-Tu. It may function by replacing EF-Tu. A C-terminal domain not found in EF-Tu is in all SelB sequences in the seed alignment except that from Methanococcus jannaschii. This model does not find an equivalent protein for eukaryotes.
Probab=96.35  E-value=0.008  Score=41.69  Aligned_cols=18  Identities=33%  Similarity=0.375  Sum_probs=16.5

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .|.++|..++|||||+.+
T Consensus         2 ~I~iiG~~d~GKTTLi~a   19 (581)
T TIGR00475         2 IIATAGHVDHGKTTLLKA   19 (581)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578999999999999996


No 368
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]
Probab=96.35  E-value=0.0064  Score=36.59  Aligned_cols=21  Identities=33%  Similarity=0.498  Sum_probs=19.1

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...|+.+-|+.|||||+++.+
T Consensus         4 ~~mki~ITG~PGvGKtTl~~k   24 (179)
T COG1618           4 MAMKIFITGRPGVGKTTLVLK   24 (179)
T ss_pred             cceEEEEeCCCCccHHHHHHH
Confidence            457999999999999999987


No 369
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein.  In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor.  This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export.  The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.35  E-value=0.0036  Score=37.93  Aligned_cols=18  Identities=44%  Similarity=0.608  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        31 ~~~i~G~nGsGKSTLl~~   48 (229)
T cd03254          31 TVAIVGPTGAGKTTLINL   48 (229)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            368999999999999974


No 370
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB.  This alignment contains the C-terminal domain, which is the ATPase.
Probab=96.34  E-value=0.0037  Score=37.13  Aligned_cols=19  Identities=37%  Similarity=0.529  Sum_probs=16.7

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|++|+|||+++..
T Consensus        26 ~~i~I~G~tGSGKTTll~a   44 (186)
T cd01130          26 KNILISGGTGSGKTTLLNA   44 (186)
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            4689999999999999974


No 371
>PRK14974 cell division protein FtsY; Provisional
Probab=96.34  E-value=0.0032  Score=41.11  Aligned_cols=20  Identities=40%  Similarity=0.414  Sum_probs=17.6

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...++++|++|+|||+++.+
T Consensus       140 ~~vi~~~G~~GvGKTTtiak  159 (336)
T PRK14974        140 PVVIVFVGVNGTGKTTTIAK  159 (336)
T ss_pred             CeEEEEEcCCCCCHHHHHHH
Confidence            46789999999999998875


No 372
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3. cereus E33L, Hahella chejuensis KCTC 2396, Pseudoalteromonas haloplanktis TAC12, and Escherichia coli B7A.
Probab=96.34  E-value=0.0029  Score=43.39  Aligned_cols=17  Identities=18%  Similarity=0.438  Sum_probs=15.5

Q ss_pred             EEEEECCCCChHHHHHh
Q psy15257         14 KCVVVGDTAVGKTRLIC   30 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~   30 (65)
                      -+.++|++|+|||+|+.
T Consensus        34 iv~L~G~SGsGKSTLLr   50 (504)
T TIGR03238        34 LLFLCGSSGDGKSEILA   50 (504)
T ss_pred             EEEEECCCCCCHHHHHh
Confidence            47899999999999997


No 373
>PRK06620 hypothetical protein; Validated
Probab=96.34  E-value=0.0032  Score=38.51  Aligned_cols=19  Identities=26%  Similarity=0.347  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+++.|++|+|||+|+..
T Consensus        45 ~~l~l~Gp~G~GKThLl~a   63 (214)
T PRK06620         45 FTLLIKGPSSSGKTYLTKI   63 (214)
T ss_pred             ceEEEECCCCCCHHHHHHH
Confidence            3578999999999999974


No 374
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis.  The CydC and CydD proteins are important for the formation of cytochrome bd terminal oxidase of E. coli and it has been proposed that they were necessary for biosynthesis of the cytochrome bd quinol oxidase and for periplasmic c-type cytochromes.  CydCD were proposed to determine a heterooligomeric complex important for heme export into the periplasm or to be involved in the maintenance of the proper redox state of the periplasmic space.  In Bacillus subtilius, the absence of CydCD does not affect the presence of halo-cytochrome c in the membrane and this observation suggests that CydCD proteins are not involved in the export of heme in this organism.
Probab=96.34  E-value=0.0038  Score=36.65  Aligned_cols=18  Identities=28%  Similarity=0.508  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        30 ~~~i~G~nGsGKStLl~~   47 (178)
T cd03247          30 KIALLGRSGSGKSTLLQL   47 (178)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 375
>PRK13851 type IV secretion system protein VirB11; Provisional
Probab=96.34  E-value=0.0041  Score=40.76  Aligned_cols=20  Identities=25%  Similarity=0.355  Sum_probs=17.9

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++.|++|+|||+++..
T Consensus       162 ~~nilI~G~tGSGKTTll~a  181 (344)
T PRK13851        162 RLTMLLCGPTGSGKTTMSKT  181 (344)
T ss_pred             CCeEEEECCCCccHHHHHHH
Confidence            46799999999999999975


No 376
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome.  The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation.  To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes.  X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family.  The disease is characterized by a striking and unpredictable variation in phenotypic expression.  Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asympt
Probab=96.33  E-value=0.0039  Score=36.41  Aligned_cols=18  Identities=28%  Similarity=0.562  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        29 ~~~i~G~nGsGKSTLl~~   46 (166)
T cd03223          29 RLLITGPSGTGKSSLFRA   46 (166)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974


No 377
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism]
Probab=96.33  E-value=0.0079  Score=37.35  Aligned_cols=22  Identities=18%  Similarity=0.342  Sum_probs=18.2

Q ss_pred             ceeeEEEEECCCCChHHHHHhH
Q psy15257         10 QELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+-|-+-|++|+|||+++.+
T Consensus         6 ~~~iiIgIaG~SgSGKTTva~~   27 (218)
T COG0572           6 EKVIIIGIAGGSGSGKTTVAKE   27 (218)
T ss_pred             CceEEEEEeCCCCCCHHHHHHH
Confidence            4456778889999999999985


No 378
>PRK14239 phosphate transporter ATP-binding protein; Provisional
Probab=96.32  E-value=0.0037  Score=38.42  Aligned_cols=18  Identities=22%  Similarity=0.484  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        33 ~~~i~G~nGsGKSTLl~~   50 (252)
T PRK14239         33 ITALIGPSGSGKSTLLRS   50 (252)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999973


No 379
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D. This model describes the ATP binding subunits of nitrate transport in bacteria and archaea. This protein belongs to the ATP-binding cassette (ABC) superfamily. It is thought that the two subunits encoded by ntrC and ntrD form the binding surface for interaction with ATP. This model is restricted in identifying ATP binding subunit associated with the nitrate transport. Nitrate assimilation is aided by other proteins derived from the operon which among others include products of ntrA - a regulatory protein; ntrB - a hydropbobic transmembrane permease and narB - a reductase.
Probab=96.32  E-value=0.0038  Score=38.14  Aligned_cols=18  Identities=22%  Similarity=0.434  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        13 ~~~i~G~nGsGKSTLl~~   30 (230)
T TIGR01184        13 FISLIGHSGCGKSTLLNL   30 (230)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578999999999999973


No 380
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism]
Probab=96.32  E-value=0.004  Score=39.45  Aligned_cols=18  Identities=33%  Similarity=0.562  Sum_probs=16.1

Q ss_pred             eEEEEECCCCChHHHHHh
Q psy15257         13 VKCVVVGDTAVGKTRLIC   30 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~   30 (65)
                      -+.+++|++|.|||+|+.
T Consensus        58 e~W~I~G~NGsGKTTLL~   75 (257)
T COG1119          58 EHWAIVGPNGAGKTTLLS   75 (257)
T ss_pred             CcEEEECCCCCCHHHHHH
Confidence            357899999999999997


No 381
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E. coli.  The hemolysin A (HlyA) transport machinery is composed of the ATP-binding cassette (ABC) transporter HlyB located in the inner membrane, hemolysin D (HlyD), also anchored in the inner membrane, and TolC, which resides in the outer membrane.  HlyD apparently forms a continuous channel that bridges the entire periplasm, interacting with TolC and HlyB.  This arrangement prevents the appearance of periplasmic intermediates of HlyA during substrate transport.  Little is known about the molecular details of HlyA transport, but it is evident that ATP-hydrolysis by the ABC-transporter HlyB is a necessary source of energy.
Probab=96.32  E-value=0.0038  Score=38.06  Aligned_cols=18  Identities=28%  Similarity=0.359  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        30 ~~~i~G~nGsGKSTLl~~   47 (237)
T cd03252          30 VVGIVGRSGSGKSTLTKL   47 (237)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974


