Query         psy15302
Match_columns 68
No_of_seqs    104 out of 332
Neff          6.2 
Searched_HMMs 46136
Date          Fri Aug 16 17:36:32 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15302.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15302hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3445|consensus              100.0 4.2E-30 9.2E-35  165.4   7.3   67    1-67     15-81  (145)
  2 KOG3446|consensus               99.9 1.2E-24 2.7E-29  131.3   1.5   61    7-67     13-73  (97)
  3 PF05047 L51_S25_CI-B8:  Mitoch  99.7 1.1E-16 2.3E-21   87.3   5.2   42   26-67      1-42  (52)
  4 KOG4079|consensus               98.5 1.7E-08 3.8E-13   66.0   0.1   61    8-68     27-87  (169)
  5 PF10780 MRP_L53:  39S ribosoma  97.5 0.00016 3.6E-09   39.6   3.5   49   16-65      1-51  (51)
  6 PF13701 DDE_Tnp_1_4:  Transpos  75.1     4.8  0.0001   30.1   3.8   35   19-53    193-227 (448)
  7 PF13692 Glyco_trans_1_4:  Glyc  74.4     4.7  0.0001   23.7   3.0   39   13-51      4-42  (135)
  8 COG4837 Uncharacterized protei  72.7     5.6 0.00012   24.7   3.0   32   17-51     19-50  (106)
  9 COG1182 AcpD Acyl carrier prot  71.6     7.2 0.00016   26.8   3.7   53   12-65      5-58  (202)
 10 cd08429 PBP2_NhaR The C-termin  70.6     7.8 0.00017   24.2   3.5   29   24-52      9-37  (204)
 11 cd08418 PBP2_TdcA The C-termin  70.3     7.6 0.00017   23.2   3.3   29   23-51      8-36  (201)
 12 cd08470 PBP2_CrgA_like_1 The C  69.7     8.1 0.00018   23.1   3.3   25   26-50     12-36  (197)
 13 cd05466 PBP2_LTTR_substrate Th  69.7     9.4  0.0002   22.1   3.5   27   25-51     10-36  (197)
 14 TIGR01159 DRP1 density-regulat  69.6       3 6.5E-05   27.9   1.4   25   14-38     14-38  (173)
 15 TIGR02136 ptsS_2 phosphate bin  67.6     6.8 0.00015   27.0   3.0   26   26-51     46-71  (287)
 16 PF02601 Exonuc_VII_L:  Exonucl  66.6      11 0.00023   26.4   3.8   30   19-52     21-50  (319)
 17 cd08465 PBP2_ToxR The C-termin  65.4     8.8 0.00019   23.5   2.9   26   26-51     11-36  (200)
 18 cd08488 PBP2_AmpR The C-termin  65.3      13 0.00029   22.3   3.7   26   27-52     12-37  (191)
 19 cd08481 PBP2_GcdR_like The C-t  64.7      12 0.00026   22.1   3.4   26   27-52     12-37  (194)
 20 cd08456 PBP2_LysR The C-termin  64.7      11 0.00024   22.5   3.2   27   25-51     10-36  (196)
 21 cd08460 PBP2_DntR_like_1 The C  64.4     9.8 0.00021   23.1   2.9   27   25-51     10-36  (200)
 22 cd08439 PBP2_LrhA_like The C-t  64.4      14 0.00029   22.2   3.6   27   25-51     10-36  (185)
 23 cd08435 PBP2_GbpR The C-termin  64.1      12 0.00027   22.2   3.3   26   26-51     11-36  (201)
 24 cd08482 PBP2_TrpI The C-termin  63.3      13 0.00028   22.4   3.3   27   25-51     10-36  (195)
 25 cd08461 PBP2_DntR_like_3 The C  63.3      11 0.00025   22.5   3.1   26   26-51     11-36  (198)
 26 cd08452 PBP2_AlsR The C-termin  63.2      10 0.00023   22.9   2.9   26   26-51     11-36  (197)
 27 cd08487 PBP2_BlaA The C-termin  62.7      14 0.00031   22.0   3.4   26   26-51     11-36  (189)
 28 cd08440 PBP2_LTTR_like_4 TThe   62.6      12 0.00026   22.0   3.0   25   27-51     12-36  (197)
 29 cd08473 PBP2_CrgA_like_4 The C  62.3      17 0.00038   21.6   3.8   26   26-51     14-39  (202)
 30 cd08450 PBP2_HcaR The C-termin  62.2      11 0.00024   22.4   2.9   26   26-51     11-36  (196)
