Query         psy15291
Match_columns 295
No_of_seqs    299 out of 1854
Neff          9.8 
Searched_HMMs 46136
Date          Fri Aug 16 17:20:15 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15291.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15291hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd00190 Tryp_SPc Trypsin-like  100.0 1.8E-46 3.9E-51  313.3  23.4  230   56-291     1-232 (232)
  2 KOG3627|consensus              100.0 9.8E-45 2.1E-49  308.0  22.5  237   52-293     9-255 (256)
  3 smart00020 Tryp_SPc Trypsin-li 100.0 3.4E-43 7.4E-48  293.3  22.5  226   55-288     1-229 (229)
  4 PF00089 Trypsin:  Trypsin;  In 100.0 2.5E-41 5.4E-46  280.1  20.1  219   56-288     1-220 (220)
  5 COG5640 Secreted trypsin-like  100.0 7.2E-34 1.6E-38  236.8  15.7  234   52-293    29-279 (413)
  6 PF03761 DUF316:  Domain of unk  99.8 3.8E-19 8.3E-24  153.0  15.7  214   50-294    36-281 (282)
  7 PF09342 DUF1986:  Domain of un  99.6 8.4E-15 1.8E-19  117.3  12.4  116   63-186    12-131 (267)
  8 COG3591 V8-like Glu-specific e  99.4 3.1E-12 6.6E-17  105.1   9.4  199   63-292    45-250 (251)
  9 TIGR02037 degP_htrA_DO peripla  98.8 4.3E-08 9.4E-13   89.3  12.3  142   79-266    57-199 (428)
 10 TIGR02038 protease_degS peripl  98.7 3.1E-07 6.7E-12   81.3  12.5  141   80-267    78-219 (351)
 11 PRK10898 serine endoprotease;   98.6 8.1E-07 1.8E-11   78.6  13.5  141   80-267    78-219 (353)
 12 PRK10139 serine endoprotease;   98.6 8.1E-07 1.8E-11   81.1  11.8  140   81-266    91-232 (455)
 13 PF13365 Trypsin_2:  Trypsin-li  98.5 1.5E-07 3.3E-12   69.8   5.7   21   82-102     1-22  (120)
 14 PRK10942 serine endoprotease;   98.4 2.3E-06 4.9E-11   78.6  11.6  141   80-266   111-253 (473)
 15 PF02395 Peptidase_S6:  Immunog  97.3 0.00093   2E-08   64.5   8.2   65   84-170    69-133 (769)
 16 PF00863 Peptidase_C4:  Peptida  96.3   0.092   2E-06   43.4  11.6  149   85-283    36-186 (235)
 17 COG0265 DegQ Trypsin-like seri  94.5    0.68 1.5E-05   41.1  11.6  146   79-269    71-217 (347)
 18 PF00548 Peptidase_C3:  3C cyst  93.1    0.29 6.2E-06   38.7   5.9   75   74-166    19-93  (172)
 19 PF00947 Pico_P2A:  Picornaviru  90.3    0.21 4.6E-06   36.8   2.1   40  239-289    87-126 (127)
 20 KOG1421|consensus               84.6      11 0.00024   36.1  10.1   76   77-171    81-159 (955)
 21 PF05416 Peptidase_C37:  Southa  83.6       4 8.6E-05   36.6   6.4  143   84-267   383-527 (535)
 22 PF08192 Peptidase_S64:  Peptid  76.5      20 0.00043   34.4   8.8   57  237-295   634-692 (695)
 23 PF05580 Peptidase_S55:  SpoIVB  74.2     4.1 8.8E-05   33.2   3.4   25  238-267   176-200 (218)
 24 KOG3925|consensus               72.4     4.8  0.0001   35.2   3.6    9  258-266   280-288 (371)
 25 PF05579 Peptidase_S32:  Equine  66.4     3.8 8.2E-05   34.5   1.7   22  241-266   207-228 (297)
 26 PF10459 Peptidase_S46:  Peptid  64.2     3.9 8.4E-05   39.8   1.6   21   81-101    48-69  (698)
 27 PF02907 Peptidase_S29:  Hepati  62.8     5.3 0.00011   29.9   1.7   22  240-265   106-127 (148)
 28 TIGR02860 spore_IV_B stage IV   59.0      12 0.00025   33.9   3.6   47  237-294   355-401 (402)
 29 KOG2422|consensus               53.0     2.3   5E-05   39.6  -1.8   14  145-158   271-284 (665)
 30 PF00944 Peptidase_S3:  Alphavi  50.0     3.6 7.9E-05   30.7  -0.9   25  240-268   104-128 (158)
 31 PF08496 Peptidase_S49_N:  Pept  46.6      18  0.0004   28.0   2.5    6   69-74    134-139 (155)
 32 KOG1230|consensus               46.2     7.2 0.00016   35.1   0.2   27    1-27      1-27  (521)
 33 PF00949 Peptidase_S7:  Peptida  40.4      17 0.00037   27.3   1.4   26  238-267    93-118 (132)
 34 KOG4364|consensus               39.5      66  0.0014   30.9   5.2   13  254-266   556-568 (811)
 35 PF10459 Peptidase_S46:  Peptid  36.9      22 0.00047   34.8   1.9   35  225-266   619-653 (698)
 36 KOG2967|consensus               34.3   1E+02  0.0022   26.9   5.3   10   37-46     68-77  (314)
 37 KOG3925|consensus               31.2      83  0.0018   27.9   4.2    8  284-291   357-364 (371)
 38 TIGR02841 spore_YyaC putative   29.9      30 0.00065   26.1   1.2   18  227-249     5-22  (140)
 39 PF06866 DUF1256:  Protein of u  29.9      31 0.00067   26.9   1.4   19  226-249    28-46  (163)
 40 KOG2775|consensus               29.0      43 0.00093   28.9   2.1   10  130-139   184-193 (397)
 41 PF10411 DsbC_N:  Disulfide bon  24.3      33 0.00073   21.4   0.6   27  237-263    23-50  (57)
 42 KOG2409|consensus               23.1 1.7E+02  0.0038   27.6   5.0   14   88-101   420-433 (647)
 43 KOG1320|consensus               22.6 4.1E+02  0.0089   24.8   7.3   24   77-100    84-107 (473)
 44 PLN03086 PRLI-interacting fact  22.5 2.3E+02  0.0051   27.1   5.9   11   84-94    151-161 (567)
 45 KOG3165|consensus               21.7 1.4E+02   0.003   23.3   3.5   14   67-80     62-75  (195)
 46 KOG2775|consensus               20.9      38 0.00082   29.2   0.4    7   80-86    138-144 (397)
 47 KOG3709|consensus               20.4      82  0.0018   29.4   2.4    7   52-58    718-724 (778)

No 1  
>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. Alignment contains also inactive enzymes that have substitutions of the catalytic triad residues.
Probab=100.00  E-value=1.8e-46  Score=313.34  Aligned_cols=230  Identities=36%  Similarity=0.605  Sum_probs=197.1

Q ss_pred             cccccccCCCCCCcceeecccccccccceEEeeCCEEEEeCCCCCCCC-CceEEEEceeecCCccccccceecceeEEEE
Q psy15291         56 NIGIGCALPPPPPTVSRHTLYTLQFPQQDSMMTNFDMFTINLSKIGFL-ANLVAVFGEYDISGELEAKRSISKNVRRVIV  134 (295)
Q Consensus        56 i~~g~~~~~~~~p~~~~~~~~~~~~~C~GtLIs~~~VLTAAhC~~~~~-~~~~v~~g~~~~~~~~~~~~~~~~~v~~i~~  134 (295)
                      |+||..+.+.++||++.+....+.+.|+||||+++||||||||+.... ..+.|++|........  ...+.+.|..+++
T Consensus         1 i~~G~~~~~~~~Pw~v~i~~~~~~~~C~GtlIs~~~VLTaAhC~~~~~~~~~~v~~g~~~~~~~~--~~~~~~~v~~~~~   78 (232)
T cd00190           1 IVGGSEAKIGSFPWQVSLQYTGGRHFCGGSLISPRWVLTAAHCVYSSAPSNYTVRLGSHDLSSNE--GGGQVIKVKKVIV   78 (232)
T ss_pred             CcCCeECCCCCCCCEEEEEccCCcEEEEEEEeeCCEEEECHHhcCCCCCccEEEEeCcccccCCC--CceEEEEEEEEEE
Confidence            689999999999999988655477899999999999999999998652 5688889987765421  2456688999999


Q ss_pred             CCCCCCCCCCCceEEEEecCCCCCCCCceeeecCCCCC-CCCCCEEEEEecccccCCCCCCCCcEEEEeeeeChhhHHHH
Q psy15291        135 HRQYDAATFENDIALLELETPIAYDSHIVPICMPKDDD-DFTGRVATVSGWGRLKYGGGVPSVLQEVQVPVIENNVCQEM  213 (295)
Q Consensus       135 hp~y~~~~~~~DiALlkL~~~i~~s~~v~picL~~~~~-~~~~~~~~~~Gwg~~~~~~~~~~~l~~~~~~~~~~~~C~~~  213 (295)
                      ||.|+.....+|||||+|++|+.++..+.|||||.... ...+..+.++|||........+..++...+.+++...|...
T Consensus        79 hp~y~~~~~~~DiAll~L~~~~~~~~~v~picl~~~~~~~~~~~~~~~~G~g~~~~~~~~~~~~~~~~~~~~~~~~C~~~  158 (232)
T cd00190          79 HPNYNPSTYDNDIALLKLKRPVTLSDNVRPICLPSSGYNLPAGTTCTVSGWGRTSEGGPLPDVLQEVNVPIVSNAECKRA  158 (232)
T ss_pred             CCCCCCCCCcCCEEEEEECCcccCCCcccceECCCccccCCCCCEEEEEeCCcCCCCCCCCceeeEEEeeeECHHHhhhh
Confidence            99999888899999999999999999999999999863 33578999999998775545677899999999999999987


Q ss_pred             HhcCCCCCCCCCCeEEeeecCCCCCCCcCCCCCceEEEeeCCeEEEEEEEEeCCCCCCCCCCcEEeeCCCcHhHHhhh
Q psy15291        214 FQTAGHAKTIINSFLCAGYANGQRDSCEGDSGGPLMIEREDGHWVLAGTVSHGIKCAAPYLPGVYMRTTYYKPWLQTI  291 (295)
Q Consensus       214 ~~~~~~~~~~~~~~~Ca~~~~~~~~~C~gdsGgPl~~~~~~g~~~lvGi~S~g~~c~~~~~p~v~t~v~~~~~WI~~~  291 (295)
                      +..   ...+.++++|+.......+.|.|||||||++.. +++|+|+||+|++..|...+.|.+|++|+.|++||+++
T Consensus       159 ~~~---~~~~~~~~~C~~~~~~~~~~c~gdsGgpl~~~~-~~~~~lvGI~s~g~~c~~~~~~~~~t~v~~~~~WI~~~  232 (232)
T cd00190         159 YSY---GGTITDNMLCAGGLEGGKDACQGDSGGPLVCND-NGRGVLVGIVSWGSGCARPNYPGVYTRVSSYLDWIQKT  232 (232)
T ss_pred             ccC---cccCCCceEeeCCCCCCCccccCCCCCcEEEEe-CCEEEEEEEEehhhccCCCCCCCEEEEcHHhhHHhhcC
Confidence            753   246789999998765457899999999999987 69999999999998898767799999999999999874


No 2  
>KOG3627|consensus
Probab=100.00  E-value=9.8e-45  Score=307.98  Aligned_cols=237  Identities=38%  Similarity=0.660  Sum_probs=197.3

Q ss_pred             hhhhcccccccCCCCCCcceeeccccc-ccccceEEeeCCEEEEeCCCCCCCCC--ceEEEEceeecCCcccccc-ceec
Q psy15291         52 ALCRNIGIGCALPPPPPTVSRHTLYTL-QFPQQDSMMTNFDMFTINLSKIGFLA--NLVAVFGEYDISGELEAKR-SISK  127 (295)
Q Consensus        52 ~~~ri~~g~~~~~~~~p~~~~~~~~~~-~~~C~GtLIs~~~VLTAAhC~~~~~~--~~~v~~g~~~~~~~~~~~~-~~~~  127 (295)
                      ...||+||..+.++++||++.+..... .+.|+|+||+++||||||||+... .  .+.|++|.+.......... ....
T Consensus         9 ~~~~i~~g~~~~~~~~Pw~~~l~~~~~~~~~Cggsli~~~~vltaaHC~~~~-~~~~~~V~~G~~~~~~~~~~~~~~~~~   87 (256)
T KOG3627|consen    9 PEGRIVGGTEAEPGSFPWQVSLQYGGNGRHLCGGSLISPRWVLTAAHCVKGA-SASLYTVRLGEHDINLSVSEGEEQLVG   87 (256)
T ss_pred             ccCCEeCCccCCCCCCCCEEEEEECCCcceeeeeEEeeCCEEEEChhhCCCC-CCcceEEEECccccccccccCchhhhc
Confidence            357999999999999999998766664 779999999999999999999873 2  7888899876554422211 2445


Q ss_pred             ceeEEEECCCCCCCCCC-CceEEEEecCCCCCCCCceeeecCCCCC---CCCCCEEEEEecccccCC-CCCCCCcEEEEe
Q psy15291        128 NVRRVIVHRQYDAATFE-NDIALLELETPIAYDSHIVPICMPKDDD---DFTGRVATVSGWGRLKYG-GGVPSVLQEVQV  202 (295)
Q Consensus       128 ~v~~i~~hp~y~~~~~~-~DiALlkL~~~i~~s~~v~picL~~~~~---~~~~~~~~~~Gwg~~~~~-~~~~~~l~~~~~  202 (295)
                      .|.++++||+|+..... ||||||+|..++.|++.|+|||||....   ...+..|.++|||.+... ...+..|+.+.+
T Consensus        88 ~v~~~i~H~~y~~~~~~~nDiall~l~~~v~~~~~i~piclp~~~~~~~~~~~~~~~v~GWG~~~~~~~~~~~~L~~~~v  167 (256)
T KOG3627|consen   88 DVEKIIVHPNYNPRTLENNDIALLRLSEPVTFSSHIQPICLPSSADPYFPPGGTTCLVSGWGRTESGGGPLPDTLQEVDV  167 (256)
T ss_pred             eeeEEEECCCCCCCCCCCCCEEEEEECCCcccCCcccccCCCCCcccCCCCCCCEEEEEeCCCcCCCCCCCCceeEEEEE
Confidence            57788999999988877 9999999999999999999999986554   334589999999988754 245778999999