No 382
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  In members of Carb_Monos family the single hydrophobic gene product forms a homodimer, while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=96.32  E-value=0.0039  Score=36.76  Aligned_cols=18  Identities=28%  Similarity=0.230  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKSTLl~~   45 (182)
T cd03215          28 IVGIAGLVGNGQTELAEA   45 (182)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            468999999999999973


No 383
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.32  E-value=0.0037  Score=39.16  Aligned_cols=18  Identities=22%  Similarity=0.418  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        35 ~~~l~G~nGsGKSTLl~~   52 (280)
T PRK13649         35 YTAFIGHTGSGKSTIMQL   52 (280)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367999999999999973


No 384
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional
Probab=96.31  E-value=0.0038  Score=38.51  Aligned_cols=18  Identities=17%  Similarity=0.457  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        35 ~~~i~G~nGsGKSTLl~~   52 (254)
T PRK14273         35 ITALIGPSGCGKSTFLRT   52 (254)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 385
>cd01854 YjeQ_engC YjeQ/EngC.  YjeQ (YloQ in Bacillus subtilis) represents a protein family whose members are broadly conserved in bacteria and have been shown to be essential to the growth of E. coli and B. subtilis. Proteins of the YjeQ family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases. All YjeQ family proteins display a unique domain architecture, which includes an N-terminal OB-fold RNA-binding domain, the central permuted GTPase domain, and a zinc knuckle-like C-terminal cysteine domain. This domain architecture suggests a role for YjeQ as a regulator of translation.
Probab=96.31  E-value=0.0039  Score=39.58  Aligned_cols=19  Identities=47%  Similarity=0.697  Sum_probs=16.9

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|++|+|||||+..
T Consensus       162 k~~~~~G~sg~GKSTlin~  180 (287)
T cd01854         162 KTSVLVGQSGVGKSTLINA  180 (287)
T ss_pred             ceEEEECCCCCCHHHHHHH
Confidence            4688999999999999985


No 386
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional
Probab=96.31  E-value=0.0039  Score=38.30  Aligned_cols=18  Identities=28%  Similarity=0.532  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        31 ~~~i~G~nGsGKSTLl~~   48 (250)
T PRK11264         31 VVAIIGPSGSGKTTLLRC   48 (250)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 387
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional
Probab=96.31  E-value=0.0033  Score=41.14  Aligned_cols=17  Identities=35%  Similarity=0.597  Sum_probs=15.3

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.++|++|+|||+|+.-
T Consensus        33 ~~llG~sGsGKSTLLr~   49 (356)
T PRK11650         33 IVLVGPSGCGKSTLLRM   49 (356)
T ss_pred             EEEECCCCCcHHHHHHH
Confidence            67999999999999974


No 388
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional
Probab=96.30  E-value=0.0033  Score=41.08  Aligned_cols=18  Identities=22%  Similarity=0.434  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        34 ~~~llGpsGsGKSTLLr~   51 (351)
T PRK11432         34 MVTLLGPSGCGKTTVLRL   51 (351)
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            368899999999999973


No 389
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional
Probab=96.30  E-value=0.0035  Score=38.62  Aligned_cols=18  Identities=22%  Similarity=0.468  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        32 ~~~l~G~nGsGKSTLl~~   49 (253)
T PRK14267         32 VFALMGPSGCGKSTLLRT   49 (253)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367999999999999974


No 390
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]
Probab=96.30  E-value=0.0034  Score=43.46  Aligned_cols=19  Identities=26%  Similarity=0.490  Sum_probs=17.2

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -|+.++|.+|+|||+++.-
T Consensus       365 EkvAIlG~SGsGKSTllqL  383 (573)
T COG4987         365 EKVAILGRSGSGKSTLLQL  383 (573)
T ss_pred             CeEEEECCCCCCHHHHHHH
Confidence            5799999999999999973


No 391
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment.  ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.30  E-value=0.004  Score=38.17  Aligned_cols=18  Identities=28%  Similarity=0.375  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        29 ~~~i~G~nGsGKSTLl~~   46 (242)
T cd03295          29 FLVLIGPSGSGKTTTMKM   46 (242)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 392
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.29  E-value=0.0039  Score=39.32  Aligned_cols=18  Identities=33%  Similarity=0.505  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        39 ~~~l~G~nGsGKSTLl~~   56 (289)
T PRK13645         39 VTCVIGTTGSGKSTMIQL   56 (289)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477999999999999974


No 393
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters. Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2.  A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane.
Probab=96.29  E-value=0.0041  Score=37.48  Aligned_cols=18  Identities=28%  Similarity=0.541  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        32 ~~~i~G~nGsGKSTLl~~   49 (220)
T cd03245          32 KVAIIGRVGSGKSTLLKL   49 (220)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 394
>PRK06547 hypothetical protein; Provisional
Probab=96.29  E-value=0.005  Score=36.58  Aligned_cols=21  Identities=29%  Similarity=0.480  Sum_probs=17.7

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....+.+.|++|+|||++...
T Consensus        14 ~~~~i~i~G~~GsGKTt~a~~   34 (172)
T PRK06547         14 GMITVLIDGRSGSGKTTLAGA   34 (172)
T ss_pred             CCEEEEEECCCCCCHHHHHHH
Confidence            346788889999999999975


No 395
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional
Probab=96.28  E-value=0.0041  Score=38.20  Aligned_cols=18  Identities=33%  Similarity=0.501  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        31 ~~~i~G~nGsGKSTLl~~   48 (241)
T PRK14250         31 IYTIVGPSGAGKSTLIKL   48 (241)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 396
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form slid
Probab=96.28  E-value=0.0036  Score=37.83  Aligned_cols=18  Identities=17%  Similarity=0.425  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++|+|||+++..
T Consensus        27 ~~~ltGpNg~GKSTllr~   44 (199)
T cd03283          27 GILITGSNMSGKSTFLRT   44 (199)
T ss_pred             EEEEECCCCCChHHHHHH
Confidence            468899999999999964


No 397
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain.  They export degradative enzymes by using a type I protein secretion system and  lack an N-terminal signal peptide, but contain a C-terminal secretion signal.  The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP).  For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli.  The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior.  HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels.  The spectrum of transport substra
Probab=96.28  E-value=0.0043  Score=36.34  Aligned_cols=18  Identities=22%  Similarity=0.421  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        30 ~~~i~G~nGsGKStLl~~   47 (173)
T cd03246          30 SLAIIGPSGSGKSTLARL   47 (173)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367999999999999974


No 398
>PF00910 RNA_helicase:  RNA helicase;  InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5). All of the proteins bind ATP and, consequently, all of them carry the classical Walker A (phosphate-binding loop or P-loop) and Walker B (Mg2+-binding aspartic acid) motifs. Superfamily 3 consists of helicases encoded mainly by small DNA viruses and some large nucleocytoplasmic DNA viruses [, ]. Small viruses are very dependent on the host-cell machinery to replicate. SF3 helicase in small viruses is associated with an origin-binding domain. By pairing a domain that recognises the ori with a helicase, the virus can bypass the host-cell-based regulation pathway and initiate its own replication. The protein binds to the viral ori leading to origin unwinding. Cellular replication proteins are then recruited to the ori and the viral DNA is replicated. In SF3 helicases the Walker A and Walker B motifs are separated by spacers of rather uniform, and relatively short, length. In addition to the A and B motifs this family is characterised by a third motif (C) which resides between the B motif and the C terminus of the conserved region. This motif consists of an Asn residue preceded by a run of hydrophobic residues []. Several structures of SF3 helicases have been solved []. They all possess the same core alpha/beta fold, consisting of a five-stranded parallel beta sheet flanked on both sides by several alpha helices. In contrast to SF1 and SF2 helicases, which have RecA-like core folds, the strand connectivity within the alpha/beta core domain is that of AAA+ proteins []. The SF3 helicase proteins assemble into a hexameric ring. Some proteins known to contain an SF3 helicase domain are listed below:  Polyomavirus large T antigen. It initiates DNA unwinding and replication via interactions with the viral origin of replication. Papillomavirus E1 protein. An ATP-dependent DNA helicase required for initiation of viral DNA replication. Parvovirus Rep/NS1 protein, which is also required for the initiation of viral replication. Poxviridae and other large DNA viruses D5 protein. Bacteriophage DNA primase/helicase protein. Bacterial prophage DNA primase/helicase protein.   The entry represents the core alpha/beta fold of the SF3 helicase domain found predominantly in DNA viruses.; GO: 0003723 RNA binding, 0003724 RNA helicase activity
Probab=96.28  E-value=0.0032  Score=34.41  Aligned_cols=17  Identities=24%  Similarity=0.382  Sum_probs=14.8