 31 cd08444 PBP2_Cbl The C-termina  62.2      13 0.00028   22.6   3.2   26   26-51     11-36  (198)
 32 PF07315 DUF1462:  Protein of u  61.8      16 0.00034   22.4   3.4   32   17-51     12-43  (93)
 33 KOG0183|consensus               61.7     4.9 0.00011   28.3   1.3   18   19-36    162-179 (249)
 34 cd08448 PBP2_LTTR_aromatics_li  61.6      13 0.00029   21.9   3.2   25   26-50     11-35  (197)
 35 cd08416 PBP2_MdcR The C-termin  61.6      15 0.00032   21.9   3.4   27   25-51     10-36  (199)
 36 cd08412 PBP2_PAO1_like The C-t  61.4      11 0.00025   22.3   2.8   25   27-51     12-36  (198)
 37 cd08477 PBP2_CrgA_like_8 The C  61.1      15 0.00034   21.8   3.4   25   26-50     12-36  (197)
 38 cd08431 PBP2_HupR The C-termin  61.1      13 0.00027   22.3   3.0   25   27-51     12-36  (195)
 39 cd08436 PBP2_LTTR_like_3 The C  60.8      13 0.00027   22.0   2.9   27   25-51     10-36  (194)
 40 cd08426 PBP2_LTTR_like_5 The C  60.8      13 0.00029   22.1   3.1   26   26-51     11-36  (199)
 41 cd08478 PBP2_CrgA The C-termin  60.5      11 0.00024   22.6   2.7   25   26-50     14-38  (199)
 42 cd08464 PBP2_DntR_like_2 The C  60.3      18 0.00039   21.6   3.6   25   27-51     12-36  (200)
 43 cd08486 PBP2_CbnR The C-termin  60.1      13 0.00028   22.7   3.0   25   27-51     13-37  (198)
 44 cd08466 PBP2_LeuO The C-termin  59.8      16 0.00034   21.9   3.3   26   26-51     11-36  (200)
 45 PF03466 LysR_substrate:  LysR   59.7      12 0.00026   22.6   2.7   27   26-52     17-43  (209)
 46 cd08432 PBP2_GcdR_TrpI_HvrB_Am  59.5      18  0.0004   21.4   3.5   28   25-52     10-37  (194)
 47 cd08414 PBP2_LTTR_aromatics_li  59.4      16 0.00034   21.6   3.2   26   26-51     11-36  (197)
 48 PF05762 VWA_CoxE:  VWA domain   59.4      22 0.00049   23.8   4.2   40   13-52     60-99  (222)
 49 cd08453 PBP2_IlvR The C-termin  58.8      16 0.00034   22.0   3.1   25   27-51     12-36  (200)
 50 cd08479 PBP2_CrgA_like_9 The C  58.7      17 0.00037   21.7   3.3   27   25-51     11-37  (198)
 51 cd08425 PBP2_CynR The C-termin  58.7      15 0.00033   21.9   3.1   27   25-51     11-37  (197)
 52 cd08472 PBP2_CrgA_like_3 The C  58.5      21 0.00046   21.3   3.7   25   26-50     12-36  (202)
 53 PF04690 YABBY:  YABBY protein;  58.0     7.1 0.00015   26.1   1.6   19   27-45    130-148 (170)
 54 cd08437 PBP2_MleR The substrat  58.0      14 0.00031   22.1   2.9   25   27-51     12-36  (198)
 55 cd08438 PBP2_CidR The C-termin  57.8      13 0.00028   22.0   2.6   25   27-51     12-36  (197)
 56 cd08434 PBP2_GltC_like The sub  57.8      14  0.0003   21.8   2.7   25   27-51     12-36  (195)
 57 cd08420 PBP2_CysL_like C-termi  57.8      17 0.00036   21.5   3.1   26   26-51     11-36  (201)
 58 PRK14003 potassium-transportin  57.4      16 0.00035   24.9   3.3   45   17-61     93-139 (194)
 59 cd08480 PBP2_CrgA_like_10 The   57.2      18 0.00038   21.9   3.2   25   26-50     12-36  (198)
 60 cd08415 PBP2_LysR_opines_like   56.6     7.9 0.00017   23.0   1.5   26   26-51     11-36  (196)
 61 cd08445 PBP2_BenM_CatM_CatR Th  56.3      19  0.0004   21.8   3.2   25   27-51     13-37  (203)
 62 cd08421 PBP2_LTTR_like_1 The C  55.9      17 0.00037   21.6   3.0   24   28-51     13-36  (198)
 63 PRK13996 potassium-transportin  55.8     9.8 0.00021   26.1   2.0   44   17-60     91-141 (197)