Q ss_pred             eeeChhhHHHHHhcCCCCCCCCCCeEEeeecCCCCCCCcCCCCCceEEEeeCCeEEEEEEEEeCCC-CCCCCCCcEEeeC
Q psy15291        203 PVIENNVCQEMFQTAGHAKTIINSFLCAGYANGQRDSCEGDSGGPLMIEREDGHWVLAGTVSHGIK-CAAPYLPGVYMRT  281 (295)
Q Consensus       203 ~~~~~~~C~~~~~~~~~~~~~~~~~~Ca~~~~~~~~~C~gdsGgPl~~~~~~g~~~lvGi~S~g~~-c~~~~~p~v~t~v  281 (295)
                      ++++..+|...+...   ..+++.+||++...+..++|+|||||||++.. +++|+++||+|||.. |...+.|++||+|
T Consensus       168 ~i~~~~~C~~~~~~~---~~~~~~~~Ca~~~~~~~~~C~GDSGGPLv~~~-~~~~~~~GivS~G~~~C~~~~~P~vyt~V  243 (256)
T KOG3627|consen  168 PIISNSECRRAYGGL---GTITDTMLCAGGPEGGKDACQGDSGGPLVCED-NGRWVLVGIVSWGSGGCGQPNYPGVYTRV  243 (256)
T ss_pred             eEcChhHhcccccCc---cccCCCEEeeCccCCCCccccCCCCCeEEEee-CCcEEEEEEEEecCCCCCCCCCCeEEeEh
Confidence            999999999887531   14667789999766667899999999999987 458999999999988 9988889999999


Q ss_pred             CCcHhHHhhhhC
Q psy15291        282 TYYKPWLQTITG  293 (295)
Q Consensus       282 ~~~~~WI~~~~~  293 (295)
                      +.|.+||++.++
T Consensus       244 ~~y~~WI~~~~~  255 (256)
T KOG3627|consen  244 SSYLDWIKENIG  255 (256)
T ss_pred             HHhHHHHHHHhc
Confidence            999999999875


No 3  
>smart00020 Tryp_SPc Trypsin-like serine protease. Many of these are synthesised as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. A few, however, are active as single chain molecules, and others are inactive due to substitutions of the catalytic triad residues.
Probab=100.00  E-value=3.4e-43  Score=293.35  Aligned_cols=226  Identities=35%  Similarity=0.626  Sum_probs=191.8

Q ss_pred             hcccccccCCCCCCcceeecccccccccceEEeeCCEEEEeCCCCCCCC-CceEEEEceeecCCccccccceecceeEEE
Q psy15291         55 RNIGIGCALPPPPPTVSRHTLYTLQFPQQDSMMTNFDMFTINLSKIGFL-ANLVAVFGEYDISGELEAKRSISKNVRRVI  133 (295)
Q Consensus        55 ri~~g~~~~~~~~p~~~~~~~~~~~~~C~GtLIs~~~VLTAAhC~~~~~-~~~~v~~g~~~~~~~~~~~~~~~~~v~~i~  133 (295)
                      ||+||..+.+.++||++.+......+.|+||||++++|||||||+.... ..+.|++|.+......   ....+.|..++
T Consensus         1 ~~~~G~~~~~~~~Pw~~~i~~~~~~~~C~GtlIs~~~VLTaahC~~~~~~~~~~v~~g~~~~~~~~---~~~~~~v~~~~   77 (229)
T smart00020        1 RIVGGSEANIGSFPWQVSLQYRGGRHFCGGSLISPRWVLTAAHCVYGSDPSNIRVRLGSHDLSSGE---EGQVIKVSKVI   77 (229)
T ss_pred             CccCCCcCCCCCCCcEEEEEEcCCCcEEEEEEecCCEEEECHHHcCCCCCcceEEEeCcccCCCCC---CceEEeeEEEE
Confidence            6899999999999999987544447899999999999999999998764 6789999987654321   12668999999


Q ss_pred             ECCCCCCCCCCCceEEEEecCCCCCCCCceeeecCCCCC-CCCCCEEEEEecccccC-CCCCCCCcEEEEeeeeChhhHH
Q psy15291        134 VHRQYDAATFENDIALLELETPIAYDSHIVPICMPKDDD-DFTGRVATVSGWGRLKY-GGGVPSVLQEVQVPVIENNVCQ  211 (295)
Q Consensus       134 ~hp~y~~~~~~~DiALlkL~~~i~~s~~v~picL~~~~~-~~~~~~~~~~Gwg~~~~-~~~~~~~l~~~~~~~~~~~~C~  211 (295)
                      +||.|+.....+|||||+|++|+.+++.++|+|||.... ...+..+.++|||.... .......++...+.+++...|.
T Consensus        78 ~~p~~~~~~~~~DiAll~L~~~i~~~~~~~pi~l~~~~~~~~~~~~~~~~g~g~~~~~~~~~~~~~~~~~~~~~~~~~C~  157 (229)
T smart00020       78 IHPNYNPSTYDNDIALLKLKSPVTLSDNVRPICLPSSNYNVPAGTTCTVSGWGRTSEGAGSLPDTLQEVNVPIVSNATCR  157 (229)
T ss_pred             ECCCCCCCCCcCCEEEEEECcccCCCCceeeccCCCcccccCCCCEEEEEeCCCCCCCCCcCCCEeeEEEEEEeCHHHhh
Confidence            999999888899999999999999999999999998743 23578999999998763 2344668889999999999999


Q ss_pred             HHHhcCCCCCCCCCCeEEeeecCCCCCCCcCCCCCceEEEeeCCeEEEEEEEEeCCCCCCCCCCcEEeeCCCcHhHH
Q psy15291        212 EMFQTAGHAKTIINSFLCAGYANGQRDSCEGDSGGPLMIEREDGHWVLAGTVSHGIKCAAPYLPGVYMRTTYYKPWL  288 (295)
Q Consensus       212 ~~~~~~~~~~~~~~~~~Ca~~~~~~~~~C~gdsGgPl~~~~~~g~~~lvGi~S~g~~c~~~~~p~v~t~v~~~~~WI  288 (295)
                      ..+..   ...+.+.++|++........|.|||||||++.. + +|+|+||+|+|..|...+.|.+|++|++|++||
T Consensus       158 ~~~~~---~~~~~~~~~C~~~~~~~~~~c~gdsG~pl~~~~-~-~~~l~Gi~s~g~~C~~~~~~~~~~~i~~~~~WI  229 (229)
T smart00020      158 RAYSG---GGAITDNMLCAGGLEGGKDACQGDSGGPLVCND-G-RWVLVGIVSWGSGCARPGKPGVYTRVSSYLDWI  229 (229)
T ss_pred             hhhcc---ccccCCCcEeecCCCCCCcccCCCCCCeeEEEC-C-CEEEEEEEEECCCCCCCCCCCEEEEeccccccC
Confidence            87643   135788999998766457899999999999986 4 999999999999998667899999999999998


No 4  
>PF00089 Trypsin:  Trypsin;  InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This group of serine proteases belong to the MEROPS peptidase family S1 (chymotrypsin family, clan PA(S))and to peptidase family S6 (Hap serine peptidases). The chymotrypsin family is almost totally confined to animals, although trypsin-like enzymes are found in actinomycetes of the genera Streptomyces and Saccharopolyspora, and in the fungus Fusarium oxysporum []. The enzymes are inherently secreted, being synthesised with a signal peptide that targets them to the secretory pathway. Animal enzymes are either secreted directly, packaged into vesicles for regulated secretion, or are retained in leukocyte granules []. The Hap family, 'Haemophilus adhesion and penetration', are proteins that play a role in the interaction with human epithelial cells. The serine protease activity is localized at the N-terminal domain, whereas the binding domain is in the C-terminal region. ; GO: 0004252 serine-type endopeptidase activity, 0006508 proteolysis; PDB: 1SPJ_A 1A5I_A 2ZGH_A 2ZKS_A 2ZGJ_A 2ZGC_A 2ODP_A 2I6Q_A 2I6S_A 2ODQ_A ....
Probab=100.00  E-value=2.5e-41  Score=280.09  Aligned_cols=219  Identities=34%  Similarity=0.657  Sum_probs=187.5

Q ss_pred             cccccccCCCCCCcceeecccccccccceEEeeCCEEEEeCCCCCCCCCceEEEEceeecCCccccccceecceeEEEEC
Q psy15291         56 NIGIGCALPPPPPTVSRHTLYTLQFPQQDSMMTNFDMFTINLSKIGFLANLVAVFGEYDISGELEAKRSISKNVRRVIVH  135 (295)
Q Consensus        56 i~~g~~~~~~~~p~~~~~~~~~~~~~C~GtLIs~~~VLTAAhC~~~~~~~~~v~~g~~~~~~~~~~~~~~~~~v~~i~~h  135 (295)
                      |+||..+.+.++||++.+....+.+.|+|+||+++||||||||+.. ...+.+.+|.......  ....+.+.|..+++|
T Consensus         1 i~~g~~~~~~~~p~~v~i~~~~~~~~C~G~li~~~~vLTaahC~~~-~~~~~v~~g~~~~~~~--~~~~~~~~v~~~~~h   77 (220)
T PF00089_consen    1 IVGGDPASPGEFPWVVSIRYSNGRFFCTGTLISPRWVLTAAHCVDG-ASDIKVRLGTYSIRNS--DGSEQTIKVSKIIIH   77 (220)
T ss_dssp             SBSSEECGTTSSTTEEEEEETTTEEEEEEEEEETTEEEEEGGGHTS-GGSEEEEESESBTTST--TTTSEEEEEEEEEEE
T ss_pred             CCCCEECCCCCCCeEEEEeeCCCCeeEeEEeccccccccccccccc-cccccccccccccccc--ccccccccccccccc
Confidence            6899999999999999886666588999999999999999999987 4678888998444332  222467899999999


Q ss_pred             CCCCCCCCCCceEEEEecCCCCCCCCceeeecCCCCCC-CCCCEEEEEecccccCCCCCCCCcEEEEeeeeChhhHHHHH
Q psy15291        136 RQYDAATFENDIALLELETPIAYDSHIVPICMPKDDDD-FTGRVATVSGWGRLKYGGGVPSVLQEVQVPVIENNVCQEMF  214 (295)
Q Consensus       136 p~y~~~~~~~DiALlkL~~~i~~s~~v~picL~~~~~~-~~~~~~~~~Gwg~~~~~~~~~~~l~~~~~~~~~~~~C~~~~  214 (295)
                      |.|+.....+|||||+|++|+.+.+.+.|+||+..... ..+..+.++||+.....+ ....++...+.+++...|...+
T Consensus        78 ~~~~~~~~~~DiAll~L~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~G~~~~~~~~-~~~~~~~~~~~~~~~~~c~~~~  156 (220)
T PF00089_consen   78 PKYDPSTYDNDIALLKLDRPITFGDNIQPICLPSAGSDPNVGTSCIVVGWGRTSDNG-YSSNLQSVTVPVVSRKTCRSSY  156 (220)
T ss_dssp             TTSBTTTTTTSEEEEEESSSSEHBSSBEESBBTSTTHTTTTTSEEEEEESSBSSTTS-BTSBEEEEEEEEEEHHHHHHHT
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccccccccccccccc-cccccccccccccccccccccc
Confidence            99998888999999999999999999999999995542 358899999999876544 5568899999999999999874


Q ss_pred             hcCCCCCCCCCCeEEeeecCCCCCCCcCCCCCceEEEeeCCeEEEEEEEEeCCCCCCCCCCcEEeeCCCcHhHH
Q psy15291        215 QTAGHAKTIINSFLCAGYANGQRDSCEGDSGGPLMIEREDGHWVLAGTVSHGIKCAAPYLPGVYMRTTYYKPWL  288 (295)
Q Consensus       215 ~~~~~~~~~~~~~~Ca~~~~~~~~~C~gdsGgPl~~~~~~g~~~lvGi~S~g~~c~~~~~p~v~t~v~~~~~WI  288 (295)
                      .     ..+.+.++|+... +..+.|.|||||||++.+.    +|+||++++..|...+.|.+|++|+.|++||
T Consensus       157 ~-----~~~~~~~~c~~~~-~~~~~~~g~sG~pl~~~~~----~lvGI~s~~~~c~~~~~~~v~~~v~~~~~WI  220 (220)
T PF00089_consen  157 N-----DNLTPNMICAGSS-GSGDACQGDSGGPLICNNN----YLVGIVSFGENCGSPNYPGVYTRVSSYLDWI  220 (220)
T ss_dssp             T-----TTSTTTEEEEETT-SSSBGGTTTTTSEEEETTE----EEEEEEEEESSSSBTTSEEEEEEGGGGHHHH
T ss_pred             c-----ccccccccccccc-cccccccccccccccccee----eecceeeecCCCCCCCcCEEEEEHHHhhccC
Confidence            3     3478999999865 5578999999999999752    7999999999999887899999999999998


No 5  
>COG5640 Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=100.00  E-value=7.2e-34  Score=236.83  Aligned_cols=234  Identities=25%  Similarity=0.331  Sum_probs=168.1

Q ss_pred             hhhhcccccccCCCCCCcceeeccccc----ccccceEEeeCCEEEEeCCCCCCCC-CceEEEEceeecCCcccccccee
Q psy15291         52 ALCRNIGIGCALPPPPPTVSRHTLYTL----QFPQQDSMMTNFDMFTINLSKIGFL-ANLVAVFGEYDISGELEAKRSIS  126 (295)
Q Consensus        52 ~~~ri~~g~~~~~~~~p~~~~~~~~~~----~~~C~GtLIs~~~VLTAAhC~~~~~-~~~~v~~g~~~~~~~~~~~~~~~  126 (295)
                      ...||+||..|..++||.++.......    .-+|+|+++..|||||||||+.... -+..+..+..+++..   ...+.
T Consensus        29 vs~rIigGs~Anag~~P~~VaLv~~isd~~s~tfCGgs~l~~RYvLTAAHC~~~~s~is~d~~~vv~~l~d~---Sq~~r  105 (413)
T COG5640          29 VSSRIIGGSNANAGEYPSLVALVDRISDYVSGTFCGGSKLGGRYVLTAAHCADASSPISSDVNRVVVDLNDS---SQAER  105 (413)
T ss_pred             cceeEecCcccccccCchHHHHHhhcccccceeEeccceecceEEeeehhhccCCCCccccceEEEeccccc---ccccC
Confidence            468999999999999997665433222    2379999999999999999998753 333344444455442   24566