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      |.+-|++|+|||.++..
T Consensus         1 I~i~G~~G~GKS~l~~~   17 (107)
T PF00910_consen    1 IWIYGPPGIGKSTLAKE   17 (107)
T ss_pred             CEEECCCCCCHHHHHHH
Confidence            46789999999999985


No 399
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=96.28  E-value=0.0034  Score=42.84  Aligned_cols=19  Identities=32%  Similarity=0.358  Sum_probs=17.0

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+.++|++|||||+++.+
T Consensus       257 ~Vi~LvGpnGvGKTTTiaK  275 (484)
T PRK06995        257 GVFALMGPTGVGKTTTTAK  275 (484)
T ss_pred             cEEEEECCCCccHHHHHHH
Confidence            4678999999999999986


No 400
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional
Probab=96.28  E-value=0.0041  Score=38.47  Aligned_cols=18  Identities=28%  Similarity=0.361  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        31 ~~~l~G~nGsGKSTLl~~   48 (254)
T PRK10418         31 VLALVGGSGSGKSLTCAA   48 (254)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974


No 401
>cd03221 ABCF_EF-3 ABCF_EF-3  Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth.  EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site.  The reaction requires ATP hydrolysis.  EF-3 contains two ATP nucleotide binding sequence (NBS) motifs.  NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.
Probab=96.27  E-value=0.004  Score=35.68  Aligned_cols=18  Identities=28%  Similarity=0.460  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKStLl~~   45 (144)
T cd03221          28 RIGLVGRNGAGKSTLLKL   45 (144)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367899999999999973


No 402
>CHL00131 ycf16 sulfate ABC transporter protein; Validated
Probab=96.27  E-value=0.0042  Score=38.20  Aligned_cols=17  Identities=24%  Similarity=0.350  Sum_probs=15.5

Q ss_pred             EEEEECCCCChHHHHHh
Q psy15257         14 KCVVVGDTAVGKTRLIC   30 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~   30 (65)
                      .+.++|++|+|||+|+.
T Consensus        35 ~~~i~G~nGsGKSTLl~   51 (252)
T CHL00131         35 IHAIMGPNGSGKSTLSK   51 (252)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            57799999999999997


No 403
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein.
Probab=96.27  E-value=0.0042  Score=38.07  Aligned_cols=18  Identities=22%  Similarity=0.276  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        49 ~~~i~G~NGsGKSTLl~~   66 (236)
T cd03267          49 IVGFIGPNGAGKTTTLKI   66 (236)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            468999999999999973


No 404
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional
Probab=96.27  E-value=0.0041  Score=38.50  Aligned_cols=18  Identities=22%  Similarity=0.499  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        40 ~~~l~G~nGsGKSTLl~~   57 (259)
T PRK14274         40 VTAIIGPSGCGKSTFIKT   57 (259)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 405
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=96.27  E-value=0.0034  Score=38.44  Aligned_cols=16  Identities=31%  Similarity=0.488  Sum_probs=14.4

Q ss_pred             EEEEECCCCChHHHHH
Q psy15257         14 KCVVVGDTAVGKTRLI   29 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~   29 (65)
                      -+.++|++|+|||+|+
T Consensus        23 ~~~l~G~sGsGKSTL~   38 (226)
T cd03270          23 LVVITGVSGSGKSSLA   38 (226)
T ss_pred             EEEEEcCCCCCHHHHH
Confidence            4678999999999997


No 406
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional
Probab=96.27  E-value=0.0042  Score=38.55  Aligned_cols=18  Identities=22%  Similarity=0.469  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        41 ~~~i~G~nGsGKSTLl~~   58 (260)
T PRK10744         41 VTAFIGPSGCGKSTLLRT   58 (260)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 407
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional
Probab=96.26  E-value=0.0041  Score=37.55  Aligned_cols=18  Identities=39%  Similarity=0.575  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        39 ~~~i~G~nGsGKSTLl~~   56 (214)
T PRK13543         39 ALLVQGDNGAGKTTLLRV   56 (214)
T ss_pred             EEEEEcCCCCCHHHHHHH
Confidence            467999999999999974


No 408
>TIGR01425 SRP54_euk signal recognition particle protein SRP54. This model represents examples from the eukaryotic cytosol of the signal recognition particle protein component, SRP54. This GTP-binding protein is a component of the eukaryotic signal recognition particle, along with several other protein subunits and a 7S RNA. Some species, including Arabidopsis, have several closely related forms. The extreme C-terminal region is glycine-rich and lower in complexity, poorly conserved between species, and excluded from this model.
Probab=96.26  E-value=0.0037  Score=42.11  Aligned_cols=20  Identities=25%  Similarity=0.159  Sum_probs=17.5

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+.++|.+|+|||+++.+
T Consensus       100 ~~vi~lvG~~GvGKTTtaaK  119 (429)
T TIGR01425       100 QNVIMFVGLQGSGKTTTCTK  119 (429)
T ss_pred             CeEEEEECCCCCCHHHHHHH
Confidence            35688999999999999986


No 409
>PRK14241 phosphate transporter ATP-binding protein; Provisional
Probab=96.26  E-value=0.0042  Score=38.45  Aligned_cols=18  Identities=17%  Similarity=0.429  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        32 ~~~i~G~nGsGKSTLl~~   49 (258)
T PRK14241         32 VTAFIGPSGCGKSTVLRT   49 (258)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 410
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=96.26  E-value=0.0042  Score=37.95  Aligned_cols=18  Identities=28%  Similarity=0.493  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        30 ~~~l~G~nGsGKSTLl~~   47 (242)
T TIGR03411        30 LRVIIGPNGAGKTTMMDV   47 (242)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973


No 411
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional
Probab=96.26  E-value=0.0043  Score=38.16  Aligned_cols=18  Identities=28%  Similarity=0.545  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        31 ~~~i~G~nGsGKSTLl~~   48 (250)
T PRK14262         31 ITAIIGPSGCGKTTLLRS   48 (250)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477999999999999974


No 412
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion]
Probab=96.26  E-value=0.0025  Score=41.83  Aligned_cols=44  Identities=23%  Similarity=0.190  Sum_probs=28.7

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhccccccccccccccceEEEEeeEEE
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNKQVSLSQLLTTHVPTVWAIDQYRI   59 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~~~~~~~~~~~~~~ti~~vd~~~~   59 (65)
                      ...+-++++|-+|+|||+.+.+      .........+..-+.+.|.||+
T Consensus       137 ~~p~Vil~vGVNG~GKTTTIaK------LA~~l~~~g~~VllaA~DTFRA  180 (340)
T COG0552         137 KKPFVILFVGVNGVGKTTTIAK------LAKYLKQQGKSVLLAAGDTFRA  180 (340)
T ss_pred             CCcEEEEEEecCCCchHhHHHH------HHHHHHHCCCeEEEEecchHHH
Confidence            3467899999999999999987      3333333334444444566553


No 413
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD. This family represents the NikD subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase. NikD and NikE are homologous.
Probab=96.26  E-value=0.0043  Score=37.82  Aligned_cols=18  Identities=28%  Similarity=0.372  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        14 ~~~i~G~nGsGKSTLl~~   31 (230)
T TIGR02770        14 VLALVGESGSGKSLTCLA   31 (230)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999973


No 414
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit. RuvA specifically binds Holliday junctions as a sandwich of two tetramers and maintains the configuration of the junction. It forms a complex with two hexameric rings of RuvB, the subunit that contains helicase activity. The complex drives ATP-dependent branch migration of the Holliday junction recombination intermediate. The endonuclease RuvC resolves junctions.
Probab=96.25  E-value=0.004  Score=39.23  Aligned_cols=18  Identities=28%  Similarity=0.429  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.|++|+|||+++..
T Consensus        32 ~~ll~Gp~G~GKT~la~~   49 (305)
T TIGR00635        32 HLLLYGPPGLGKTTLAHI   49 (305)
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            588999999999999975


No 415
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional
Probab=96.25  E-value=0.0043  Score=38.66  Aligned_cols=18  Identities=22%  Similarity=0.387  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        39 ~~~i~G~nGsGKSTLl~~   56 (265)
T PRK10575         39 VTGLIGHNGSGKSTLLKM   56 (265)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973


No 416
>PRK13947 shikimate kinase; Provisional
Probab=96.25  E-value=0.0046  Score=35.77  Aligned_cols=18  Identities=28%  Similarity=0.298  Sum_probs=16.5