 64 cd08471 PBP2_CrgA_like_2 The C  55.4      24 0.00051   21.1   3.5   25   26-50     12-36  (201)
 65 cd08476 PBP2_CrgA_like_7 The C  55.2      15 0.00032   21.8   2.6   24   27-50     11-34  (197)
 66 cd08423 PBP2_LTTR_like_6 The C  55.1      19 0.00042   21.3   3.1   25   27-51     12-36  (200)
 67 cd08441 PBP2_MetR The C-termin  54.6      25 0.00055   21.0   3.6   24   28-51     13-36  (198)
 68 cd08474 PBP2_CrgA_like_5 The C  54.5      25 0.00054   21.1   3.5   26   26-51     14-39  (202)
 69 cd08483 PBP2_HvrB The C-termin  54.4      22 0.00047   21.1   3.2   25   26-50     11-35  (190)
 70 cd08422 PBP2_CrgA_like The C-t  54.2      16 0.00036   21.5   2.6   24   27-50     13-36  (197)
 71 cd08459 PBP2_DntR_NahR_LinR_li  54.2      30 0.00065   20.7   3.8   26   27-52     12-37  (201)
 72 cd08411 PBP2_OxyR The C-termin  53.0      22 0.00049   21.2   3.1   24   27-50     13-36  (200)
 73 cd08446 PBP2_Chlorocatechol Th  52.9      22 0.00048   21.2   3.1   25   27-51     13-37  (198)
 74 cd08419 PBP2_CbbR_RubisCO_like  52.3      23 0.00049   20.9   3.1   25   27-51     11-35  (197)
 75 cd08458 PBP2_NocR The C-termin  52.2      20 0.00043   21.7   2.8   26   26-51     11-36  (196)
 76 cd08442 PBP2_YofA_SoxR_like Th  52.0      19 0.00041   21.3   2.7   25   27-51     12-36  (193)
 77 cd08449 PBP2_XapR The C-termin  51.9      19  0.0004   21.4   2.6   24   27-50     12-35  (197)
 78 cd08467 PBP2_SyrM The C-termin  51.9      22 0.00047   21.6   3.0   26   26-51     11-36  (200)
 79 PTZ00062 glutaredoxin; Provisi  51.7      45 0.00097   22.6   4.7   37   12-52     21-57  (204)
 80 PRK13997 potassium-transportin  51.5      13 0.00028   25.4   2.0   44   17-60     87-137 (193)
 81 cd08447 PBP2_LTTR_aromatics_li  50.8      25 0.00054   20.9   3.1   26   26-51     11-36  (198)
 82 COG1653 UgpB ABC-type sugar tr  50.3      53  0.0011   22.5   5.0   26   27-52     45-70  (433)
 83 cd08485 PBP2_ClcR The C-termin  50.3      18 0.00039   22.0   2.4   26   26-51     12-37  (198)
 84 cd08469 PBP2_PnbR The C-termin  50.2      27 0.00058   21.5   3.2   26   27-52     12-37  (221)
 85 cd08427 PBP2_LTTR_like_2 The C  50.0      24 0.00052   20.9   2.9   25   27-51     12-36  (195)
 86 cd03026 AhpF_NTD_C TRX-GRX-lik  49.8      49  0.0011   19.1   5.4   37   11-51     15-51  (89)
 87 TIGR00237 xseA exodeoxyribonuc  49.8      28 0.00061   25.9   3.8   30   19-52    136-165 (432)
 88 PRK00286 xseA exodeoxyribonucl  49.4      28 0.00061   25.6   3.7   30   19-52    142-171 (438)
 89 cd02989 Phd_like_TxnDC9 Phosdu  49.2      43 0.00093   19.9   4.0   34   11-48     25-58  (113)
 90 cd08417 PBP2_Nitroaromatics_li  48.9      28 0.00062   20.7   3.1   26   26-51     11-36  (200)
 91 cd08433 PBP2_Nac The C-teminal  48.9      19 0.00042   21.5   2.4   25   27-51     12-36  (198)
 92 cd08475 PBP2_CrgA_like_6 The C  48.4      27 0.00058   20.7   3.0   25   26-50     12-36  (199)
 93 cd08462 PBP2_NodD The C-termin  48.0      31 0.00068   20.8   3.3   26   26-51     11-36  (200)
 94 cd08430 PBP2_IlvY The C-termin  47.7      17 0.00036   21.6   2.0   25   27-51     12-36  (199)
 95 PF06244 DUF1014:  Protein of u  47.6      17 0.00036   23.1   2.0   20   26-45     80-99  (122)
 96 cd08468 PBP2_Pa0477 The C-term  47.5      34 0.00074   20.7   3.4   25   27-51     12-36  (202)
 97 PLN02757 sirohydrochlorine fer  47.4      14 0.00031   23.8   1.7   32   27-58     89-120 (154)