Q ss_pred             cceeEEEECCCCCCCCCCCceEEEEecCCCCCCCCceeeecCCCCC-----CCCCCEEEEEecccccCCC---CCC--CC
Q psy15291        127 KNVRRVIVHRQYDAATFENDIALLELETPIAYDSHIVPICMPKDDD-----DFTGRVATVSGWGRLKYGG---GVP--SV  196 (295)
Q Consensus       127 ~~v~~i~~hp~y~~~~~~~DiALlkL~~~i~~s~~v~picL~~~~~-----~~~~~~~~~~Gwg~~~~~~---~~~--~~  196 (295)
                      ..|..++.|..|.+.++.||+|+++|.++...- .+ .+-.....+     ..........+|+.+....   ..+  ..
T Consensus       106 g~vr~i~~~efY~~~n~~ND~Av~~l~~~a~~p-r~-ki~~~~~sdt~l~sv~~~s~~~n~t~~~~~~~~v~~~~p~gt~  183 (413)
T COG5640         106 GHVRTIYVHEFYSPGNLGNDIAVLELARAASLP-RV-KITSFDASDTFLNSVTTVSPMTNGTFGVTTPSDVPRSSPKGTI  183 (413)
T ss_pred             cceEEEeeecccccccccCcceeeccccccccc-hh-heeeccCcccceecccccccccceeeeeeeecCCCCCCCccce
Confidence            889999999999999999999999999866421 11 111111111     1113334456666544321   112  47


Q ss_pred             cEEEEeeeeChhhHHHHHhcCC-CCCCCCCCeEEeeecCCCCCCCcCCCCCceEEEeeCCeEEEEEEEEeCCC-CCCCCC
Q psy15291        197 LQEVQVPVIENNVCQEMFQTAG-HAKTIINSFLCAGYANGQRDSCEGDSGGPLMIEREDGHWVLAGTVSHGIK-CAAPYL  274 (295)
Q Consensus       197 l~~~~~~~~~~~~C~~~~~~~~-~~~~~~~~~~Ca~~~~~~~~~C~gdsGgPl~~~~~~g~~~lvGi~S~g~~-c~~~~~  274 (295)
                      +++..+..++...|...+.... ......-.-+|++...  .++|+||||||++...++|+ .++||+|||.+ |+....
T Consensus       184 l~e~~v~fv~~stc~~~~g~an~~dg~~~lT~~cag~~~--~daCqGDSGGPi~~~g~~G~-vQ~GVvSwG~~~Cg~t~~  260 (413)
T COG5640         184 LHEVAVLFVPLSTCAQYKGCANASDGATGLTGFCAGRPP--KDACQGDSGGPIFHKGEEGR-VQRGVVSWGDGGCGGTLI  260 (413)
T ss_pred             eeeeeeeeechHHhhhhccccccCCCCCCccceecCCCC--cccccCCCCCceEEeCCCcc-EEEeEEEecCCCCCCCCc
Confidence            8999999999999998885221 1122222339998654  69999999999999875565 78899999987 999999


Q ss_pred             CcEEeeCCCcHhHHhhhhC
Q psy15291        275 PGVYMRTTYYKPWLQTITG  293 (295)
Q Consensus       275 p~v~t~v~~~~~WI~~~~~  293 (295)
                      |.|||+|+.|.+||..+|+
T Consensus       261 ~gVyT~vsny~~WI~a~~~  279 (413)
T COG5640         261 PGVYTNVSNYQDWIAAMTN  279 (413)
T ss_pred             ceeEEehhHHHHHHHHHhc
Confidence            9999999999999998774


No 6  
>PF03761 DUF316:  Domain of unknown function (DUF316) ;  InterPro: IPR005514 This is a family of uncharacterised proteins from Caenorhabditis elegans.
Probab=99.82  E-value=3.8e-19  Score=152.97  Aligned_cols=214  Identities=17%  Similarity=0.327  Sum_probs=139.8

Q ss_pred             HHhhhhcccccccCCCCCCcceeecccc---cccccceEEeeCCEEEEeCCCCCCCCCce---------EEEEc------
Q psy15291         50 IEALCRNIGIGCALPPPPPTVSRHTLYT---LQFPQQDSMMTNFDMFTINLSKIGFLANL---------VAVFG------  111 (295)
Q Consensus        50 ~~~~~ri~~g~~~~~~~~p~~~~~~~~~---~~~~C~GtLIs~~~VLTAAhC~~~~~~~~---------~v~~g------  111 (295)
                      +....++..|..+...+.||++.+....   ..+.++|||||+||||||+||+......+         ...-+      
T Consensus        36 ~~~~~~~~~g~~~~~~~~pW~v~v~~~~~~~~~~~~~gtlIS~RHiLtss~~~~~~~~~W~~~~~~~~~~C~~~~~~l~v  115 (282)
T PF03761_consen   36 LPYPSKVFNGTPAESGEAPWAVSVYTKNHNEGNYFSTGTLISPRHILTSSHCVMNDKSKWLNGEEFDNKKCEGNNNHLIV  115 (282)
T ss_pred             CCCcccccCCcccccCCCCCEEEEEeccCcccceecceEEeccCeEEEeeeEEEecccccccCcccccceeeCCCceEEe
Confidence            3345567888888889999988764332   23567999999999999999997432211         00000      


Q ss_pred             -e-----eec--CCccccccceecceeEEEECCCC----CCCCCCCceEEEEecCCCCCCCCceeeecCCCCCCC-CCCE
Q psy15291        112 -E-----YDI--SGELEAKRSISKNVRRVIVHRQY----DAATFENDIALLELETPIAYDSHIVPICMPKDDDDF-TGRV  178 (295)
Q Consensus       112 -~-----~~~--~~~~~~~~~~~~~v~~i~~hp~y----~~~~~~~DiALlkL~~~i~~s~~v~picL~~~~~~~-~~~~  178 (295)
                       .     ..+  .............|.++++....    ......++++||+|+++  ++....|+|||...... .+..
T Consensus       116 P~~~l~~~~v~~~~~~~~~~~~~~~v~ka~il~~C~~~~~~~~~~~~~mIlEl~~~--~~~~~~~~Cl~~~~~~~~~~~~  193 (282)
T PF03761_consen  116 PEEVLSKIDVRCCNCFSNGKCFSIKVKKAYILNGCKKIKKNFNRPYSPMILELEED--FSKNVSPPCLADSSTNWEKGDE  193 (282)
T ss_pred             CHHHhccEEEEeecccccCCcccceeEEEEEEecCCCcccccccccceEEEEEccc--ccccCCCEEeCCCccccccCce
Confidence             0     000  00000111223456666654333    33445689999999999  67789999999887654 3667


Q ss_pred             EEEEecccccCCCCCCCCcEEEEeeeeChhhHHHHHhcCCCCCCCCCCeEEeeecCCCCCCCcCCCCCceEEEeeCCeEE
Q psy15291        179 ATVSGWGRLKYGGGVPSVLQEVQVPVIENNVCQEMFQTAGHAKTIINSFLCAGYANGQRDSCEGDSGGPLMIEREDGHWV  258 (295)
Q Consensus       179 ~~~~Gwg~~~~~~~~~~~l~~~~~~~~~~~~C~~~~~~~~~~~~~~~~~~Ca~~~~~~~~~C~gdsGgPl~~~~~~g~~~  258 (295)
                      +.++|+.       ....+....+.+.....|              ...+|     .....|.||+||||+... +|+|+
T Consensus       194 ~~~yg~~-------~~~~~~~~~~~i~~~~~~--------------~~~~~-----~~~~~~~~d~Gg~lv~~~-~gr~t  246 (282)
T PF03761_consen  194 VDVYGFN-------STGKLKHRKLKITNCTKC--------------AYSIC-----TKQYSCKGDRGGPLVKNI-NGRWT  246 (282)
T ss_pred             EEEeecC-------CCCeEEEEEEEEEEeecc--------------ceeEe-----cccccCCCCccCeEEEEE-CCCEE
Confidence            7788871       122445555555442221              11222     235789999999999987 89999


Q ss_pred             EEEEEEeCCC-CCCCCCCcEEeeCCCcHhHHhhhhCC
Q psy15291        259 LAGTVSHGIK-CAAPYLPGVYMRTTYYKPWLQTITGV  294 (295)
Q Consensus       259 lvGi~S~g~~-c~~~~~p~v~t~v~~~~~WI~~~~~~  294 (295)
                      |+||.+.+.. |...  ...|.+|..|.+=|.+.+|+
T Consensus       247 lIGv~~~~~~~~~~~--~~~f~~v~~~~~~IC~ltGI  281 (282)
T PF03761_consen  247 LIGVGASGNYECNKN--NSYFFNVSWYQDEICELTGI  281 (282)
T ss_pred             EEEEEccCCCccccc--ccEEEEHHHhhhhhccceec
Confidence            9999987753 4322  57899999999999999886


No 7  
>PF09342 DUF1986:  Domain of unknown function (DUF1986);  InterPro: IPR015420 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This domain is found in serine endopeptidases belonging to MEROPS peptidase family S1A (clan PA). It is found in unusual mosaic proteins, which are encoded by the Drosophila nudel gene (see P98159 from SWISSPROT). Nudel is involved in defining embryonic dorsoventral polarity. Three proteases; ndl, gd and snk process easter to create active easter. Active easter defines cell identities along the dorsal-ventral continuum by activating the spz ligand for the Tl receptor in the ventral region of the embryo. Nudel, pipe and windbeutel together trigger the protease cascade within the extraembryonic perivitelline compartment which induces dorsoventral polarity of the Drosophila embryo [].
Probab=99.62  E-value=8.4e-15  Score=117.31  Aligned_cols=116  Identities=12%  Similarity=0.134  Sum_probs=90.2

Q ss_pred             CCCCCCcceeecccccccccceEEeeCCEEEEeCCCCCCCC---CceEEEEceeecCCccccccceecceeEEEECCCCC
Q psy15291         63 LPPPPPTVSRHTLYTLQFPQQDSMMTNFDMFTINLSKIGFL---ANLVAVFGEYDISGELEAKRSISKNVRRVIVHRQYD  139 (295)
Q Consensus        63 ~~~~~p~~~~~~~~~~~~~C~GtLIs~~~VLTAAhC~~~~~---~~~~v~~g~~~~~~~~~~~~~~~~~v~~i~~hp~y~  139 (295)
                      ..-.|||.+.| ...|.|.|+|+||.++|||++..|+.+..   .-+.+.+|........+.+.+|.+.|+.+..-|   
T Consensus        12 e~y~WPWlA~I-YvdG~~~CsgvLlD~~WlLvsssCl~~I~L~~~YvsallG~~Kt~~~v~Gp~EQI~rVD~~~~V~---   87 (267)
T PF09342_consen   12 EDYHWPWLADI-YVDGRYWCSGVLLDPHWLLVSSSCLRGISLSHHYVSALLGGGKTYLSVDGPHEQISRVDCFKDVP---   87 (267)
T ss_pred             ccccCcceeeE-EEcCeEEEEEEEeccceEEEeccccCCcccccceEEEEecCcceecccCCChheEEEeeeeeecc---
Confidence            44459999976 67788999999999999999999998743   225778886554443456678888887776544   


Q ss_pred             CCCCCCceEEEEecCCCCCCCCceeeecCCCCCCC-CCCEEEEEeccc
Q psy15291        140 AATFENDIALLELETPIAYDSHIVPICMPKDDDDF-TGRVATVSGWGR  186 (295)
Q Consensus       140 ~~~~~~DiALlkL~~~i~~s~~v~picL~~~~~~~-~~~~~~~~Gwg~  186 (295)
                          ..+++||.|++|+.|+.+|.|..||....+. ....|..+|-..
T Consensus        88 ----~S~v~LLHL~~~~~fTr~VlP~flp~~~~~~~~~~~CVAVg~d~  131 (267)
T PF09342_consen   88 ----ESNVLLLHLEQPANFTRYVLPTFLPETSNENESDDECVAVGHDD  131 (267)
T ss_pred             ----ccceeeeeecCcccceeeecccccccccCCCCCCCceEEEEccc
Confidence                3899999999999999999999999744332 356899988654


No 8  
>COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism]
Probab=99.37  E-value=3.1e-12  Score=105.12  Aligned_cols=199  Identities=14%  Similarity=0.071  Sum_probs=111.8

Q ss_pred             CCCCCCc--ceeecccccccccceEEeeCCEEEEeCCCCCCCCCceEEEEceeecCCccccccceecceeEEEE--CCC-
Q psy15291         63 LPPPPPT--VSRHTLYTLQFPQQDSMMTNFDMFTINLSKIGFLANLVAVFGEYDISGELEAKRSISKNVRRVIV--HRQ-  137 (295)
Q Consensus        63 ~~~~~p~--~~~~~~~~~~~~C~GtLIs~~~VLTAAhC~~~~~~~~~v~~g~~~~~~~~~~~~~~~~~v~~i~~--hp~-  137 (295)
                      ....+||  |+...+..|.+-|+++||+|+.||||+||+..................   ........+..+..  .|. 
T Consensus        45 dt~~~Py~av~~~~~~tG~~~~~~~lI~pntvLTa~Hc~~s~~~G~~~~~~~p~g~~---~~~~~~~~~~~~~~~~~~g~  121 (251)
T COG3591          45 DTTQFPYSAVVQFEAATGRLCTAATLIGPNTVLTAGHCIYSPDYGEDDIAAAPPGVN---SDGGPFYGITKIEIRVYPGE  121 (251)
T ss_pred             cCCCCCcceeEEeecCCCcceeeEEEEcCceEEEeeeEEecCCCChhhhhhcCCccc---CCCCCCCceeeEEEEecCCc
Confidence            3455776  555678888887788999999999999999775421111111110000   01122223333222  333 


Q ss_pred             -CCCCCCCCceEEEEecCCCCCCCCceeeecCCCCCCCCCCEEEEEecccccCCCCCCCCcEEEEeeeeChhhHHHHHhc
Q psy15291        138 -YDAATFENDIALLELETPIAYDSHIVPICMPKDDDDFTGRVATVSGWGRLKYGGGVPSVLQEVQVPVIENNVCQEMFQT  216 (295)
Q Consensus       138 -y~~~~~~~DiALlkL~~~i~~s~~v~picL~~~~~~~~~~~~~~~Gwg~~~~~~~~~~~l~~~~~~~~~~~~C~~~~~~  216 (295)
                       |.......|+..+.|+....+.+......++.......+....++||-.....     .++.       .+.|...   
T Consensus       122 ~~~~d~~~~~v~~~~~~~g~~~~~~~~~~~~~~~~~~~~~d~i~v~GYP~dk~~-----~~~~-------~e~t~~v---  186 (251)
T COG3591         122 LYKEDGASYDVGEAALESGINIGDVVNYLKRNTASEAKANDRITVIGYPGDKPN-----IGTM-------WESTGKV---  186 (251)
T ss_pred             eeccCCceeeccHHHhccCCCccccccccccccccccccCceeEEEeccCCCCc-----ceeE-------eeeccee---
Confidence             33444567777777775555556666556665555555566889998532210     1110       0111111   