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +|+++|.+|+|||++..+
T Consensus         3 ~I~l~G~~GsGKst~a~~   20 (171)
T PRK13947          3 NIVLIGFMGTGKTTVGKR   20 (171)
T ss_pred             eEEEEcCCCCCHHHHHHH
Confidence            689999999999999975


No 417
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed
Probab=96.25  E-value=0.0043  Score=37.99  Aligned_cols=17  Identities=24%  Similarity=0.423  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHh
Q psy15257         14 KCVVVGDTAVGKTRLIC   30 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~   30 (65)
                      .+.++|++|+|||+|+.
T Consensus        29 ~~~i~G~nGsGKSTLl~   45 (248)
T PRK09580         29 VHAIMGPNGSGKSTLSA   45 (248)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            47899999999999997


No 418
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors.  The eye pigmentation of Drosophila is developed from the synthesis and deposition in the cells of red pigments, which are synthesized from guanine, and brown pigments, which are synthesized from tryptophan.  The pigment precursors are encoded by the white, brown, and scarlet genes, respectively.  Evidence from genetic and biochemical studies suggest that the White and Brown proteins function as heterodimers to import guanine, while the White and Scarlet proteins function to import tryptophan.  However, a recent study also suggests that White may be involved in the transport of a metabolite, such as 3-hydroxykynurenine, across intracellular membranes.  Mammalian ABC transporters belonging to the White subfamily (ABCG1, ABCG5, and ABCG8) have been shown to be involved in the regulation of lipid-trafficking mechanisms in 
Probab=96.25  E-value=0.0044  Score=37.63  Aligned_cols=18  Identities=33%  Similarity=0.530  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        35 ~~~l~G~nGsGKSTLlk~   52 (226)
T cd03234          35 VMAILGSSGSGKTTLLDA   52 (226)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            468999999999999973


No 419
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE. This family represents the NikE subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase.
Probab=96.24  E-value=0.0043  Score=38.64  Aligned_cols=18  Identities=22%  Similarity=0.364  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        39 ~~~i~G~nGsGKSTLl~~   56 (265)
T TIGR02769        39 TVGLLGRSGCGKSTLARL   56 (265)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973


No 420
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional
Probab=96.24  E-value=0.0042  Score=38.77  Aligned_cols=18  Identities=22%  Similarity=0.464  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        41 ~~~i~G~NGsGKSTLl~~   58 (267)
T PRK15112         41 TLAIIGENGSGKSTLAKM   58 (267)
T ss_pred             EEEEEcCCCCCHHHHHHH
Confidence            467999999999999974


No 421
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of Ser-46 of HPr and its dephosphorylation by phosphorolysis. The latter reaction uses inorganic phosphate as substrate and produces pyrophosphate. Phosphoenolpyruvate carboxykinase (PEPCK) and the C-terminal catalytic domain of HprK/P are structurally similar with conserved active site residues suggesting these two phosphotransferases have related functions.  The HprK/P N-terminal domain is structurally similar to the N-terminal domains of the MurE and MurF amino acid ligases.
Probab=96.24  E-value=0.0043  Score=36.38  Aligned_cols=19  Identities=21%  Similarity=0.550  Sum_probs=16.4

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .=+++.|++|+|||++...
T Consensus        15 ~gvLi~G~sG~GKStlal~   33 (149)
T cd01918          15 IGVLITGPSGIGKSELALE   33 (149)
T ss_pred             EEEEEEcCCCCCHHHHHHH
Confidence            3578999999999999875


No 422
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional
Probab=96.24  E-value=0.0043  Score=38.80  Aligned_cols=18  Identities=33%  Similarity=0.429  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        35 ~~~l~G~nGsGKSTLl~~   52 (272)
T PRK15056         35 IAALVGVNGSGKSTLFKA   52 (272)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973


No 423
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt   The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export.  Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters.  A typical system is made of a conserved integral membrane and an ABC.  In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenzae) and a cytoplasmic membrane protein MPA2.
Probab=96.24  E-value=0.0044  Score=37.75  Aligned_cols=18  Identities=22%  Similarity=0.466  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        50 ~~~i~G~nGsGKSTLl~~   67 (224)
T cd03220          50 RIGLIGRNGAGKSTLLRL   67 (224)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477999999999999974


No 424
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional
Probab=96.24  E-value=0.0043  Score=38.39  Aligned_cols=18  Identities=39%  Similarity=0.553  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        34 ~~~i~G~nGsGKSTLl~~   51 (258)
T PRK11701         34 VLGIVGESGSGKTTLLNA   51 (258)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974


No 425
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter.  The CCM family is involved in bacterial cytochrome c biogenesis.  Cytochrome c maturation in E. coli requires the ccm operon, which encodes eight membrane proteins (CcmABCDEFGH).  CcmE is a periplasmic heme chaperone that binds heme covalently and transfers it onto apocytochrome c in the presence of CcmF, CcmG, and CcmH.  The CcmAB proteins represent an ABC transporter and the CcmCD proteins participate in heme transfer to CcmE.
Probab=96.24  E-value=0.0045  Score=37.04  Aligned_cols=18  Identities=33%  Similarity=0.405  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKSTLl~~   45 (201)
T cd03231          28 ALQVTGPNGSGKTTLLRI   45 (201)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578999999999999973


No 426
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains.  The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence.  This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence.
Probab=96.23  E-value=0.0038  Score=37.76  Aligned_cols=18  Identities=39%  Similarity=0.604  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+..
T Consensus        24 ~~~i~G~NGsGKTTLl~a   41 (204)
T cd03240          24 LTLIVGQNGAGKTTIIEA   41 (204)
T ss_pred             eEEEECCCCCCHHHHHHH
Confidence            568889999999999974


No 427
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional
Probab=96.23  E-value=0.0044  Score=38.14  Aligned_cols=18  Identities=22%  Similarity=0.416  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        33 ~~~l~G~nGsGKSTLl~~   50 (255)
T PRK11300         33 IVSLIGPNGAGKTTVFNC   50 (255)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477999999999999973


No 428
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein. Members of this family are the ATP-binding protein of a conserved four gene ABC transporter operon found next to ectoine unilization operons and ectoine biosynthesis operons. Ectoine is a compatible solute that protects enzymes from high osmolarity. It is released by some species in response to hypoosmotic shock, and it is taken up by a number of bacteria as a compatible solute or for consumption. This family shows strong sequence similiarity to a number of amino acid ABC transporter ATP-binding proteins.
Probab=96.23  E-value=0.0045  Score=38.16  Aligned_cols=18  Identities=22%  Similarity=0.534  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKSTLl~~   45 (252)
T TIGR03005        28 KVALIGPSGSGKSTILRI   45 (252)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 429
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only]
Probab=96.22  E-value=0.0042  Score=38.00  Aligned_cols=18  Identities=22%  Similarity=0.390  Sum_probs=15.5

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.+.||+|+|||+|+..
T Consensus        31 ~iaitGPSG~GKStllk~   48 (223)
T COG4619          31 FIAITGPSGCGKSTLLKI   48 (223)
T ss_pred             eEEEeCCCCccHHHHHHH
Confidence            467889999999999974


No 430
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=96.22  E-value=0.0039  Score=41.74  Aligned_cols=18  Identities=39%  Similarity=0.549  Sum_probs=16.3

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++|||||+++.+
T Consensus       223 ~i~~vGptGvGKTTt~~k  240 (424)
T PRK05703        223 VVALVGPTGVGKTTTLAK  240 (424)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            678999999999999886


No 431
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional
Probab=96.22  E-value=0.0046  Score=37.02  Aligned_cols=19  Identities=21%  Similarity=0.193  Sum_probs=16.5

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-+.++|.+|+|||+|+.+
T Consensus         7 ~ii~ivG~sgsGKTTLi~~   25 (173)
T PRK10751          7 PLLAIAAWSGTGKTTLLKK   25 (173)
T ss_pred             eEEEEECCCCChHHHHHHH
Confidence            3578899999999999876


No 432
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase. It is a homohexamer. Each monomer consists of an N-terminal domain of the OB fold, which is responsible for binding to cysteine rich nucleotides. This alignment is of the C-terminal ATP binding domain.
Probab=96.22  E-value=0.0044  Score=38.89  Aligned_cols=20  Identities=25%  Similarity=0.340  Sum_probs=17.3

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-++.++|++|+|||+|+..
T Consensus        16 Gqr~~I~G~~G~GKTTLlr~   35 (249)
T cd01128          16 GQRGLIVAPPKAGKTTLLQS   35 (249)
T ss_pred             CCEEEEECCCCCCHHHHHHH
Confidence            34789999999999999974