 98 TIGR00681 kdpC K+-transporting  47.3      11 0.00023   25.7   1.1   44   17-60     84-133 (187)
 99 cd08484 PBP2_LTTR_beta_lactama  46.8      36 0.00077   20.2   3.4   26   26-51     11-36  (189)
100 cd08463 PBP2_DntR_like_4 The C  46.6      32 0.00069   21.1   3.2   24   27-50     12-35  (203)
101 cd08451 PBP2_BudR The C-termin  46.3      21 0.00046   21.2   2.3   23   29-51     15-37  (199)
102 smart00329 BPI2 BPI/LBP/CETP C  46.2      55  0.0012   21.5   4.4   33   29-61     48-80  (202)
103 cd08413 PBP2_CysB_like The C-t  45.6      22 0.00048   21.5   2.3   26   26-51     11-36  (198)
104 TIGR02200 GlrX_actino Glutared  45.4      24 0.00052   18.6   2.2   22   11-32      1-22  (77)
105 cd02974 AhpF_NTD_N Alkyl hydro  45.1      65  0.0014   19.1   6.1   40   18-61     28-67  (94)
106 PF09457 RBD-FIP:  FIP domain ;  44.5       9 0.00019   20.6   0.3   20   25-44     25-44  (48)
107 PRK13999 potassium-transportin  44.1      16 0.00034   25.2   1.6   44   17-60     97-144 (201)
108 PRK14002 potassium-transportin  43.9      20 0.00043   24.4   2.0   44   17-60     81-131 (186)
109 TIGR02036 dsdC D-serine deamin  43.4      42 0.00091   22.8   3.6   27   26-52    107-133 (302)
110 PLN02958 diacylglycerol kinase  43.3      51  0.0011   24.9   4.3   44   10-53    112-155 (481)
111 PF13516 LRR_6:  Leucine Rich r  42.3     6.9 0.00015   17.1  -0.3   21    7-29      2-22  (24)
112 PRK13994 potassium-transportin  41.3      22 0.00048   24.8   2.0   44   17-60    111-165 (222)
113 smart00367 LRR_CC Leucine-rich  40.6      22 0.00047   15.8   1.3   23    7-30      2-24  (26)
114 PRK10470 ribosome hibernation   40.6      72  0.0016   18.4   3.9   32   12-44      3-34  (95)
115 cd08457 PBP2_OccR The C-termin  40.6      22 0.00048   21.3   1.7   26   26-51     11-36  (196)
116 PRK00315 potassium-transportin  40.5      15 0.00033   25.0   1.1   44   17-60     86-135 (193)
117 cd00026 BPI2 BPI/LBP/CETP C-te  40.2      82  0.0018   20.7   4.5   32   30-61     44-75  (200)
118 TIGR00741 yfiA ribosomal subun  40.0      71  0.0015   18.1   4.1   31   12-43      3-33  (95)
119 PF02482 Ribosomal_S30AE:  Sigm  38.8      72  0.0016   18.0   3.7   32   12-44      2-33  (97)
120 PF02638 DUF187:  Glycosyl hydr  38.7      49  0.0011   23.5   3.5   30   23-52    202-231 (311)
121 COG1570 XseA Exonuclease VII,   38.5      52  0.0011   25.2   3.7   30   19-52    142-171 (440)
122 KOG1909|consensus               38.2      30 0.00066   26.0   2.4   36    7-48    241-276 (382)
123 COG0607 PspE Rhodanese-related  38.0      52  0.0011   18.5   3.0   23   10-32     61-83  (110)
124 PF02114 Phosducin:  Phosducin;  37.7 1.1E+02  0.0023   21.6   4.9   50   11-65    149-208 (265)
125 PF11247 DUF2675:  Protein of u  37.2      27 0.00058   21.5   1.7   15   24-38     68-82  (98)
126 PF09217 EcoRII-N:  Restriction  36.9      31 0.00066   22.9   2.0   43   24-66     33-77  (156)
127 PF07205 DUF1413:  Domain of un  36.8      62  0.0013   17.9   3.1   33   18-50     27-59  (70)
128 cd02987 Phd_like_Phd Phosducin  36.7      67  0.0015   20.9   3.6   35   12-50     87-121 (175)
129 TIGR02174 CXXU_selWTH selT/sel  36.6      79  0.0017   17.6   4.3   38   12-53      1-38  (72)
130 PF10262 Rdx:  Rdx family;  Int  36.4      80  0.0017   17.6   4.9   37   11-51      2-40  (76)