Q ss_pred             CCCCCCCCCCeEEeeecCCCCCCCcCCCCCceEEEeeCCeEEEEEEEEeCCCCCCCCCCcEEeeCCC-cHhHHhhhh
Q psy15291        217 AGHAKTIINSFLCAGYANGQRDSCEGDSGGPLMIEREDGHWVLAGTVSHGIKCAAPYLPGVYMRTTY-YKPWLQTIT  292 (295)
Q Consensus       217 ~~~~~~~~~~~~Ca~~~~~~~~~C~gdsGgPl~~~~~~g~~~lvGi~S~g~~c~~~~~p~v~t~v~~-~~~WI~~~~  292 (295)
                          ..+....+-     -..++|+|+||+|++....    +++||.+-|+.-.........+++.. +++||++.+
T Consensus       187 ----~~~~~~~l~-----y~~dT~pG~SGSpv~~~~~----~vigv~~~g~~~~~~~~~n~~vr~t~~~~~~I~~~~  250 (251)
T COG3591         187 ----NSIKGNKLF-----YDADTLPGSSGSPVLISKD----EVIGVHYNGPGANGGSLANNAVRLTPEILNFIQQNI  250 (251)
T ss_pred             ----EEEecceEE-----EEecccCCCCCCceEecCc----eEEEEEecCCCcccccccCcceEecHHHHHHHHHhh
Confidence                011111111     1368999999999999753    89999998875322222344556555 779998875


No 9  
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family. This family consists of a set proteins various designated DegP, heat shock protein HtrA, and protease DO. The ortholog in Pseudomonas aeruginosa is designated MucD and is found in an operon that controls mucoid phenotype. This family also includes the DegQ (HhoA) paralog in E. coli which can rescue a DegP mutant, but not the smaller DegS paralog, which cannot. Members of this family are located in the periplasm and have separable functions as both protease and chaperone. Members have a trypsin domain and two copies of a PDZ domain. This protein protects bacteria from thermal and other stresses and may be important for the survival of bacterial pathogens.// The chaperone function is dominant at low temperatures, whereas the proteolytic activity is turned on at elevated temperatures.
Probab=98.83  E-value=4.3e-08  Score=89.26  Aligned_cols=142  Identities=15%  Similarity=0.122  Sum_probs=84.3

Q ss_pred             ccccceEEeeCC-EEEEeCCCCCCCCCceEEEEceeecCCccccccceecceeEEEECCCCCCCCCCCceEEEEecCCCC
Q psy15291         79 QFPQQDSMMTNF-DMFTINLSKIGFLANLVAVFGEYDISGELEAKRSISKNVRRVIVHRQYDAATFENDIALLELETPIA  157 (295)
Q Consensus        79 ~~~C~GtLIs~~-~VLTAAhC~~~~~~~~~v~~g~~~~~~~~~~~~~~~~~v~~i~~hp~y~~~~~~~DiALlkL~~~i~  157 (295)
                      ...++|.+|+++ ||||++|++.+. ..+.|.+..           ...+.+.-+..++       ..|||||+++.+  
T Consensus        57 ~~~GSGfii~~~G~IlTn~Hvv~~~-~~i~V~~~~-----------~~~~~a~vv~~d~-------~~DlAllkv~~~--  115 (428)
T TIGR02037        57 RGLGSGVIISADGYILTNNHVVDGA-DEITVTLSD-----------GREFKAKLVGKDP-------RTDIAVLKIDAK--  115 (428)
T ss_pred             cceeeEEEECCCCEEEEcHHHcCCC-CeEEEEeCC-----------CCEEEEEEEEecC-------CCCEEEEEecCC--
Confidence            457999999976 999999999875 455555432           1123344343443       379999999865  


Q ss_pred             CCCCceeeecCCCCCCCCCCEEEEEecccccCCCCCCCCcEEEEeeeeChhhHHHHHhcCCCCCCCCCCeEEeeecCCCC
Q psy15291        158 YDSHIVPICMPKDDDDFTGRVATVSGWGRLKYGGGVPSVLQEVQVPVIENNVCQEMFQTAGHAKTIINSFLCAGYANGQR  237 (295)
Q Consensus       158 ~s~~v~picL~~~~~~~~~~~~~~~Gwg~~~~~~~~~~~l~~~~~~~~~~~~C~~~~~~~~~~~~~~~~~~Ca~~~~~~~  237 (295)
                        ..+.++.|.+......++.++++|+....     ...+....+.-.....    ..     ......++=.     +.
T Consensus       116 --~~~~~~~l~~~~~~~~G~~v~aiG~p~g~-----~~~~t~G~vs~~~~~~----~~-----~~~~~~~i~t-----da  174 (428)
T TIGR02037       116 --KNLPVIKLGDSDKLRVGDWVLAIGNPFGL-----GQTVTSGIVSALGRSG----LG-----IGDYENFIQT-----DA  174 (428)
T ss_pred             --CCceEEEccCCCCCCCCCEEEEEECCCcC-----CCcEEEEEEEecccCc----cC-----CCCccceEEE-----CC
Confidence              24567888766554579999999985321     1122222222111100    00     0000112211     13


Q ss_pred             CCCcCCCCCceEEEeeCCeEEEEEEEEeC
Q psy15291        238 DSCEGDSGGPLMIEREDGHWVLAGTVSHG  266 (295)
Q Consensus       238 ~~C~gdsGgPl~~~~~~g~~~lvGi~S~g  266 (295)
                      ..-+|.|||||+..  +|  .++||++..
T Consensus       175 ~i~~GnSGGpl~n~--~G--~viGI~~~~  199 (428)
T TIGR02037       175 AINPGNSGGPLVNL--RG--EVIGINTAI  199 (428)
T ss_pred             CCCCCCCCCceECC--CC--eEEEEEeEE
Confidence            45679999999865  45  799998764


No 10 
>TIGR02038 protease_degS periplasmic serine pepetdase DegS. This family consists of the periplasmic serine protease DegS (HhoB), a shorter paralog of protease DO (HtrA, DegP) and DegQ (HhoA). It is found in E. coli and several other Proteobacteria of the gamma subdivision. It contains a trypsin domain and a single copy of PDZ domain (in contrast to DegP with two copies). A critical role of this DegS is to sense stress in the periplasm and partially degrade an inhibitor of sigma(E).
Probab=98.68  E-value=3.1e-07  Score=81.27  Aligned_cols=141  Identities=16%  Similarity=0.134  Sum_probs=80.1

Q ss_pred             cccceEEeeCC-EEEEeCCCCCCCCCceEEEEceeecCCccccccceecceeEEEECCCCCCCCCCCceEEEEecCCCCC
Q psy15291         80 FPQQDSMMTNF-DMFTINLSKIGFLANLVAVFGEYDISGELEAKRSISKNVRRVIVHRQYDAATFENDIALLELETPIAY  158 (295)
Q Consensus        80 ~~C~GtLIs~~-~VLTAAhC~~~~~~~~~v~~g~~~~~~~~~~~~~~~~~v~~i~~hp~y~~~~~~~DiALlkL~~~i~~  158 (295)
                      ...+|.+|+++ +|||++|.+.+. ..+.|.+.+           +..+...-+..+|       ..|||||+++.+-  
T Consensus        78 ~~GSG~vi~~~G~IlTn~HVV~~~-~~i~V~~~d-----------g~~~~a~vv~~d~-------~~DlAvlkv~~~~--  136 (351)
T TIGR02038        78 GLGSGVIMSKEGYILTNYHVIKKA-DQIVVALQD-----------GRKFEAELVGSDP-------LTDLAVLKIEGDN--  136 (351)
T ss_pred             ceEEEEEEeCCeEEEecccEeCCC-CEEEEEECC-----------CCEEEEEEEEecC-------CCCEEEEEecCCC--
Confidence            35899999976 999999999764 445555432           1223344344443       4899999998542  


Q ss_pred             CCCceeeecCCCCCCCCCCEEEEEecccccCCCCCCCCcEEEEeeeeChhhHHHHHhcCCCCCCCCCCeEEeeecCCCCC
Q psy15291        159 DSHIVPICMPKDDDDFTGRVATVSGWGRLKYGGGVPSVLQEVQVPVIENNVCQEMFQTAGHAKTIINSFLCAGYANGQRD  238 (295)
Q Consensus       159 s~~v~picL~~~~~~~~~~~~~~~Gwg~~~~~~~~~~~l~~~~~~~~~~~~C~~~~~~~~~~~~~~~~~~Ca~~~~~~~~  238 (295)
                         +.++.|........++.+.++|+....     ........+..+...    .+.     ..-....+=.     +..
T Consensus       137 ---~~~~~l~~s~~~~~G~~V~aiG~P~~~-----~~s~t~GiIs~~~r~----~~~-----~~~~~~~iqt-----da~  194 (351)
T TIGR02038       137 ---LPTIPVNLDRPPHVGDVVLAIGNPYNL-----GQTITQGIISATGRN----GLS-----SVGRQNFIQT-----DAA  194 (351)
T ss_pred             ---CceEeccCcCccCCCCEEEEEeCCCCC-----CCcEEEEEEEeccCc----ccC-----CCCcceEEEE-----CCc
Confidence               334555444333469999999985321     112222222211110    000     0000111211     235


Q ss_pred             CCcCCCCCceEEEeeCCeEEEEEEEEeCC
Q psy15291        239 SCEGDSGGPLMIEREDGHWVLAGTVSHGI  267 (295)
Q Consensus       239 ~C~gdsGgPl~~~~~~g~~~lvGi~S~g~  267 (295)
                      ..+|.|||||+..  +|  .|+||++...
T Consensus       195 i~~GnSGGpl~n~--~G--~vIGI~~~~~  219 (351)
T TIGR02038       195 INAGNSGGALINT--NG--ELVGINTASF  219 (351)
T ss_pred             cCCCCCcceEECC--CC--eEEEEEeeee
Confidence            5689999999976  34  7999997643


No 11 
>PRK10898 serine endoprotease; Provisional
Probab=98.63  E-value=8.1e-07  Score=78.62  Aligned_cols=141  Identities=15%  Similarity=0.099  Sum_probs=79.3

Q ss_pred             cccceEEeeCC-EEEEeCCCCCCCCCceEEEEceeecCCccccccceecceeEEEECCCCCCCCCCCceEEEEecCCCCC
Q psy15291         80 FPQQDSMMTNF-DMFTINLSKIGFLANLVAVFGEYDISGELEAKRSISKNVRRVIVHRQYDAATFENDIALLELETPIAY  158 (295)
Q Consensus        80 ~~C~GtLIs~~-~VLTAAhC~~~~~~~~~v~~g~~~~~~~~~~~~~~~~~v~~i~~hp~y~~~~~~~DiALlkL~~~i~~  158 (295)
                      ..-+|.+|+++ +|||++|-+.+. ..+.|.+.+           +..+...-+..+|       .+|||||+++.+   
T Consensus        78 ~~GSGfvi~~~G~IlTn~HVv~~a-~~i~V~~~d-----------g~~~~a~vv~~d~-------~~DlAvl~v~~~---  135 (353)
T PRK10898         78 TLGSGVIMDQRGYILTNKHVINDA-DQIIVALQD-----------GRVFEALLVGSDS-------LTDLAVLKINAT---  135 (353)
T ss_pred             ceeeEEEEeCCeEEEecccEeCCC-CEEEEEeCC-----------CCEEEEEEEEEcC-------CCCEEEEEEcCC---
Confidence            45889999976 999999999764 556665532           1123333344443       389999999754   


Q ss_pred             CCCceeeecCCCCCCCCCCEEEEEecccccCCCCCCCCcEEEEeeeeChhhHHHHHhcCCCCCCCCCCeEEeeecCCCCC
Q psy15291        159 DSHIVPICMPKDDDDFTGRVATVSGWGRLKYGGGVPSVLQEVQVPVIENNVCQEMFQTAGHAKTIINSFLCAGYANGQRD  238 (295)
Q Consensus       159 s~~v~picL~~~~~~~~~~~~~~~Gwg~~~~~~~~~~~l~~~~~~~~~~~~C~~~~~~~~~~~~~~~~~~Ca~~~~~~~~  238 (295)
                        .+.++.|........++.+.++|+.....     .......+.-...    ....     ..-...++-.     +..
T Consensus       136 --~l~~~~l~~~~~~~~G~~V~aiG~P~g~~-----~~~t~Giis~~~r----~~~~-----~~~~~~~iqt-----da~  194 (353)
T PRK10898        136 --NLPVIPINPKRVPHIGDVVLAIGNPYNLG-----QTITQGIISATGR----IGLS-----PTGRQNFLQT-----DAS  194 (353)
T ss_pred             --CCCeeeccCcCcCCCCCEEEEEeCCCCcC-----CCcceeEEEeccc----cccC-----CccccceEEe-----ccc
Confidence              13345554443334689999999853211     1111111111110    0000     0000112211     235


Q ss_pred             CCcCCCCCceEEEeeCCeEEEEEEEEeCC
Q psy15291        239 SCEGDSGGPLMIEREDGHWVLAGTVSHGI  267 (295)
Q Consensus       239 ~C~gdsGgPl~~~~~~g~~~lvGi~S~g~  267 (295)
                      ..+|.|||||+..  +|  .++||++...
T Consensus       195 i~~GnSGGPl~n~--~G--~vvGI~~~~~  219 (353)
T PRK10898        195 INHGNSGGALVNS--LG--ELMGINTLSF  219 (353)
T ss_pred             cCCCCCcceEECC--CC--eEEEEEEEEe
Confidence            5679999999875  44  7999998643


No 12 
>PRK10139 serine endoprotease; Provisional
Probab=98.56  E-value=8.1e-07  Score=81.14  Aligned_cols=140  Identities=16%  Similarity=0.151  Sum_probs=82.7