No 433
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional
Probab=96.22  E-value=0.0045  Score=38.66  Aligned_cols=18  Identities=28%  Similarity=0.532  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        35 ~~~i~G~nGsGKSTLl~~   52 (269)
T PRK11831         35 ITAIMGPSGIGKTTLLRL   52 (269)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477999999999999973


No 434
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP). This enzyme is required for the biosynthesis of ADP and is essential for homeostasis of adenosine phosphates.
Probab=96.21  E-value=0.0041  Score=36.51  Aligned_cols=18  Identities=17%  Similarity=0.279  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +|+++|+.|+|||++..+
T Consensus         1 ~I~i~G~pGsGKst~a~~   18 (194)
T cd01428           1 RILLLGPPGSGKGTQAER   18 (194)
T ss_pred             CEEEECCCCCCHHHHHHH
Confidence            478999999999999975


No 435
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional
Probab=96.21  E-value=0.0046  Score=38.12  Aligned_cols=18  Identities=22%  Similarity=0.499  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        34 ~~~i~G~nGsGKSTLl~~   51 (253)
T PRK14261         34 VTALIGPSGCGKSTLLRC   51 (253)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477999999999999973


No 436
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL. Members of this family are the PhnL protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated C-P lysase complex. This protein (PhnL) and the adjacent-encoded PhnK (TIGR02323) resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this C-P lyase complex rather than part of a transporter per se.
Probab=96.21  E-value=0.0048  Score=37.32  Aligned_cols=18  Identities=22%  Similarity=0.414  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        36 ~~~l~G~nGsGKSTLl~~   53 (224)
T TIGR02324        36 CVALSGPSGAGKSTLLKS   53 (224)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 437
>cd00880 Era_like Era (E. coli Ras-like protein)-like.  This family includes several distinct subfamilies (TrmE/ThdF, FeoB, YihA (EngG), Era, and EngA/YfgK) that generally show sequence conservation in the region between the Walker A and B motifs (G1 and G3 box motifs), to the exclusion of other GTPases. TrmE is ubiquitous in bacteria and is a widespread mitochondrial protein in eukaryotes, but is absent from archaea. The yeast member of TrmE family, MSS1, is involved in mitochondrial translation; bacterial members are often present in translation-related operons.  FeoB represents an unusual adaptation of GTPases for high-affinity iron (II) transport. YihA (EngB) family of GTPases is typified by the E. coli YihA, which is an essential protein involved in cell division control.  Era is characterized by a distinct derivative of the KH domain (the pseudo-KH domain) which is located C-terminal to the GTPase domain.  EngA and its orthologs are composed of two GTPase domains and, since the se
Probab=96.21  E-value=0.0025  Score=35.00  Aligned_cols=15  Identities=40%  Similarity=0.645  Sum_probs=13.6

Q ss_pred             EECCCCChHHHHHhH
Q psy15257         17 VVGDTAVGKTRLICA   31 (65)
Q Consensus        17 ~lG~~gvGKTsl~~~   31 (65)
                      ++|+.|+|||+++.+
T Consensus         1 i~G~~gsGKstl~~~   15 (163)
T cd00880           1 LFGRTNAGKSSLLNA   15 (163)
T ss_pred             CcCCCCCCHHHHHHH
Confidence            479999999999986


No 438
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed
Probab=96.21  E-value=0.0047  Score=38.40  Aligned_cols=18  Identities=22%  Similarity=0.429  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        32 ~~~I~G~NGsGKSTLl~~   49 (251)
T PRK09544         32 ILTLLGPNGAGKSTLVRV   49 (251)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999973


No 439
>PF01695 IstB_IS21:  IstB-like ATP binding protein;  InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif. They are found associated with IS21 family insertion sequences []. Functionally they have not been characterised, but they may be involved in transposition [].; GO: 0005524 ATP binding; PDB: 3EC2_A 3ECC_A 2W58_A 2QGZ_A.
Probab=96.20  E-value=0.0039  Score=37.17  Aligned_cols=20  Identities=30%  Similarity=0.365  Sum_probs=16.5

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+++.|++|+|||.|+..
T Consensus        47 ~~~l~l~G~~G~GKThLa~a   66 (178)
T PF01695_consen   47 GENLILYGPPGTGKTHLAVA   66 (178)
T ss_dssp             --EEEEEESTTSSHHHHHHH
T ss_pred             CeEEEEEhhHhHHHHHHHHH
Confidence            35799999999999999875


No 440
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor.  The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI s are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLIs have an N-terminal Fe-S domain and two nucleotide binding domains which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=96.20  E-value=0.0047  Score=38.64  Aligned_cols=18  Identities=22%  Similarity=0.331  Sum_probs=16.2

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~IvG~nGsGKSTLlk~   45 (255)
T cd03236          28 VLGLVGPNGIGKSTALKI   45 (255)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            688999999999999974


No 441
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional
Probab=96.20  E-value=0.0047  Score=37.62  Aligned_cols=18  Identities=22%  Similarity=0.567  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        27 ~~~l~G~nGsGKSTLl~~   44 (232)
T PRK10771         27 RVAILGPSGAGKSTLLNL   44 (232)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 442
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional
Probab=96.20  E-value=0.0045  Score=40.62  Aligned_cols=18  Identities=33%  Similarity=0.492  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        31 ~~~l~G~nGsGKSTLL~~   48 (369)
T PRK11000         31 FVVFVGPSGCGKSTLLRM   48 (369)
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            468999999999999973


No 443
>PRK14531 adenylate kinase; Provisional
Probab=96.20  E-value=0.0052  Score=36.37  Aligned_cols=19  Identities=16%  Similarity=0.282  Sum_probs=17.1

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++++|++|+|||++..+
T Consensus         3 ~~i~i~G~pGsGKsT~~~~   21 (183)
T PRK14531          3 QRLLFLGPPGAGKGTQAAR   21 (183)
T ss_pred             cEEEEECCCCCCHHHHHHH
Confidence            4799999999999999875


No 444
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein. This model represents the ATP-binding protein of a family of ABC transporters for inorganic phosphate. In the model species Escherichia coli, a constitutive transporter for inorganic phosphate, with low affinity, is also present. The high affinity transporter that includes this polypeptide is induced when extracellular phosphate concentrations are low. The proteins most similar to the members of this family but not included appear to be amino acid transporters.
Probab=96.20  E-value=0.0042  Score=38.16  Aligned_cols=18  Identities=22%  Similarity=0.510  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        29 ~~~i~G~nGsGKSTLl~~   46 (247)
T TIGR00972        29 VTALIGPSGCGKSTLLRS   46 (247)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367999999999999974


No 445
>PLN02772 guanylate kinase
Probab=96.20  E-value=0.0055  Score=40.99  Aligned_cols=19  Identities=37%  Similarity=0.515  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      .-++++||+||||++|+.+
T Consensus       136 k~iVlsGPSGvGKsTL~~~  154 (398)
T PLN02772        136 KPIVISGPSGVGKGTLISM  154 (398)
T ss_pred             cEEEEECCCCCCHHHHHHH
Confidence            3578889999999999985


No 446
>PRK12298 obgE GTPase CgtA; Reviewed
Probab=96.20  E-value=0.012  Score=39.04  Aligned_cols=18  Identities=28%  Similarity=0.383  Sum_probs=16.5

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .|.++|.+++|||||+.+
T Consensus       161 dValVG~PNaGKSTLln~  178 (390)
T PRK12298        161 DVGLLGLPNAGKSTFIRA  178 (390)
T ss_pred             cEEEEcCCCCCHHHHHHH
Confidence            578999999999999985


No 447
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.20  E-value=0.0042  Score=38.85  Aligned_cols=18  Identities=17%  Similarity=0.342  Sum_probs=15.6

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        37 ~~~l~G~nGsGKSTLl~~   54 (271)
T PRK13632         37 YVAILGHNGSGKSTISKI   54 (271)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973


No 448
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein. This ABC transporter ATP-binding protein is found in a number of genomes in operon-like contexts strongly suggesting a substrate specificity for 2-aminoethylphosphonate (2-AEP). The characterized PhnSTUV system is absent in the genomes in which this system is found. These genomes encode systems for the catabolism of 2-AEP, making the need for a 2-AEP-specific transporter likely.
Probab=96.20  E-value=0.0045  Score=40.43  Aligned_cols=18  Identities=28%  Similarity=0.447  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        32 ~~~l~GpsGsGKSTLLr~   49 (353)
T TIGR03265        32 FVCLLGPSGCGKTTLLRI   49 (353)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            468999999999999973