Q ss_pred             ccceEEeeC--CEEEEeCCCCCCCCCceEEEEceeecCCccccccceecceeEEEECCCCCCCCCCCceEEEEecCCCCC
Q psy15291         81 PQQDSMMTN--FDMFTINLSKIGFLANLVAVFGEYDISGELEAKRSISKNVRRVIVHRQYDAATFENDIALLELETPIAY  158 (295)
Q Consensus        81 ~C~GtLIs~--~~VLTAAhC~~~~~~~~~v~~g~~~~~~~~~~~~~~~~~v~~i~~hp~y~~~~~~~DiALlkL~~~i~~  158 (295)
                      ..+|.+|++  .||||++|.+.+. ..+.|.+.+           +..+...-+...|       ..|||||+++.+-  
T Consensus        91 ~GSG~ii~~~~g~IlTn~HVv~~a-~~i~V~~~d-----------g~~~~a~vvg~D~-------~~DlAvlkv~~~~--  149 (455)
T PRK10139         91 LGSGVIIDAAKGYVLTNNHVINQA-QKISIQLND-----------GREFDAKLIGSDD-------QSDIALLQIQNPS--  149 (455)
T ss_pred             eEEEEEEECCCCEEEeChHHhCCC-CEEEEEECC-----------CCEEEEEEEEEcC-------CCCEEEEEecCCC--
Confidence            588999974  6999999999765 556666532           1123444444443       4899999998542  


Q ss_pred             CCCceeeecCCCCCCCCCCEEEEEecccccCCCCCCCCcEEEEeeeeChhhHHHHHhcCCCCCCCCCCeEEeeecCCCCC
Q psy15291        159 DSHIVPICMPKDDDDFTGRVATVSGWGRLKYGGGVPSVLQEVQVPVIENNVCQEMFQTAGHAKTIINSFLCAGYANGQRD  238 (295)
Q Consensus       159 s~~v~picL~~~~~~~~~~~~~~~Gwg~~~~~~~~~~~l~~~~~~~~~~~~C~~~~~~~~~~~~~~~~~~Ca~~~~~~~~  238 (295)
                        .+.++.|.+......++.+.++|+....     .....   .-+++...= ....     ..-....+-+     +..
T Consensus       150 --~l~~~~lg~s~~~~~G~~V~aiG~P~g~-----~~tvt---~GivS~~~r-~~~~-----~~~~~~~iqt-----da~  208 (455)
T PRK10139        150 --KLTQIAIADSDKLRVGDFAVAVGNPFGL-----GQTAT---SGIISALGR-SGLN-----LEGLENFIQT-----DAS  208 (455)
T ss_pred             --CCceeEecCccccCCCCEEEEEecCCCC-----CCceE---EEEEccccc-cccC-----CCCcceEEEE-----CCc
Confidence              3456777665554469999999974211     11122   223321100 0000     0000122222     245


Q ss_pred             CCcCCCCCceEEEeeCCeEEEEEEEEeC
Q psy15291        239 SCEGDSGGPLMIEREDGHWVLAGTVSHG  266 (295)
Q Consensus       239 ~C~gdsGgPl~~~~~~g~~~lvGi~S~g  266 (295)
                      ..+|.|||||+...  |  .|+||++..
T Consensus       209 in~GnSGGpl~n~~--G--~vIGi~~~~  232 (455)
T PRK10139        209 INRGNSGGALLNLN--G--ELIGINTAI  232 (455)
T ss_pred             cCCCCCcceEECCC--C--eEEEEEEEE
Confidence            66899999999863  4  799999874


No 13 
>PF13365 Trypsin_2:  Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A ....
Probab=98.54  E-value=1.5e-07  Score=69.77  Aligned_cols=21  Identities=5%  Similarity=-0.083  Sum_probs=19.3

Q ss_pred             cceEEeeCC-EEEEeCCCCCCC
Q psy15291         82 QQDSMMTNF-DMFTINLSKIGF  102 (295)
Q Consensus        82 C~GtLIs~~-~VLTAAhC~~~~  102 (295)
                      |+|.+|+++ +|||||||+...
T Consensus         1 GTGf~i~~~g~ilT~~Hvv~~~   22 (120)
T PF13365_consen    1 GTGFLIGPDGYILTAAHVVEDW   22 (120)
T ss_dssp             EEEEEEETTTEEEEEHHHHTCC
T ss_pred             CEEEEEcCCceEEEchhheecc
Confidence            689999999 999999999864


No 14 
>PRK10942 serine endoprotease; Provisional
Probab=98.44  E-value=2.3e-06  Score=78.63  Aligned_cols=141  Identities=17%  Similarity=0.143  Sum_probs=80.8

Q ss_pred             cccceEEeeC--CEEEEeCCCCCCCCCceEEEEceeecCCccccccceecceeEEEECCCCCCCCCCCceEEEEecCCCC
Q psy15291         80 FPQQDSMMTN--FDMFTINLSKIGFLANLVAVFGEYDISGELEAKRSISKNVRRVIVHRQYDAATFENDIALLELETPIA  157 (295)
Q Consensus        80 ~~C~GtLIs~--~~VLTAAhC~~~~~~~~~v~~g~~~~~~~~~~~~~~~~~v~~i~~hp~y~~~~~~~DiALlkL~~~i~  157 (295)
                      ...+|.+|++  .+|||++|.+.+. ..+.|.+.+           +..+...-+..+|       ..|||||+++.+- 
T Consensus       111 ~~GSG~ii~~~~G~IlTn~HVv~~a-~~i~V~~~d-----------g~~~~a~vv~~D~-------~~DlAvlki~~~~-  170 (473)
T PRK10942        111 ALGSGVIIDADKGYVVTNNHVVDNA-TKIKVQLSD-----------GRKFDAKVVGKDP-------RSDIALIQLQNPK-  170 (473)
T ss_pred             ceEEEEEEECCCCEEEeChhhcCCC-CEEEEEECC-----------CCEEEEEEEEecC-------CCCEEEEEecCCC-
Confidence            4689999985  5999999999765 556666542           1123334344444       4899999997533 


Q ss_pred             CCCCceeeecCCCCCCCCCCEEEEEecccccCCCCCCCCcEEEEeeeeChhhHHHHHhcCCCCCCCCCCeEEeeecCCCC
Q psy15291        158 YDSHIVPICMPKDDDDFTGRVATVSGWGRLKYGGGVPSVLQEVQVPVIENNVCQEMFQTAGHAKTIINSFLCAGYANGQR  237 (295)
Q Consensus       158 ~s~~v~picL~~~~~~~~~~~~~~~Gwg~~~~~~~~~~~l~~~~~~~~~~~~C~~~~~~~~~~~~~~~~~~Ca~~~~~~~  237 (295)
                         .+.++.|.+......++.+.++|+....     ........+.-+...    ...     ..-...++-.     +.
T Consensus       171 ---~l~~~~lg~s~~l~~G~~V~aiG~P~g~-----~~tvt~GiVs~~~r~----~~~-----~~~~~~~iqt-----da  228 (473)
T PRK10942        171 ---NLTAIKMADSDALRVGDYTVAIGNPYGL-----GETVTSGIVSALGRS----GLN-----VENYENFIQT-----DA  228 (473)
T ss_pred             ---CCceeEecCccccCCCCEEEEEcCCCCC-----CcceeEEEEEEeecc----cCC-----cccccceEEe-----cc
Confidence               2346667655544468999999874211     111111222111110    000     0000122222     13


Q ss_pred             CCCcCCCCCceEEEeeCCeEEEEEEEEeC
Q psy15291        238 DSCEGDSGGPLMIEREDGHWVLAGTVSHG  266 (295)
Q Consensus       238 ~~C~gdsGgPl~~~~~~g~~~lvGi~S~g  266 (295)
                      ..-+|.|||||+...  |  .|+||.+..
T Consensus       229 ~i~~GnSGGpL~n~~--G--eviGI~t~~  253 (473)
T PRK10942        229 AINRGNSGGALVNLN--G--ELIGINTAI  253 (473)
T ss_pred             ccCCCCCcCccCCCC--C--eEEEEEEEE
Confidence            455799999999763  4  799999863


No 15 
>PF02395 Peptidase_S6:  Immunoglobulin A1 protease Serine protease Prosite pattern;  InterPro: IPR000710 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This group of serine peptidases belong to the MEROPS peptidase family S6 (clan PA(S)). The type sample being the IgA1-specific serine endopeptidase from Neisseria gonorrhoeae []. These cleave prolyl bonds in the hinge regions of immunoglobulin A heavy chains. Similar specificity is shown by the unrelated family of M26 metalloendopeptidases.; GO: 0004252 serine-type endopeptidase activity, 0006508 proteolysis; PDB: 3SZE_A 3H09_B 3SYJ_A 1WXR_A 3AK5_B.
Probab=97.29  E-value=0.00093  Score=64.49  Aligned_cols=65  Identities=11%  Similarity=0.159  Sum_probs=37.1

Q ss_pred             eEEeeCCEEEEeCCCCCCCCCceEEEEceeecCCccccccceecceeEEEECCCCCCCCCCCceEEEEecCCCCCCCCce
Q psy15291         84 DSMMTNFDMFTINLSKIGFLANLVAVFGEYDISGELEAKRSISKNVRRVIVHRQYDAATFENDIALLELETPIAYDSHIV  163 (295)
Q Consensus        84 GtLIs~~~VLTAAhC~~~~~~~~~v~~g~~~~~~~~~~~~~~~~~v~~i~~hp~y~~~~~~~DiALlkL~~~i~~s~~v~  163 (295)
                      +|||+|++|+|++|=...+   -.|.+|....         ..+.+..--.|+.       .|+.+-||++=+.   .+.
T Consensus        69 aTLigpqYiVSV~HN~~gy---~~v~FG~~g~---------~~Y~iV~RNn~~~-------~Df~~pRLnK~VT---Eva  126 (769)
T PF02395_consen   69 ATLIGPQYIVSVKHNGKGY---NSVSFGNEGQ---------NTYKIVDRNNYPS-------GDFHMPRLNKFVT---EVA  126 (769)
T ss_dssp             -EEEETTEEEBETTG-TSC---CEECESCSST---------CEEEEEEEEBETT-------STEBEEEESS------SS-
T ss_pred             EEEecCCeEEEEEccCCCc---CceeecccCC---------ceEEEEEccCCCC-------cccceeecCceEE---EEe
Confidence            8999999999999998322   3555665322         2344444444443       6999999998654   466


Q ss_pred             eeecCCC
Q psy15291        164 PICMPKD  170 (295)
Q Consensus       164 picL~~~  170 (295)
                      |+.+...
T Consensus       127 P~~~t~~  133 (769)
T PF02395_consen  127 PAEMTTA  133 (769)
T ss_dssp             ---BBSS
T ss_pred             ccccccc
Confidence            7766555


No 16 
>PF00863 Peptidase_C4:  Peptidase family C4 This family belongs to family C4 of the peptidase classification.;  InterPro: IPR001730 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  Nuclear inclusion A (NIA) proteases from potyviruses are cysteine peptidases belong to the MEROPS peptidase family C4 (NIa protease family, clan PA(C)) [, ].  Potyviruses include plant viruses in which the single-stranded RNA encodes a polyprotein with NIA protease activity, where proteolytic cleavage is specific for Gln+Gly sites. The NIA protease acts on the polyprotein, releasing itself by Gln+Gly cleavage at both the N- and C-termini. It further processes the polyprotein by cleavage at five similar sites in the C-terminal half of the sequence. In addition to its C-terminal protease activity, the NIA protease contains an N-terminal domain that has been implicated in the transcription process []. This peptidase is present in the nuclear inclusion protein of potyviruses.; GO: 0008234 cysteine-type peptidase activity, 0006508 proteolysis; PDB: 3MMG_B 1Q31_B 1LVB_A 1LVM_A.
Probab=96.34  E-value=0.092  Score=43.41  Aligned_cols=149  Identities=15%  Similarity=0.141  Sum_probs=68.8

Q ss_pred             EEeeCCEEEEeCCCCCCCCCceEEEE--ceeecCCccccccceecceeEEEECCCCCCCCCCCceEEEEecCCCCCCCCc
Q psy15291         85 SMMTNFDMFTINLSKIGFLANLVAVF--GEYDISGELEAKRSISKNVRRVIVHRQYDAATFENDIALLELETPIAYDSHI  162 (295)
Q Consensus        85 tLIs~~~VLTAAhC~~~~~~~~~v~~--g~~~~~~~~~~~~~~~~~v~~i~~hp~y~~~~~~~DiALlkL~~~i~~s~~v  162 (295)
                      -+.-..||||-+|-|......+.+..  |.+.+.+.           .++.+||-     ...||.||+|..+++  ++-
T Consensus        36 gigyG~~iItn~HLf~~nng~L~i~s~hG~f~v~nt-----------~~lkv~~i-----~~~DiviirmPkDfp--Pf~   97 (235)
T PF00863_consen   36 GIGYGSYIITNAHLFKRNNGELTIKSQHGEFTVPNT-----------TQLKVHPI-----EGRDIVIIRMPKDFP--PFP   97 (235)
T ss_dssp             EEEETTEEEEEGGGGSSTTCEEEEEETTEEEEECEG-----------GGSEEEE------TCSSEEEEE--TTS------
T ss_pred             EEeECCEEEEChhhhccCCCeEEEEeCceEEEcCCc-----------cccceEEe-----CCccEEEEeCCcccC--Ccc
Confidence            45678999999999987766666654  33443321           12223332     258999999988664  222


Q ss_pred             eeeecCCCCCCCCCCEEEEEecccccCCCCCCCCcEEEEeeeeChhhHHHHHhcCCCCCCCCCCeEEeeecCCCCCCCcC
Q psy15291        163 VPICMPKDDDDFTGRVATVSGWGRLKYGGGVPSVLQEVQVPVIENNVCQEMFQTAGHAKTIINSFLCAGYANGQRDSCEG  242 (295)
Q Consensus       163 ~picL~~~~~~~~~~~~~~~Gwg~~~~~~~~~~~l~~~~~~~~~~~~C~~~~~~~~~~~~~~~~~~Ca~~~~~~~~~C~g  242 (295)
                      +-+++-   .+..++.+.++|-.....  .......+.  ..+... ..             .+...     ...++=.|
T Consensus        98 ~kl~FR---~P~~~e~v~mVg~~fq~k--~~~s~vSes--S~i~p~-~~-------------~~fWk-----HwIsTk~G  151 (235)
T PF00863_consen   98 QKLKFR---APKEGERVCMVGSNFQEK--SISSTVSES--SWIYPE-EN-------------SHFWK-----HWISTKDG  151 (235)
T ss_dssp             S---B-------TT-EEEEEEEECSSC--CCEEEEEEE--EEEEEE-TT-------------TTEEE-----E-C---TT
T ss_pred             hhhhcc---CCCCCCEEEEEEEEEEcC--CeeEEECCc--eEEeec-CC-------------CCeeE-----EEecCCCC
Confidence            222221   112366777777643321  111111111  111110 00             00100     01344468