No 449
>PRK14240 phosphate transporter ATP-binding protein; Provisional
Probab=96.20  E-value=0.0048  Score=37.93  Aligned_cols=18  Identities=17%  Similarity=0.464  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        31 ~~~i~G~nGsGKSTLl~~   48 (250)
T PRK14240         31 VTALIGPSGCGKSTFLRT   48 (250)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            468999999999999973


No 450
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules.  Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells.  Subsequently, virus-infected or malignantly transformed cells can be eliminated.  TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes.
Probab=96.19  E-value=0.0049  Score=37.32  Aligned_cols=18  Identities=22%  Similarity=0.470  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        42 ~~~i~G~nGsGKSTLl~~   59 (226)
T cd03248          42 VTALVGPSGSGKSTVVAL   59 (226)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            468999999999999974


No 451
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate. The resulting product gluconate-6-phoshate is an important precursor of gluconate metabolism. GntK acts as a dimmer composed of two identical subunits.
Probab=96.19  E-value=0.0048  Score=35.03  Aligned_cols=17  Identities=35%  Similarity=0.393  Sum_probs=15.2

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +++.|.+|+|||++...
T Consensus         2 i~l~G~~GsGKST~a~~   18 (150)
T cd02021           2 IVVMGVSGSGKSTVGKA   18 (150)
T ss_pred             EEEEcCCCCCHHHHHHH
Confidence            57889999999999985


No 452
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea.  This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily.  The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.19  E-value=0.0043  Score=38.82  Aligned_cols=18  Identities=28%  Similarity=0.464  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        52 ~~~l~G~nGsGKSTLl~~   69 (269)
T cd03294          52 IFVIMGLSGSGKSTLLRC   69 (269)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367999999999999974


No 453
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional
Probab=96.19  E-value=0.0048  Score=38.58  Aligned_cols=18  Identities=17%  Similarity=0.469  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        41 ~~~l~G~nGsGKSTLl~~   58 (269)
T PRK14259         41 VTALIGPSGCGKSTVLRS   58 (269)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 454
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]
Probab=96.18  E-value=0.0046  Score=38.83  Aligned_cols=20  Identities=40%  Similarity=0.456  Sum_probs=17.7

Q ss_pred             eeEEEEECCCCChHHHHHhH
Q psy15257         12 LVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        12 ~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+++.|++|+|||.|+..
T Consensus       105 ~~nl~l~G~~G~GKThLa~A  124 (254)
T COG1484         105 GENLVLLGPPGVGKTHLAIA  124 (254)
T ss_pred             CCcEEEECCCCCcHHHHHHH
Confidence            45789999999999999985


No 455
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional
Probab=96.18  E-value=0.0047  Score=40.21  Aligned_cols=18  Identities=39%  Similarity=0.553  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        26 ~~~l~G~nGsGKSTLl~~   43 (352)
T PRK11144         26 ITAIFGRSGAGKTSLINA   43 (352)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974


No 456
>PTZ00088 adenylate kinase 1; Provisional
Probab=96.18  E-value=0.0052  Score=38.11  Aligned_cols=19  Identities=32%  Similarity=0.447  Sum_probs=17.4

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ++++++|++|+|||++..+
T Consensus         7 mrIvl~G~PGsGK~T~a~~   25 (229)
T PTZ00088          7 LKIVLFGAPGVGKGTFAEI   25 (229)
T ss_pred             ceEEEECCCCCCHHHHHHH
Confidence            6799999999999999985


No 457
>smart00053 DYNc Dynamin, GTPase. Large GTPases that mediate vesicle trafficking. Dynamin participates in the endocytic uptake of receptors, associated ligands, and  plasma membrane following an exocytic event.
Probab=96.17  E-value=0.0048  Score=38.63  Aligned_cols=21  Identities=29%  Similarity=0.517  Sum_probs=18.2

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ....++++|++|+||||++..
T Consensus        25 ~~p~i~vvG~~~~GKSt~l~~   45 (240)
T smart00053       25 DLPQIAVVGGQSAGKSSVLEN   45 (240)
T ss_pred             CCCeEEEEcCCCccHHHHHHH
Confidence            345799999999999999985


No 458
>PF03205 MobB:  Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A.
Probab=96.17  E-value=0.0035  Score=36.08  Aligned_cols=18  Identities=44%  Similarity=0.479  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+.++|+.++|||+|+.+
T Consensus         2 vv~VvG~~~sGKTTl~~~   19 (140)
T PF03205_consen    2 VVQVVGPKNSGKTTLIRK   19 (140)
T ss_dssp             EEEEEESTTSSHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367899999999999985


No 459
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones]
Probab=96.17  E-value=0.0054  Score=40.90  Aligned_cols=21  Identities=29%  Similarity=0.419  Sum_probs=18.5

Q ss_pred             eeeEEEEECCCCChHHHHHhH
Q psy15257         11 ELVKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        11 ~~~kvv~lG~~gvGKTsl~~~   31 (65)
                      ...+++++||+|||||-++.|
T Consensus        49 ~PKNILMIGpTGVGKTEIARR   69 (444)
T COG1220          49 TPKNILMIGPTGVGKTEIARR   69 (444)
T ss_pred             CccceEEECCCCCcHHHHHHH
Confidence            346799999999999999986


No 460
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI. This model does not recognize the highly divergent NodI from Azorhizobium caulinodans.
Probab=96.17  E-value=0.0049  Score=39.19  Aligned_cols=18  Identities=17%  Similarity=0.259  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        32 ~~~l~G~NGaGKSTLl~~   49 (303)
T TIGR01288        32 CFGLLGPNGAGKSTIARM   49 (303)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974


No 461
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only]
Probab=96.17  E-value=0.0046  Score=37.33  Aligned_cols=16  Identities=25%  Similarity=0.611  Sum_probs=14.3

Q ss_pred             EEEECCCCChHHHHHh
Q psy15257         15 CVVVGDTAVGKTRLIC   30 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~   30 (65)
                      +-+.||+|||||+|+.
T Consensus        31 vtlMGPSGcGKSTLls   46 (213)
T COG4136          31 VTLMGPSGCGKSTLLS   46 (213)
T ss_pred             EEEECCCCccHHHHHH
Confidence            5688999999999996


No 462
>TIGR00150 HI0065_YjeE ATPase, YjeE family. Members of this family have a conserved nucleotide-binding motif GXXGXGKT and a nucleotide-binding fold. Member protein YjeE of Haemophilus influenzae (HI0065) was shown to have ATPase activity.
Probab=96.16  E-value=0.0048  Score=35.53  Aligned_cols=18  Identities=33%  Similarity=0.521  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+++.|+.|+|||++++.
T Consensus        24 ~i~l~G~lGaGKTtl~~~   41 (133)
T TIGR00150        24 VVLLKGDLGAGKTTLVQG   41 (133)
T ss_pred             EEEEEcCCCCCHHHHHHH
Confidence            578999999999999975


No 463
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit. Model TIGR03731 represents the family of all lantibiotics related to gallidermin, including epidermin, mutatin, and nisin. This protein family describes the ATP-binding subunit of a gallidermin/epidermin class lantibiotic protection transporter. It is largely restricted to gallidermin-family lantibiotic biosynthesis and export cassettes, but also occurs in orphan transporter cassettes in species that lack candidate lantibiotic precursor and synthetase genes.
Probab=96.16  E-value=0.0052  Score=37.17  Aligned_cols=18  Identities=22%  Similarity=0.362  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKSTLl~~   45 (223)
T TIGR03740        28 VYGLLGPNGAGKSTLLKM   45 (223)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 464
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.15  E-value=0.0052  Score=37.34  Aligned_cols=18  Identities=28%  Similarity=0.510  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        30 ~~~i~G~nGsGKSTLl~~   47 (234)
T cd03251          30 TVALVGPSGSGKSTLVNL   47 (234)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            477999999999999974


No 465
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed
Probab=96.15  E-value=0.0043  Score=40.90  Aligned_cols=18  Identities=22%  Similarity=0.372  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        42 ~~~LlGpsGsGKSTLLr~   59 (375)
T PRK09452         42 FLTLLGPSGCGKTTVLRL   59 (375)
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            367899999999999973


No 466
>cd01855 YqeH YqeH.  YqeH is an essential GTP-binding protein. Depletion of YqeH induces an excess initiation of DNA replication, suggesting that it negatively controls initiation of chromosome replication. The YqeH subfamily is common in eukaryotes and sporadically present in bacteria with probable acquisition by plants from chloroplasts.  Proteins of the YqeH family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases.
Probab=96.15  E-value=0.0045  Score=36.61  Aligned_cols=19  Identities=53%  Similarity=0.606  Sum_probs=17.2