Q ss_pred             CCCCceEEEeeCCeEEEEEEEEeCCCCCCCCCCcEEeeCCC
Q psy15291        243 DSGGPLMIEREDGHWVLAGTVSHGIKCAAPYLPGVYMRTTY  283 (295)
Q Consensus       243 dsGgPl~~~~~~g~~~lvGi~S~g~~c~~~~~p~v~t~v~~  283 (295)
                      |=|.||+... +|  .+|||.|.+..-..   -.+|+.+..
T Consensus       152 ~CG~PlVs~~-Dg--~IVGiHsl~~~~~~---~N~F~~f~~  186 (235)
T PF00863_consen  152 DCGLPLVSTK-DG--KIVGIHSLTSNTSS---RNYFTPFPD  186 (235)
T ss_dssp             -TT-EEEETT-T----EEEEEEEEETTTS---SEEEEE--T
T ss_pred             ccCCcEEEcC-CC--cEEEEEcCccCCCC---eEEEEcCCH
Confidence            8899999976 77  79999997654332   347887765


No 17 
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones]
Probab=94.52  E-value=0.68  Score=41.08  Aligned_cols=146  Identities=16%  Similarity=0.115  Sum_probs=78.6

Q ss_pred             ccccceEEee-CCEEEEeCCCCCCCCCceEEEEceeecCCccccccceecceeEEEECCCCCCCCCCCceEEEEecCCCC
Q psy15291         79 QFPQQDSMMT-NFDMFTINLSKIGFLANLVAVFGEYDISGELEAKRSISKNVRRVIVHRQYDAATFENDIALLELETPIA  157 (295)
Q Consensus        79 ~~~C~GtLIs-~~~VLTAAhC~~~~~~~~~v~~g~~~~~~~~~~~~~~~~~v~~i~~hp~y~~~~~~~DiALlkL~~~i~  157 (295)
                      ....+|.+++ ..+|||-.|=+.. ...+.+.+.+           +..+...-+-..       ...|+|+++.+..-.
T Consensus        71 ~~~gSg~i~~~~g~ivTn~hVi~~-a~~i~v~l~d-----------g~~~~a~~vg~d-------~~~dlavlki~~~~~  131 (347)
T COG0265          71 EGLGSGFIISSDGYIVTNNHVIAG-AEEITVTLAD-----------GREVPAKLVGKD-------PISDLAVLKIDGAGG  131 (347)
T ss_pred             cccccEEEEcCCeEEEecceecCC-cceEEEEeCC-----------CCEEEEEEEecC-------CccCEEEEEeccCCC
Confidence            3568899998 8899999999987 5666665511           122233333222       348999999986532


Q ss_pred             CCCCceeeecCCCCCCCCCCEEEEEecccccCCCCCCCCcEEEEeeeeChhhHHHHHhcCCCCCCCCCCeEEeeecCCCC
Q psy15291        158 YDSHIVPICMPKDDDDFTGRVATVSGWGRLKYGGGVPSVLQEVQVPVIENNVCQEMFQTAGHAKTIINSFLCAGYANGQR  237 (295)
Q Consensus       158 ~s~~v~picL~~~~~~~~~~~~~~~Gwg~~~~~~~~~~~l~~~~~~~~~~~~C~~~~~~~~~~~~~~~~~~Ca~~~~~~~  237 (295)
                          +..+.+.+......++.+..+|-....     ........+...... +-...      .. ..+.+     ..+.
T Consensus       132 ----~~~~~~~~s~~l~vg~~v~aiGnp~g~-----~~tvt~Givs~~~r~-~v~~~------~~-~~~~I-----qtdA  189 (347)
T COG0265         132 ----LPVIALGDSDKLRVGDVVVAIGNPFGL-----GQTVTSGIVSALGRT-GVGSA------GG-YVNFI-----QTDA  189 (347)
T ss_pred             ----CceeeccCCCCcccCCEEEEecCCCCc-----ccceeccEEeccccc-cccCc------cc-ccchh-----hccc
Confidence                223334333332246666666643221     111111222222221 11000      00 11111     1124


Q ss_pred             CCCcCCCCCceEEEeeCCeEEEEEEEEeCCCC
Q psy15291        238 DSCEGDSGGPLMIEREDGHWVLAGTVSHGIKC  269 (295)
Q Consensus       238 ~~C~gdsGgPl~~~~~~g~~~lvGi~S~g~~c  269 (295)
                      ..++|.||||++...  |  .++||.+.....
T Consensus       190 ain~gnsGgpl~n~~--g--~~iGint~~~~~  217 (347)
T COG0265         190 AINPGNSGGPLVNID--G--EVVGINTAIIAP  217 (347)
T ss_pred             ccCCCCCCCceEcCC--C--cEEEEEEEEecC
Confidence            678999999999864  4  799999876543


No 18 
>PF00548 Peptidase_C3:  3C cysteine protease (picornain 3C);  InterPro: IPR000199 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This signature defines cysteine peptidases belong to MEROPS peptidase family C3 (picornain, clan PA(C)), subfamilies C3A and C3B. The protein fold of this peptidase domain for members of this family resembles that of the serine peptidase, chymotrypsin [], the type example for clan PA. Picornaviral proteins are expressed as a single polyprotein which is cleaved by the viral C3 cysteine protease. The poliovirus polyprotein is selectively cleaved between the Gln-|-Gly bond. In other picornavirus reactions Glu may be substituted for Gln, and Ser or Thr for Gly. ; GO: 0004197 cysteine-type endopeptidase activity, 0006508 proteolysis; PDB: 3SJO_E 2H6M_A 1QA7_C 1HAV_B 2HAL_A 2H9H_A 3QZQ_B 3QZR_A 3R0F_B 3SJ9_A ....
Probab=93.09  E-value=0.29  Score=38.74  Aligned_cols=75  Identities=11%  Similarity=0.028  Sum_probs=40.7

Q ss_pred             cccccccccceEEeeCCEEEEeCCCCCCCCCceEEEEceeecCCccccccceecceeEEEECCCCCCCCCCCceEEEEec
Q psy15291         74 TLYTLQFPQQDSMMTNFDMFTINLSKIGFLANLVAVFGEYDISGELEAKRSISKNVRRVIVHRQYDAATFENDIALLELE  153 (295)
Q Consensus        74 ~~~~~~~~C~GtLIs~~~VLTAAhC~~~~~~~~~v~~g~~~~~~~~~~~~~~~~~v~~i~~hp~y~~~~~~~DiALlkL~  153 (295)
                      ....+.|.|.|..|..+|.|--.|.-    ....+.++...            +.+...+..  .+......||+|++|+
T Consensus        19 ~~~~g~~t~l~~gi~~~~~lvp~H~~----~~~~i~i~g~~------------~~~~d~~~l--v~~~~~~~Dl~~v~l~   80 (172)
T PF00548_consen   19 TTGKGEFTMLALGIYDRYFLVPTHEE----PEDTIYIDGVE------------YKVDDSVVL--VDRDGVDTDLTLVKLP   80 (172)
T ss_dssp             EETTEEEEEEEEEEEBTEEEEEGGGG----GCSEEEETTEE------------EEEEEEEEE--EETTSSEEEEEEEEEE
T ss_pred             EeCCceEEEecceEeeeEEEEECcCC----CcEEEEECCEE------------EEeeeeEEE--ecCCCcceeEEEEEcc
Confidence            34566777888899999999999922    22233332111            111111111  1111234699999998


Q ss_pred             CCCCCCCCceeee
Q psy15291        154 TPIAYDSHIVPIC  166 (295)
Q Consensus       154 ~~i~~s~~v~pic  166 (295)
                      ..-.|-+-.+-++
T Consensus        81 ~~~kfrDIrk~~~   93 (172)
T PF00548_consen   81 RNPKFRDIRKFFP   93 (172)
T ss_dssp             SSS-B--GGGGSB
T ss_pred             CCcccCchhhhhc
Confidence            8777754444444


No 19 
>PF00947 Pico_P2A:  Picornavirus core protein 2A;  InterPro: IPR000081 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This domain defines cysteine peptidases belong to MEROPS peptidase family C3 (picornain, clan PA(C)), subfamilies 3CA and 3CB. The protein fold of this peptidase domain for members of this family resembles that of the serine peptidase, chymotrypsin [], the type example for clan PA. Picornaviral proteins are expressed as a single polyprotein which is cleaved by the viral 3C cysteine protease []. The poliovirus polyprotein is selectively cleaved between the Gln-|-Gly bond. In other picornavirus reactions Glu may be substituted for Gln, and Ser or Thr for Gly. ; GO: 0008233 peptidase activity, 0006508 proteolysis, 0016032 viral reproduction; PDB: 2HRV_B 1Z8R_A.
Probab=90.32  E-value=0.21  Score=36.77  Aligned_cols=40  Identities=28%  Similarity=0.443  Sum_probs=28.6

Q ss_pred             CCcCCCCCceEEEeeCCeEEEEEEEEeCCCCCCCCCCcEEeeCCCcHhHHh
Q psy15291        239 SCEGDSGGPLMIEREDGHWVLAGTVSHGIKCAAPYLPGVYMRTTYYKPWLQ  289 (295)
Q Consensus       239 ~C~gdsGgPl~~~~~~g~~~lvGi~S~g~~c~~~~~p~v~t~v~~~~~WI~  289 (295)
                      .-+||-||+|.|..  |   ++||++.|..     .-.-|++|+.+ .|++
T Consensus        87 ~~PGdCGg~L~C~H--G---ViGi~Tagg~-----g~VaF~dir~~-~~~e  126 (127)
T PF00947_consen   87 AEPGDCGGILRCKH--G---VIGIVTAGGE-----GHVAFADIRDL-LWLE  126 (127)
T ss_dssp             SSTT-TCSEEEETT--C---EEEEEEEEET-----TEEEEEECCCG-STTS
T ss_pred             CCCCCCCceeEeCC--C---eEEEEEeCCC-----ceEEEEechhh-heec
Confidence            34799999999985  3   9999998732     23579999874 4543


No 20 
>KOG1421|consensus
Probab=84.63  E-value=11  Score=36.08  Aligned_cols=76  Identities=13%  Similarity=0.119  Sum_probs=42.6

Q ss_pred             ccccccceEEeeC--CEEEEeCCCCCCCCCceEEEEceeecCCccccccceecceeEEEECCCCCCCCCCCceEEEEecC
Q psy15291         77 TLQFPQQDSMMTN--FDMFTINLSKIGFLANLVAVFGEYDISGELEAKRSISKNVRRVIVHRQYDAATFENDIALLELET  154 (295)
Q Consensus        77 ~~~~~C~GtLIs~--~~VLTAAhC~~~~~~~~~v~~g~~~~~~~~~~~~~~~~~v~~i~~hp~y~~~~~~~DiALlkL~~  154 (295)
                      .+.+.-+|.++++  .++||+-|-+.-.+-.-.+.+-.+                +.+-+.|.|..  .-||+.+++.+.
T Consensus        81 ag~~~atgfvvd~~~gyiLtnrhvv~pgP~va~avf~n~----------------ee~ei~pvyrD--pVhdfGf~r~dp  142 (955)
T KOG1421|consen   81 AGESEATGFVVDKKLGYILTNRHVVAPGPFVASAVFDNH----------------EEIEIYPVYRD--PVHDFGFFRYDP  142 (955)
T ss_pred             ccccceeEEEEecccceEEEeccccCCCCceeEEEeccc----------------ccCCcccccCC--chhhcceeecCh
Confidence            3444456788876  579999999876543333332211                11223344432  237888888765


Q ss_pred             C-CCCCCCceeeecCCCC
Q psy15291        155 P-IAYDSHIVPICMPKDD  171 (295)
Q Consensus       155 ~-i~~s~~v~picL~~~~  171 (295)
                      . +.| ..+.-+||....
T Consensus       143 s~ir~-s~vt~i~lap~~  159 (955)
T KOG1421|consen  143 STIRF-SIVTEICLAPEL  159 (955)
T ss_pred             hhcce-eeeeccccCccc
Confidence            3 333 356777876554


No 21 
>PF05416 Peptidase_C37:  Southampton virus-type processing peptidase;  InterPro: IPR001665 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This group of cysteine peptidases belong to the MEROPS peptidase family C37, (clan PA(C)). The type example is calicivirin from Southampton virus, an endopeptidase that cleaves the polyprotein at sites N-terminal to itself, liberating the polyprotein helicase. Southampton virus is a positive-stranded ssRNA virus belonging to the Caliciviruses, which are viruses that cause gastroenteritis. The calicivirus genome contains two open reading frames, ORF1 and ORF2. ORF1 encodes a non-structural polypeptide, which has RNA helicase, cysteine protease and RNA polymerase activity []. The regions of the polyprotein in which these activities lie are similar to proteins produced by the picornaviruses []. ORF2 encodes a structural, capsid protein. Two different families of caliciviruses can be distinguished on the basis of sequence similarity, namely the Norwalk-like viruses or small round structured viruses (SRSVs), and those classed as non-SRSVs.; GO: 0004197 cysteine-type endopeptidase activity, 0006508 proteolysis; PDB: 2FYQ_A 2FYR_A 1WQS_D 4ASH_A 2IPH_B.
Probab=83.56  E-value=4  Score=36.63  Aligned_cols=143  Identities=15%  Similarity=0.188  Sum_probs=68.5

Q ss_pred             eEEeeCCEEEEeCCCCCCCCCceEEEEceeecCCccccccceecceeEEEECCCCCCCCCCCceEEEEecCCCCCCCCce
Q psy15291         84 DSMMTNFDMFTINLSKIGFLANLVAVFGEYDISGELEAKRSISKNVRRVIVHRQYDAATFENDIALLELETPIAYDSHIV  163 (295)
Q Consensus        84 GtLIs~~~VLTAAhC~~~~~~~~~v~~g~~~~~~~~~~~~~~~~~v~~i~~hp~y~~~~~~~DiALlkL~~~i~~s~~v~  163 (295)
                      |--+||...+|+.|-+....   .-.+|               .++.+|.+|..       -++.-+++..|+.  +.+.
T Consensus       383 GfWVS~~lfITttHViP~g~---~E~FG---------------v~i~~i~vh~s-------GeF~~~rFpk~iR--PDvt  435 (535)
T PF05416_consen  383 GFWVSPTLFITTTHVIPPGA---KEAFG---------------VPISQIQVHKS-------GEFCRFRFPKPIR--PDVT  435 (535)
T ss_dssp             EEESSSSEEEEEGGGS-STT---SEETT---------------EECGGEEEEEE-------TTEEEEEESS-SS--TTS-
T ss_pred             eeeecceEEEEeeeecCCcc---hhhhC---------------CChhHeEEeec-------cceEEEecCCCCC--CCcc
Confidence            67899999999999986432   11222               34555666642       5677788887775  2333