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..+.++|.++||||+|+..
T Consensus       128 ~~~~~~G~~nvGKStliN~  146 (190)
T cd01855         128 GDVYVVGATNVGKSTLINA  146 (190)
T ss_pred             CcEEEEcCCCCCHHHHHHH
Confidence            4789999999999999985


No 467
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends. They cleave ends sealed by hairpin structures and are thought to play a role in removing protein bound to DNA termini.
Probab=96.15  E-value=0.005  Score=37.25  Aligned_cols=18  Identities=28%  Similarity=0.499  Sum_probs=16.1

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++|+|||+|+..
T Consensus        30 ~~~i~G~NGsGKSTll~~   47 (213)
T cd03279          30 LFLICGPTGAGKSTILDA   47 (213)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            578999999999999974


No 468
>PRK09825 idnK D-gluconate kinase; Provisional
Probab=96.15  E-value=0.0048  Score=36.61  Aligned_cols=18  Identities=17%  Similarity=0.333  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++|+|||+++..
T Consensus         5 ~i~l~G~sGsGKSTl~~~   22 (176)
T PRK09825          5 SYILMGVSGSGKSLIGSK   22 (176)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            468899999999999974


No 469
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export.  They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins.  The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities.  The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.15  E-value=0.0049  Score=36.02  Aligned_cols=18  Identities=33%  Similarity=0.567  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        30 ~~~l~G~nGsGKstLl~~   47 (171)
T cd03228          30 KVAIVGPSGSGKSTLLKL   47 (171)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467899999999999974


No 470
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs. A related protein is found in archaea.
Probab=96.14  E-value=0.0047  Score=36.01  Aligned_cols=17  Identities=24%  Similarity=0.413  Sum_probs=15.3

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +++.|++|+|||++..+
T Consensus         2 ~li~G~~G~GKT~l~~~   18 (187)
T cd01124           2 TLLSGGPGTGKTTFALQ   18 (187)
T ss_pred             EEEEcCCCCCHHHHHHH
Confidence            57889999999999986


No 471
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT). Cm-inactivating enzyme; modifies the primary (C-3) hydroxyl of the antibiotic. Related structurally to shikimate kinase II.
Probab=96.14  E-value=0.0052  Score=36.02  Aligned_cols=18  Identities=22%  Similarity=0.412  Sum_probs=16.2

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+++.|.+|+|||++...
T Consensus         4 ~i~l~G~~gsGKst~a~~   21 (175)
T cd00227           4 IIILNGGSSAGKSSIARA   21 (175)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999985


No 472
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed
Probab=96.14  E-value=0.0054  Score=37.50  Aligned_cols=18  Identities=28%  Similarity=0.575  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        29 ~~~l~G~nGsGKSTLl~~   46 (240)
T PRK09493         29 VVVIIGPSGSGKSTLLRC   46 (240)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 473
>KOG0060|consensus
Probab=96.13  E-value=0.0044  Score=43.40  Aligned_cols=19  Identities=26%  Similarity=0.482  Sum_probs=16.4

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.+++.||+|+|||||++-
T Consensus       462 ~~LLItG~sG~GKtSLlRv  480 (659)
T KOG0060|consen  462 QNLLITGPSGCGKTSLLRV  480 (659)
T ss_pred             CeEEEECCCCCchhHHHHH
Confidence            3578999999999999963


No 474
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional
Probab=96.13  E-value=0.0045  Score=40.82  Aligned_cols=17  Identities=24%  Similarity=0.515  Sum_probs=15.2

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      +.++|++|+|||+|+.-
T Consensus        48 ~~llGpsGsGKSTLLr~   64 (377)
T PRK11607         48 FALLGASGCGKSTLLRM   64 (377)
T ss_pred             EEEECCCCCcHHHHHHH
Confidence            57999999999999974


No 475
>PF13476 AAA_23:  AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A.
Probab=96.13  E-value=0.0033  Score=36.66  Aligned_cols=17  Identities=29%  Similarity=0.503  Sum_probs=14.7

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      .++.|++|+|||+++..
T Consensus        22 ~vi~G~Ng~GKStil~a   38 (202)
T PF13476_consen   22 NVIYGPNGSGKSTILEA   38 (202)
T ss_dssp             EEEEESTTSSHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            46779999999999975


No 476
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit. This protein family is the ATP-binding cassette subunit of binding protein-dependent ABC transporter complex that strictly co-occurs with TIGR03769. TIGRFAMs model TIGR03769 describes a protein domain that occurs singly or as one of up to three repeats in proteins of a number of Actinobacteria, including Propionibacterium acnes KPA171202. The TIGR03769 domain occurs both in an adjacent gene for the substrate-binding protein and in additional (often nearby) proteins, often with LPXTG-like sortase recognition signals. Homologous ATP-binding subunits outside the scope of this family include manganese transporter MntA in Synechocystis sp. PCC 6803 and chelated iron transporter subunits. The function of this transporter complex is unknown.
Probab=96.13  E-value=0.0053  Score=37.33  Aligned_cols=19  Identities=32%  Similarity=0.368  Sum_probs=16.5

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.+.++|++|+|||+|+.-
T Consensus         7 e~~~l~G~nGsGKSTLl~~   25 (223)
T TIGR03771         7 ELLGLLGPNGAGKTTLLRA   25 (223)
T ss_pred             cEEEEECCCCCCHHHHHHH
Confidence            3678999999999999974


No 477
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family also possess a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, and recognition of specific DNA stru
Probab=96.13  E-value=0.005  Score=36.91  Aligned_cols=19  Identities=16%  Similarity=0.256  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -.++++|++|+|||+++..
T Consensus        30 ~~~~l~G~Ng~GKStll~~   48 (202)
T cd03243          30 RLLLITGPNMGGKSTYLRS   48 (202)
T ss_pred             eEEEEECCCCCccHHHHHH
Confidence            3689999999999999974


No 478
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria.  Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.13  E-value=0.0054  Score=37.31  Aligned_cols=18  Identities=28%  Similarity=0.556  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        29 ~~~l~G~nGsGKSTLl~~   46 (236)
T cd03253          29 KVAIVGPSGSGKSTILRL   46 (236)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 479
>PRK14237 phosphate transporter ATP-binding protein; Provisional
Probab=96.13  E-value=0.0048  Score=38.50  Aligned_cols=18  Identities=17%  Similarity=0.410  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        48 ~~~I~G~nGsGKSTLl~~   65 (267)
T PRK14237         48 ITALIGPSGSGKSTYLRS   65 (267)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367899999999999973


No 480
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional
Probab=96.12  E-value=0.0055  Score=38.07  Aligned_cols=18  Identities=28%  Similarity=0.527  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        30 ~~~i~G~nGsGKSTLl~~   47 (258)
T PRK13548         30 VVAILGPNGAGKSTLLRA   47 (258)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973


No 481
>PTZ00258 GTP-binding protein; Provisional
Probab=96.12  E-value=0.015  Score=38.87  Aligned_cols=26  Identities=31%  Similarity=0.437  Sum_probs=21.0

Q ss_pred             ceeeEEEEECCCCChHHHHHhHhhhcc
Q psy15257         10 QELVKCVVVGDTAVGKTRLICARACNK   36 (65)
Q Consensus        10 ~~~~kvv~lG~~gvGKTsl~~~~~~~~   36 (65)
                      ...+++.++|.++||||+|+.+ +++.
T Consensus        19 ~~~~kvgIVG~PNvGKSTLfna-Lt~~   44 (390)
T PTZ00258         19 GNNLKMGIVGLPNVGKSTTFNA-LCKQ   44 (390)
T ss_pred             CCCcEEEEECCCCCChHHHHHH-HhcC
Confidence            4457999999999999999985 3443


No 482
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional
Probab=96.12  E-value=0.0049  Score=38.00  Aligned_cols=18  Identities=17%  Similarity=0.493  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        32 ~~~i~G~nGsGKSTLl~~   49 (252)
T PRK14256         32 VTAIIGPSGCGKSTVLRS   49 (252)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974


No 483
>PRK00131 aroK shikimate kinase; Reviewed
Probab=96.11  E-value=0.0059  Score=35.06  Aligned_cols=19  Identities=21%  Similarity=0.253  Sum_probs=16.8

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      ..++++|++|+|||++...
T Consensus         5 ~~i~l~G~~GsGKstla~~   23 (175)
T PRK00131          5 PNIVLIGFMGAGKSTIGRL   23 (175)
T ss_pred             CeEEEEcCCCCCHHHHHHH
Confidence            4789999999999999874