Q ss_pred             eeecCCCCCCCCCCEEEEEecccccCCCCCCCCcEEEEeeeeChhhHHHHHhcCCCCCCCCCCeEEeeec--CCCCCCCc
Q psy15291        164 PICMPKDDDDFTGRVATVSGWGRLKYGGGVPSVLQEVQVPVIENNVCQEMFQTAGHAKTIINSFLCAGYA--NGQRDSCE  241 (295)
Q Consensus       164 picL~~~~~~~~~~~~~~~Gwg~~~~~~~~~~~l~~~~~~~~~~~~C~~~~~~~~~~~~~~~~~~Ca~~~--~~~~~~C~  241 (295)
                      -.-|-...+  .+..|.+.-=-.       +..|...-+.+-....-.-...    ...-...||=++..  .-+-.+-+
T Consensus       436 gmiLEeGap--EGtV~siLiKR~-------sGEllpLAvRMgt~AsmkIqgr----~v~GQ~GMLLTGaNAK~mDLGT~P  502 (535)
T PF05416_consen  436 GMILEEGAP--EGTVCSILIKRP-------SGELLPLAVRMGTHASMKIQGR----TVHGQMGMLLTGANAKGMDLGTIP  502 (535)
T ss_dssp             --EE-SS----TT-EEEEEEE-T-------TSBEEEEEEEEEEEEEEEETTE----EEEEEEEEETTSTT-SSTTTS--T
T ss_pred             ceeeccCCC--CceEEEEEEEcC-------CccchhhhhhhccceeEEEcce----eecceeeeeeecCCccccccCCCC
Confidence            333322221  366666543211       1122222222222111000000    00011223333221  11245789


Q ss_pred             CCCCCceEEEeeCCeEEEEEEEEeCC
Q psy15291        242 GDSGGPLMIEREDGHWVLAGTVSHGI  267 (295)
Q Consensus       242 gdsGgPl~~~~~~g~~~lvGi~S~g~  267 (295)
                      ||-|.|.+... ++-|+++||.....
T Consensus       503 GDCGcPYvyKr-gNd~VV~GVH~AAt  527 (535)
T PF05416_consen  503 GDCGCPYVYKR-GNDWVVIGVHAAAT  527 (535)
T ss_dssp             TGTT-EEEEEE-TTEEEEEEEEEEE-
T ss_pred             CCCCCceeeec-CCcEEEEEEEehhc
Confidence            99999999987 88999999987643


No 22 
>PF08192 Peptidase_S64:  Peptidase family S64;  InterPro: IPR012985 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This family of fungal proteins is involved in the processing of membrane bound transcription factor Stp1 [] and belongs to MEROPS petidase family S64 (clan PA). The processing causes the signalling domain of Stp1 to be passed to the nucleus where several permease genes are induced. The permeases are important for uptake of amino acids, and processing of tp1 only occurs in an amino acid-rich environment. This family is predicted to be distantly related to the trypsin family (MEROPS peptidase family S1) and to have a typical trypsin-like catalytic triad [].
Probab=76.46  E-value=20  Score=34.38  Aligned_cols=57  Identities=19%  Similarity=0.248  Sum_probs=39.6

Q ss_pred             CCCCcCCCCCceEEEeeC--CeEEEEEEEEeCCCCCCCCCCcEEeeCCCcHhHHhhhhCCC
Q psy15291        237 RDSCEGDSGGPLMIERED--GHWVLAGTVSHGIKCAAPYLPGVYMRTTYYKPWLQTITGVQ  295 (295)
Q Consensus       237 ~~~C~gdsGgPl~~~~~~--g~~~lvGi~S~g~~c~~~~~p~v~t~v~~~~~WI~~~~~~~  295 (295)
                      .-.-.||||+=++...++  --.-++|++. ++++.. ..-++||.+...++=+++++|++
T Consensus       634 ~Fa~~GDSGS~VLtk~~d~~~gLgvvGMlh-sydge~-kqfglftPi~~il~rl~~vT~I~  692 (695)
T PF08192_consen  634 AFASGGDSGSWVLTKLEDNNKGLGVVGMLH-SYDGEQ-KQFGLFTPINEILDRLEEVTGIK  692 (695)
T ss_pred             cccCCCCcccEEEecccccccCceeeEEee-ecCCcc-ceeeccCcHHHHHHHHHHhhccc
Confidence            345579999999886433  1124777764 334333 33588999999999999999874


No 23 
>PF05580 Peptidase_S55:  SpoIVB peptidase S55;  InterPro: IPR008763 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This group of serine peptidases belong to the MEROPS peptidase family S55 (SpoIVB peptidase family, clan PA(S)). The protein SpoIVB plays a key role in signalling in the final sigma-K checkpoint of Bacillus subtilis [, ].
Probab=74.22  E-value=4.1  Score=33.20  Aligned_cols=25  Identities=32%  Similarity=0.571  Sum_probs=21.7

Q ss_pred             CCCcCCCCCceEEEeeCCeEEEEEEEEeCC
Q psy15291        238 DSCEGDSGGPLMIEREDGHWVLAGTVSHGI  267 (295)
Q Consensus       238 ~~C~gdsGgPl~~~~~~g~~~lvGi~S~g~  267 (295)
                      ...+|-||+|++.+.     .|+|-++++.
T Consensus       176 GIvqGMSGSPI~qdG-----KLiGAVthvf  200 (218)
T PF05580_consen  176 GIVQGMSGSPIIQDG-----KLIGAVTHVF  200 (218)
T ss_pred             CEEecccCCCEEECC-----EEEEEEEEEE
Confidence            578999999998865     8999999975


No 24 
>KOG3925|consensus
Probab=72.41  E-value=4.8  Score=35.21  Aligned_cols=9  Identities=33%  Similarity=0.697  Sum_probs=4.2

Q ss_pred             EEEEEEEeC
Q psy15291        258 VLAGTVSHG  266 (295)
Q Consensus       258 ~lvGi~S~g  266 (295)
                      +++|+.+.|
T Consensus       280 ~~vg~s~rg  288 (371)
T KOG3925|consen  280 FVVGTSTRG  288 (371)
T ss_pred             eEEEeccCC
Confidence            455554433


No 25 
>PF05579 Peptidase_S32:  Equine arteritis virus serine endopeptidase S32;  InterPro: IPR008760 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This group of serine peptidases belong to MEROPS peptidase family S32 (clan PA(S)). The type example is equine arteritis virus serine endopeptidase (equine arteritis virus), which is involved in processing of nidovirus polyproteins [].; GO: 0004252 serine-type endopeptidase activity, 0016032 viral reproduction, 0019082 viral protein processing; PDB: 3FAN_A 3FAO_A 1MBM_A.
Probab=66.36  E-value=3.8  Score=34.46  Aligned_cols=22  Identities=41%  Similarity=0.693  Sum_probs=16.5

Q ss_pred             cCCCCCceEEEeeCCeEEEEEEEEeC
Q psy15291        241 EGDSGGPLMIEREDGHWVLAGTVSHG  266 (295)
Q Consensus       241 ~gdsGgPl~~~~~~g~~~lvGi~S~g  266 (295)
                      .||||+|++..+  |  .|+||.+.+
T Consensus       207 ~GDSGSPVVt~d--g--~liGVHTGS  228 (297)
T PF05579_consen  207 PGDSGSPVVTED--G--DLIGVHTGS  228 (297)
T ss_dssp             GGCTT-EEEETT--C---EEEEEEEE
T ss_pred             CCCCCCccCcCC--C--CEEEEEecC
Confidence            699999999874  4  699999864


No 26 
>PF10459 Peptidase_S46:  Peptidase S46;  InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This entry represents S46 peptidases, where dipeptidyl-peptidase 7 (DPP-7) is the best-characterised member of this family. It is a serine peptidase that is located on the cell surface and is predicted to have two N-terminal transmembrane domains. 
Probab=64.19  E-value=3.9  Score=39.76  Aligned_cols=21  Identities=14%  Similarity=0.023  Sum_probs=18.7

Q ss_pred             ccceEEeeCC-EEEEeCCCCCC
Q psy15291         81 PQQDSMMTNF-DMFTINLSKIG  101 (295)
Q Consensus        81 ~C~GtLIs~~-~VLTAAhC~~~  101 (295)
                      .|+|++||++ .|||--||..+
T Consensus        48 GCSgsfVS~~GLvlTNHHC~~~   69 (698)
T PF10459_consen   48 GCSGSFVSPDGLVLTNHHCGYG   69 (698)
T ss_pred             ceeEEEEcCCceEEecchhhhh
Confidence            4999999986 99999999865


No 27 
>PF02907 Peptidase_S29:  Hepatitis C virus NS3 protease;  InterPro: IPR004109 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This signature identifies the Hepatitis C virus NS3 protein as a serine protease which belongs to MEROPS peptidase family S29 (hepacivirin family, clan PA(S)), which has a trypsin-like fold. The non-structural (NS) protein NS3 is one of the NS proteins involved in replication of the HCV genome. The NS2 proteinase (IPR002518 from INTERPRO), a zinc-dependent enzyme, performs a single proteolytic cut to release the N terminus of NS3. The action of NS3 proteinase (NS3P), which resides in the N-terminal one-third of the NS3 protein, then yields all remaining non-structural proteins. The C-terminal two-thirds of the NS3 protein contain a helicase. The functional relationship between the proteinase and helicase domains is unknown. NS3 has a structural zinc-binding site and requires cofactor NS4. It has been suggested that the NS3 serine protease of hepatitus C is involved in cell transformation and that the ability to transform requires an active enzyme [].; GO: 0008236 serine-type peptidase activity, 0006508 proteolysis, 0019087 transformation of host cell by virus; PDB: 2QV1_B 3LOX_C 2OBQ_C 2OC1_C 2OC0_A 3LON_A 3KNX_A 2O8M_A 2OBO_A 2OC8_A ....
Probab=62.82  E-value=5.3  Score=29.88  Aligned_cols=22  Identities=32%  Similarity=0.640  Sum_probs=15.5

Q ss_pred             CcCCCCCceEEEeeCCeEEEEEEEEe
Q psy15291        240 CEGDSGGPLMIEREDGHWVLAGTVSH  265 (295)
Q Consensus       240 C~gdsGgPl~~~~~~g~~~lvGi~S~  265 (295)
                      -.|.||||++|..  |  .++||...
T Consensus       106 lkGSSGgPiLC~~--G--H~vG~f~a  127 (148)
T PF02907_consen  106 LKGSSGGPILCPS--G--HAVGMFRA  127 (148)
T ss_dssp             HTT-TT-EEEETT--S--EEEEEEEE
T ss_pred             EecCCCCcccCCC--C--CEEEEEEE
Confidence            3688999999974  4  68898754


No 28 
>TIGR02860 spore_IV_B stage IV sporulation protein B. SpoIVB, the stage IV sporulation protein B of endospore-forming bacteria such as Bacillus subtilis, is a serine proteinase, expressed in the spore (rather than mother cell) compartment, that participates in a proteolytic activation cascade for Sigma-K. It appears to be universal among endospore-forming bacteria and occurs nowhere else.
Probab=58.99  E-value=12  Score=33.88  Aligned_cols=47  Identities=26%  Similarity=0.450  Sum_probs=31.7

Q ss_pred             CCCCcCCCCCceEEEeeCCeEEEEEEEEeCCCCCCCCCCcEEeeCCCcHhHHhhhhCC
Q psy15291        237 RDSCEGDSGGPLMIEREDGHWVLAGTVSHGIKCAAPYLPGVYMRTTYYKPWLQTITGV  294 (295)
Q Consensus       237 ~~~C~gdsGgPl~~~~~~g~~~lvGi~S~g~~c~~~~~p~v~t~v~~~~~WI~~~~~~  294 (295)
                      ....+|-||+|++.+.     .|+|-+++..-.......++      |++|+.+..++
T Consensus       355 gGivqGMSGSPi~q~g-----kliGAvtHVfvndpt~GYGi------~ie~Ml~~~~~  401 (402)
T TIGR02860       355 GGIVQGMSGSPIIQNG-----KVIGAVTHVFVNDPTSGYGV------YIEWMLKEAGI  401 (402)
T ss_pred             CCEEecccCCCEEECC-----EEEEEEEEEEecCCCcceee------hHHHHHHHhcc
Confidence            3567899999999865     89999998643221111222      57888876553


No 29 
>KOG2422|consensus
Probab=53.04  E-value=2.3  Score=39.63  Aligned_cols=14  Identities=21%  Similarity=0.510  Sum_probs=7.8

Q ss_pred             CceEEEEecCCCCC
Q psy15291        145 NDIALLELETPIAY  158 (295)
Q Consensus       145 ~DiALlkL~~~i~~  158 (295)
                      |.|++|-...|...
T Consensus       271 n~v~~lL~ssPYHv  284 (665)
T KOG2422|consen  271 NNVLILLISSPYHV  284 (665)
T ss_pred             cceeeeeccCCcch
Confidence            55665555555543


No 30 
>PF00944 Peptidase_S3:  Alphavirus core protein ;  InterPro: IPR000930 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. Togavirin, also known as Sindbis virus core endopeptidase, is a serine protease resident at the N terminus of the p130 polyprotein of togaviruses []. The endopeptidase signature identifies the peptidase as belonging to the MEROPS peptidase family S3 (togavirin family, clan PA(S)). The polyprotein also includes structural proteins for the nucleocapsid core and for the glycoprotein spikes []. Togavirin is only active while part of the polyprotein, cleavage at a Trp-Ser bond resulting in total lack of activity []. Mutagenesis studies have identified the location of the His-Asp-Ser catalytic triad, and X-ray studies have revealed the protein fold to be similar to that of chymotrypsin [, ].; GO: 0004252 serine-type endopeptidase activity, 0006508 proteolysis, 0016020 membrane; PDB: 2YEW_D 1EP5_A 3J0C_F 1EP6_C 1WYK_D 1DYL_A 1VCQ_B 1VCP_B 1LD4_D 1KXA_A ....
Probab=49.96  E-value=3.6  Score=30.67  Aligned_cols=25  Identities=32%  Similarity=0.512  Sum_probs=18.6

Q ss_pred             CcCCCCCceEEEeeCCeEEEEEEEEeCCC
Q psy15291        240 CEGDSGGPLMIEREDGHWVLAGTVSHGIK  268 (295)
Q Consensus       240 C~gdsGgPl~~~~~~g~~~lvGi~S~g~~  268 (295)
                      -+||||-|++.+  .|  .+|||+-.|..
T Consensus       104 ~~GDSGRpi~DN--sG--rVVaIVLGG~n  128 (158)
T PF00944_consen  104 KPGDSGRPIFDN--SG--RVVAIVLGGAN  128 (158)
T ss_dssp             STTSTTEEEEST--TS--BEEEEEEEEEE
T ss_pred             CCCCCCCccCcC--CC--CEEEEEecCCC
Confidence            479999999875  45  58888876543


No 31 
>PF08496 Peptidase_S49_N:  Peptidase family S49 N-terminal;  InterPro: IPR013703 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This domain is found to the N terminus of bacterial signal peptidases that belong to the MEROPS peptidase family S49 (protease IV family, clan SK) (see also IPR002142 from INTERPRO) [, ]. ; GO: 0004252 serine-type endopeptidase activity, 0005886 plasma membrane
Probab=46.61  E-value=18  Score=27.98  Aligned_cols=6  Identities=17%  Similarity=0.196  Sum_probs=2.4

Q ss_pred             cceeec
Q psy15291         69 TVSRHT   74 (295)
Q Consensus        69 ~~~~~~   74 (295)
                      .+++++
T Consensus       134 V~~rLE  139 (155)
T PF08496_consen  134 VLVRLE  139 (155)
T ss_pred             EEEEEe
Confidence            344433


No 32 
>KOG1230|consensus
Probab=46.23  E-value=7.2  Score=35.05  Aligned_cols=27  Identities=30%  Similarity=0.354  Sum_probs=13.2

Q ss_pred             CchhHHHHHHHHHHHHHHHHHHHHHhh
Q psy15291          1 MIRSRRRKEKKKKKKKKKKKKKKKKKK   27 (295)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~k   27 (295)
                      |.||-||.+|-|+-.|+.+|-.||.-|
T Consensus         1 MgKK~Kk~kkgk~aek~a~K~dkK~ak   27 (521)
T KOG1230|consen    1 MGKKNKKDKKGKGAEKTAAKQDKKFAK   27 (521)
T ss_pred             CCccccCcccccchhhhHHHHHHHHHh
Confidence            555555555545444554444444433


No 33 
>PF00949 Peptidase_S7:  Peptidase S7, Flavivirus NS3 serine protease ;  InterPro: IPR001850 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This signature identifies serine peptidases belong to MEROPS peptidase family S7 (flavivirin family, clan PA(S)). The protein fold of the peptidase domain for members of this family resembles that of chymotrypsin, the type example for clan PA.  Flaviviruses produce a polyprotein from the ssRNA genome. The N terminus of the NS3 protein (approx. 180 aa) is required for the processing of the polyprotein. NS3 also has conserved homology with NTP-binding proteins and DEAD family of RNA helicase [, , ].; GO: 0003723 RNA binding, 0003724 RNA helicase activity, 0005524 ATP binding; PDB: 2IJO_B 3E90_D 2GGV_B 2FP7_B 2WV9_A 3U1I_B 3U1J_B 2WZQ_A 2WHX_A 3L6P_A ....
Probab=40.37  E-value=17  Score=27.28  Aligned_cols=26  Identities=31%  Similarity=0.673  Sum_probs=17.3

Q ss_pred             CCCcCCCCCceEEEeeCCeEEEEEEEEeCC
Q psy15291        238 DSCEGDSGGPLMIEREDGHWVLAGTVSHGI  267 (295)
Q Consensus       238 ~~C~gdsGgPl~~~~~~g~~~lvGi~S~g~  267 (295)
                      +.-.|.||+|++..  +|  .++||.-.+.
T Consensus        93 d~~~GsSGSpi~n~--~g--~ivGlYg~g~  118 (132)
T PF00949_consen   93 DFPKGSSGSPIFNQ--NG--EIVGLYGNGV  118 (132)
T ss_dssp             -S-TTGTT-EEEET--TS--CEEEEEEEEE
T ss_pred             ccCCCCCCCceEcC--CC--cEEEEEccce
Confidence            45578999999965  44  6888887654


No 34 
>KOG4364|consensus
Probab=39.46  E-value=66  Score=30.94  Aligned_cols=13  Identities=38%  Similarity=0.623  Sum_probs=5.9

Q ss_pred             CCeEEEEEEEEeC
Q psy15291        254 DGHWVLAGTVSHG  266 (295)
Q Consensus       254 ~g~~~lvGi~S~g  266 (295)
                      +|.|+-.|-+|-+
T Consensus       556 DgffVPhgyLSed  568 (811)
T KOG4364|consen  556 DGFFVPHGYLSED  568 (811)
T ss_pred             CCeecCCcccccc
Confidence            3344444555543


No 35 
>PF10459 Peptidase_S46:  Peptidase S46;  InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This entry represents S46 peptidases, where dipeptidyl-peptidase 7 (DPP-7) is the best-characterised member of this family. It is a serine peptidase that is located on the cell surface and is predicted to have two N-terminal transmembrane domains. 
Probab=36.92  E-value=22  Score=34.81  Aligned_cols=35  Identities=26%  Similarity=0.362  Sum_probs=24.4

Q ss_pred             CCeEEeeecCCCCCCCcCCCCCceEEEeeCCeEEEEEEEEeC
Q psy15291        225 NSFLCAGYANGQRDSCEGDSGGPLMIEREDGHWVLAGTVSHG  266 (295)
Q Consensus       225 ~~~~Ca~~~~~~~~~C~gdsGgPl~~~~~~g~~~lvGi~S~g  266 (295)
                      +.-+|.-.   +.++..|.||||++...  |  .|||++=-|
T Consensus       619 ~~pv~Fls---tnDitGGNSGSPvlN~~--G--eLVGl~FDg  653 (698)
T PF10459_consen  619 SVPVNFLS---TNDITGGNSGSPVLNAK--G--ELVGLAFDG  653 (698)
T ss_pred             CeeeEEEe---ccCcCCCCCCCccCCCC--c--eEEEEeecC
Confidence            33455432   25788999999999864  4  799997433


No 36 
>KOG2967|consensus
Probab=34.26  E-value=1e+02  Score=26.91  Aligned_cols=10  Identities=10%  Similarity=-0.080  Sum_probs=3.8

Q ss_pred             HHHHHhhhhh
Q psy15291         37 MELEKLQQRH   46 (295)
Q Consensus        37 ~~~~~~~~~~   46 (295)
                      ++.+.+....
T Consensus        68 k~~~~i~~g~   77 (314)
T KOG2967|consen   68 KRNELIELGL   77 (314)
T ss_pred             HHHhhcccCc
Confidence            3333333333


No 37 
>KOG3925|consensus
Probab=31.24  E-value=83  Score=27.86  Aligned_cols=8  Identities=50%  Similarity=0.572  Sum_probs=3.4

Q ss_pred             cHhHHhhh
Q psy15291        284 YKPWLQTI  291 (295)
Q Consensus       284 ~~~WI~~~  291 (295)
                      -++|....
T Consensus       357 slp~~~~~  364 (371)
T KOG3925|consen  357 SLPRLQTM  364 (371)
T ss_pred             hhhhhhhh
Confidence            34444443


No 38 
>TIGR02841 spore_YyaC putative sporulation protein YyaC. A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, also called YyaC, is a member of that panel and is otherwise uncharacterized. The second round of PSI-BLAST shows many similarities to the germination protease GPR, which is found in exactly the same set of organisms and has a known role in the sporulation/germination process.
Probab=29.93  E-value=30  Score=26.15  Aligned_cols=18  Identities=50%  Similarity=1.025  Sum_probs=15.7

Q ss_pred             eEEeeecCCCCCCCcCCCCCceE
Q psy15291        227 FLCAGYANGQRDSCEGDSGGPLM  249 (295)
Q Consensus       227 ~~Ca~~~~~~~~~C~gdsGgPl~  249 (295)
                      .+|.|     .+.|.||+=|||+
T Consensus         5 ~lCIG-----TDRstGDsLGPLV   22 (140)
T TIGR02841         5 LLCIG-----TDRSTGDALGPLV   22 (140)
T ss_pred             EEEEC-----CCCCcccccchhh
Confidence            58986     6889999999998


No 39 
>PF06866 DUF1256:  Protein of unknown function (DUF1256);  InterPro: IPR009665 This family consists of several uncharacterised bacterial proteins, which seem to be specific to the orders Clostridia and Bacillales. Family members are typically around 180 residues in length. The function of this family is unknown.
Probab=29.86  E-value=31  Score=26.92  Aligned_cols=19  Identities=58%  Similarity=1.060  Sum_probs=16.4

Q ss_pred             CeEEeeecCCCCCCCcCCCCCceE
Q psy15291        226 SFLCAGYANGQRDSCEGDSGGPLM  249 (295)
Q Consensus       226 ~~~Ca~~~~~~~~~C~gdsGgPl~  249 (295)
                      -.+|.|     .+.|.|||=|||+
T Consensus        28 v~lCIG-----TDRstGDsLGPLV   46 (163)
T PF06866_consen   28 VFLCIG-----TDRSTGDSLGPLV   46 (163)
T ss_pred             EEEEEC-----CCCCccccccchh
Confidence            468986     6889999999998


No 40 
>KOG2775|consensus
Probab=29.03  E-value=43  Score=28.89  Aligned_cols=10  Identities=30%  Similarity=0.454  Sum_probs=5.7

Q ss_pred             eEEEECCCCC
Q psy15291        130 RRVIVHRQYD  139 (295)
Q Consensus       130 ~~i~~hp~y~  139 (295)
                      -.+.+.|.|+
T Consensus       184 FTv~F~p~~d  193 (397)
T KOG2775|consen  184 FTVAFNPKYD  193 (397)
T ss_pred             eEEeeCcccc
Confidence            3455666665


No 41 
>PF10411 DsbC_N:  Disulfide bond isomerase protein N-terminus;  InterPro: IPR018950  This is the N-terminal domain of the disulphide bond isomerase DsbC. The whole molecule is V-shaped, where each arm is a DsbC monomer of two domains linked by a hinge; and the N-termini of each monomer join to form the dimer interface at the base of the V, so are vital for dimerisation []. DsbC is required for disulphide bond formation and functions as a disulphide bond isomerase during oxidative protein-folding in bacterial periplasm. It also has chaperone activity []. ; PDB: 1EEJ_B 2IYJ_A 1TJD_A 1JZD_B 1JZO_A 1G0T_B 1T3B_A.
Probab=24.30  E-value=33  Score=21.39  Aligned_cols=27  Identities=26%  Similarity=0.478  Sum_probs=20.0

Q ss_pred             CCCCcCCC-CCceEEEeeCCeEEEEEEE
Q psy15291        237 RDSCEGDS-GGPLMIEREDGHWVLAGTV  263 (295)
Q Consensus       237 ~~~C~gds-GgPl~~~~~~g~~~lvGi~  263 (295)
                      .+.|.... |++++..+.+|++.+.|=+
T Consensus        23 ~GlyeV~~~~~~i~Y~~~dg~yli~G~l   50 (57)
T PF10411_consen   23 PGLYEVVLKGGGILYVDEDGRYLIQGQL   50 (57)
T ss_dssp             TTEEEEEE-TTEEEEEETTSSEEEES-E
T ss_pred             CCeEEEEECCCeEEEEcCCCCEEEEeEE
Confidence            45666666 8888887779999998854


No 42 
>KOG2409|consensus
Probab=23.13  E-value=1.7e+02  Score=27.59  Aligned_cols=14  Identities=7%  Similarity=-0.315  Sum_probs=8.9

Q ss_pred             eCCEEEEeCCCCCC
Q psy15291         88 TNFDMFTINLSKIG  101 (295)
Q Consensus        88 s~~~VLTAAhC~~~  101 (295)
                      ..+|=-+-.||...
T Consensus       420 ~gd~~~~eg~~ed~  433 (647)
T KOG2409|consen  420 PGDDSEDEGSVEDE  433 (647)
T ss_pred             CCCcchhcccccch
Confidence            44666777777643


No 43 
>KOG1320|consensus
Probab=22.56  E-value=4.1e+02  Score=24.83  Aligned_cols=24  Identities=4%  Similarity=-0.128  Sum_probs=19.6

Q ss_pred             ccccccceEEeeCCEEEEeCCCCC
Q psy15291         77 TLQFPQQDSMMTNFDMFTINLSKI  100 (295)
Q Consensus        77 ~~~~~C~GtLIs~~~VLTAAhC~~  100 (295)
                      .....|+|-.|..+-+||-||++.
T Consensus        84 q~~~~~s~f~i~~~~lltn~~~v~  107 (473)
T KOG1320|consen   84 QFSSGGSGFAIYGKKLLTNAHVVA  107 (473)
T ss_pred             hhcccccchhhcccceeecCcccc
Confidence            344578888899999999999986


No 44 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=22.46  E-value=2.3e+02  Score=27.08  Aligned_cols=11  Identities=9%  Similarity=0.048  Sum_probs=5.8

Q ss_pred             eEEeeCCEEEE
Q psy15291         84 DSMMTNFDMFT   94 (295)
Q Consensus        84 GtLIs~~~VLT   94 (295)
                      |.+.-|.|++.
T Consensus       151 G~v~lP~wm~~  161 (567)
T PLN03086        151 GSVGLPPHVWS  161 (567)
T ss_pred             CeEEcCHHHHh
Confidence            45555555543


No 45 
>KOG3165|consensus
Probab=21.71  E-value=1.4e+02  Score=23.33  Aligned_cols=14  Identities=21%  Similarity=0.275  Sum_probs=6.7

Q ss_pred             CCcceeeccccccc
Q psy15291         67 PPTVSRHTLYTLQF   80 (295)
Q Consensus        67 ~p~~~~~~~~~~~~   80 (295)
                      +|+.+.+.++.-.|
T Consensus        62 PPy~vivDTNFINf   75 (195)
T KOG3165|consen   62 PPYHVIVDTNFINF   75 (195)
T ss_pred             CCeEEEEecchhhH
Confidence            56555444444443


No 46 
>KOG2775|consensus
Probab=20.92  E-value=38  Score=29.23  Aligned_cols=7  Identities=43%  Similarity=0.733  Sum_probs=3.0

Q ss_pred             cccceEE
Q psy15291         80 FPQQDSM   86 (295)
Q Consensus        80 ~~C~GtL   86 (295)
                      ||-+-||
T Consensus       138 FPtG~Sl  144 (397)
T KOG2775|consen  138 FPTGCSL  144 (397)
T ss_pred             CCCcccc
Confidence            4444344


No 47 
>KOG3709|consensus
Probab=20.37  E-value=82  Score=29.44  Aligned_cols=7  Identities=29%  Similarity=0.240  Sum_probs=4.0

Q ss_pred             hhhhccc
Q psy15291         52 ALCRNIG   58 (295)
Q Consensus        52 ~~~ri~~   58 (295)
                      -.+|++.
T Consensus       718 gI~RLIC  724 (778)
T KOG3709|consen  718 GIGRLIC  724 (778)
T ss_pred             Hhhhhee
Confidence            4556664


Done!