No 484
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component.  Biosynthesis of iron-sulfur clusters (Fe-S) depends on multiprotein systems.  The SUF system of E. coli and Erwinia chrysanthemi is important for Fe-S biogenesis under stressful conditions.  The SUF system is made of six proteins: SufC is an atypical cytoplasmic ABC-ATPase, which forms a complex with SufB and SufD; SufA plays the role of a scaffold protein for assembly of iron-sulfur clusters and delivery to target proteins; SufS is a cysteine desulfurase which mobilizes the sulfur atom from cysteine and provides it to the cluster; SufE has no associated function yet.
Probab=96.11  E-value=0.0058  Score=36.58  Aligned_cols=18  Identities=22%  Similarity=0.344  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        28 ~~~i~G~nGsGKStLl~~   45 (200)
T cd03217          28 VHALMGPNGSGKSTLAKT   45 (200)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974


No 485
>TIGR01351 adk adenylate kinases. Adenylate kinase (EC 2.7.4.3) converts ATP + AMP to ADP + ADP, that is, uses ATP as a phosphate donor for AMP. Most members of this family are known or believed to be adenylate kinase. However, some members accept other nucleotide triphosphates as donors, may be unable to use ATP, and may fail to complement adenylate kinase mutants. An example of a nucleoside-triphosphate--adenylate kinase (EC 2.7.4.10) is a GTP:AMP phosphotransferase. This family is designated subfamily rather than equivalog for this reason.
Probab=96.11  E-value=0.0049  Score=37.18  Aligned_cols=18  Identities=22%  Similarity=0.305  Sum_probs=16.2

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      +++++|++|+|||++..+
T Consensus         1 rI~i~G~pGsGKsT~a~~   18 (210)
T TIGR01351         1 RLVLLGPPGSGKGTQAKR   18 (210)
T ss_pred             CEEEECCCCCCHHHHHHH
Confidence            588999999999999985


No 486
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.11  E-value=0.0055  Score=38.66  Aligned_cols=18  Identities=39%  Similarity=0.554  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        35 ~~~i~G~nGsGKSTLl~~   52 (286)
T PRK13646         35 YYAIVGQTGSGKSTLIQN   52 (286)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999973


No 487
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional
Probab=96.10  E-value=0.0048  Score=39.81  Aligned_cols=18  Identities=28%  Similarity=0.346  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        35 ~~~ivG~sGsGKSTLl~~   52 (330)
T PRK15093         35 IRGLVGESGSGKSLIAKA   52 (330)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            367999999999999974


No 488
>PRK15064 ABC transporter ATP-binding protein; Provisional
Probab=96.10  E-value=0.0051  Score=41.73  Aligned_cols=18  Identities=17%  Similarity=0.429  Sum_probs=16.0

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        29 ~~~liG~NGsGKSTLl~~   46 (530)
T PRK15064         29 RYGLIGANGCGKSTFMKI   46 (530)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999973


No 489
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism]
Probab=96.10  E-value=0.0046  Score=40.46  Aligned_cols=18  Identities=22%  Similarity=0.455  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      -+.++||||+|||+++.-
T Consensus        30 ~vaLlGpSGaGKsTlLRi   47 (345)
T COG1118          30 LVALLGPSGAGKSTLLRI   47 (345)
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            367899999999999974


No 490
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional
Probab=96.10  E-value=0.0057  Score=38.10  Aligned_cols=18  Identities=22%  Similarity=0.477  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        35 ~~~i~G~nGsGKSTLl~~   52 (265)
T PRK10253         35 FTAIIGPNGCGKSTLLRT   52 (265)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999973


No 491
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.  This family is also known as MRP (mulrtidrug resisitance-associated protein).  Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed.  MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=96.10  E-value=0.0051  Score=37.06  Aligned_cols=18  Identities=44%  Similarity=0.621  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        32 ~~~i~G~nGsGKSTLl~~   49 (221)
T cd03244          32 KVGIVGRTGSGKSSLLLA   49 (221)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467899999999999974


No 492
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein. This model describes the energy-transducing ATPase subunit ThiQ of the ThiBPQ thiamine (and thiamine pyrophosphate) ABC transporter in several Proteobacteria. This protein is found so far only in Proteobacteria, and is found in complete genomes only if the ThiB and ThiP subunits are also found.
Probab=96.10  E-value=0.0058  Score=36.77  Aligned_cols=18  Identities=22%  Similarity=0.475  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        26 ~~~i~G~nGsGKSTLl~~   43 (213)
T TIGR01277        26 IVAIMGPSGAGKSTLLNL   43 (213)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 493
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit. This model describes daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. In eukaryotes proteins of similar function include p-gyco proteins, multidrug resistance protein etc.
Probab=96.10  E-value=0.0056  Score=38.93  Aligned_cols=18  Identities=28%  Similarity=0.279  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        21 ~~~l~G~NGaGKSTLl~~   38 (302)
T TIGR01188        21 VFGFLGPNGAGKTTTIRM   38 (302)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973


No 494
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional
Probab=96.09  E-value=0.0058  Score=37.64  Aligned_cols=18  Identities=17%  Similarity=0.431  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        33 ~~~I~G~nGsGKSTLl~~   50 (251)
T PRK14244         33 VTAFIGPSGCGKSTFLRC   50 (251)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999974


No 495
>cd03290 ABCC_SUR1_N The SUR domain 1.  The sulfonylurea receptor SUR is an ATP transporter of the ABCC/MRP family with tandem ATPase binding domains.  Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel.  Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism.  It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=96.09  E-value=0.0053  Score=37.04  Aligned_cols=18  Identities=33%  Similarity=0.599  Sum_probs=15.8

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        29 ~~~i~G~nGsGKSTLl~~   46 (218)
T cd03290          29 LTMIVGQVGCGKSSLLLA   46 (218)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467899999999999974


No 496
>PLN02165 adenylate isopentenyltransferase
Probab=96.09  E-value=0.0078  Score=39.46  Aligned_cols=18  Identities=39%  Similarity=0.604  Sum_probs=16.4

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .++++|++|+|||+|...
T Consensus        45 iivIiGPTGSGKStLA~~   62 (334)
T PLN02165         45 VVVIMGATGSGKSRLSVD   62 (334)
T ss_pred             EEEEECCCCCcHHHHHHH
Confidence            588999999999999985


No 497
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed
Probab=96.08  E-value=0.0053  Score=41.98  Aligned_cols=19  Identities=37%  Similarity=0.578  Sum_probs=16.6

Q ss_pred             eEEEEECCCCChHHHHHhH
Q psy15257         13 VKCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        13 ~kvv~lG~~gvGKTsl~~~   31 (65)
                      -++.++|++|+|||+|+.-
T Consensus       377 ~~vaIvG~SGsGKSTL~~l  395 (588)
T PRK11174        377 QRIALVGPSGAGKTSLLNA  395 (588)
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            4578999999999999973


No 498
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=96.08  E-value=0.0058  Score=38.15  Aligned_cols=18  Identities=22%  Similarity=0.328  Sum_probs=15.7

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        37 ~~~I~G~nGsGKSTLl~~   54 (269)
T PRK13648         37 WTSIVGHNGSGKSTIAKL   54 (269)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            467999999999999973


No 499
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional
Probab=96.08  E-value=0.0058  Score=37.92  Aligned_cols=18  Identities=22%  Similarity=0.447  Sum_probs=15.9

Q ss_pred             EEEEECCCCChHHHHHhH
Q psy15257         14 KCVVVGDTAVGKTRLICA   31 (65)
Q Consensus        14 kvv~lG~~gvGKTsl~~~   31 (65)
                      .+.++|++|+|||+|+.-
T Consensus        32 ~~~i~G~nGsGKSTLl~~   49 (262)
T PRK09984         32 MVALLGPSGSGKSTLLRH   49 (262)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            478999999999999974


No 500
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants. Chorismic acid is a important intermediate in the synthesis of aromatic compounds, such as aromatic amino acids, p-aminobenzoic acid, folate and ubiquinone. Shikimate kinase catalyses the phosphorylation of the 3-hydroxyl group of shikimic acid using ATP.
Probab=96.08  E-value=0.006  Score=34.51  Aligned_cols=17  Identities=29%  Similarity=0.331  Sum_probs=15.6

Q ss_pred             EEEECCCCChHHHHHhH
Q psy15257         15 CVVVGDTAVGKTRLICA   31 (65)
Q Consensus        15 vv~lG~~gvGKTsl~~~   31 (65)
                      ++++|++|+|||++...
T Consensus         2 i~l~G~~GsGKstla~~   18 (154)
T cd00464           2 IVLIGMMGAGKTTVGRL   18 (154)
T ss_pred             EEEEcCCCCCHHHHHHH
Confidence            78999999999999975


Done!