131 TIGR00269 conserved hypothetic  35.3      20 0.00042   21.5   0.9   24   22-45     34-57  (104)
132 PRK10837 putative DNA-binding   35.1      58  0.0013   21.5   3.2   26   26-51    100-125 (290)
133 PF13504 LRR_7:  Leucine rich r  35.1      19 0.00041   14.8   0.6   11    8-18      2-12  (17)
134 PF00280 potato_inhibit:  Potat  35.0      36 0.00079   19.0   1.9   19   34-52     16-34  (63)
135 PRK10696 tRNA 2-thiocytidine b  34.7      41 0.00088   23.0   2.5   25   22-46    206-230 (258)
136 PRK11139 DNA-binding transcrip  34.6      64  0.0014   21.6   3.4   25   27-51    106-130 (297)
137 PRK11716 DNA-binding transcrip  34.5      67  0.0014   20.8   3.4   25   27-51     79-103 (269)
138 PRK10597 DNA damage-inducible   34.3   1E+02  0.0022   18.2   5.8   43   11-53      2-47  (81)
139 PRK10974 glycerol-3-phosphate   34.3      60  0.0013   23.3   3.4   25   26-50     38-62  (438)
140 PRK13995 potassium-transportin  34.2      65  0.0014   22.2   3.3   44   17-60     95-145 (203)
141 PF08109 Antimicrobial14:  Lact  34.1      26 0.00057   16.9   1.0   23   21-43      4-26  (31)
142 COG4097 Predicted ferric reduc  34.1      44 0.00096   25.5   2.7   44   10-59    344-388 (438)
143 PRK11151 DNA-binding transcrip  34.1      72  0.0016   21.5   3.6   27   25-51    101-127 (305)
144 PRK12681 cysB transcriptional   33.6      63  0.0014   22.4   3.3   36   11-51     94-129 (324)
145 PRK09508 leuO leucine transcri  33.6      73  0.0016   21.7   3.6   26   27-52    124-149 (314)
146 PRK09801 transcriptional activ  33.6      76  0.0016   21.7   3.7   28   24-51    105-132 (310)
147 PF07735 FBA_2:  F-box associat  33.3      73  0.0016   17.0   3.0   35    8-47     33-67  (70)
148 PF09822 ABC_transp_aux:  ABC-t  33.3 1.3E+02  0.0029   20.3   4.8   40   11-50     28-69  (271)
149 PRK14001 potassium-transportin  33.1      70  0.0015   21.8   3.3   44   17-60     85-135 (189)
150 PRK09791 putative DNA-binding   33.0      66  0.0014   21.6   3.2   26   26-51    106-131 (302)
151 TIGR02196 GlrX_YruB Glutaredox  32.8      54  0.0012   16.7   2.3   21   12-32      2-22  (74)
152 cd02957 Phd_like Phosducin (Ph  32.6 1.1E+02  0.0023   17.9   3.9   34   11-48     27-60  (113)
153 PRK11074 putative DNA-binding   32.6      54  0.0012   22.1   2.8   37   10-51     92-128 (300)
154 cd06544 GH18_narbonin Narbonin  32.5      39 0.00084   23.4   2.1   21   32-52     59-79  (253)
155 PRK09375 quinolinate synthetas  32.5      70  0.0015   23.3   3.4   34   16-49    223-269 (319)
156 cd02973 TRX_GRX_like Thioredox  32.3      79  0.0017   16.3   4.7   36   11-50      2-37  (67)
157 PF01547 SBP_bac_1:  Bacterial   32.3      44 0.00095   21.8   2.2   23   29-51      9-32  (315)
158 KOG2559|consensus               32.3      55  0.0012   23.8   2.8   36    1-36      1-36  (318)
159 PRK14997 LysR family transcrip  32.1      95   0.002   20.8   3.9   27   26-52    103-129 (301)
160 COG2871 NqrF Na+-transporting   31.9      94   0.002   23.3   4.0   38    9-51    304-342 (410)
161 PRK03601 transcriptional regul  31.9      89  0.0019   20.9   3.7   26   26-51    100-125 (275)
162 cd04864 LigD_Pol_like_1 LigD_P  31.8      39 0.00084   23.6   2.0   45   22-66    156-201 (228)
163 PRK10086 DNA-binding transcrip  31.7      77  0.0017   21.6   3.4   28   25-52    112-139 (311)
164 KOG3170|consensus               31.7 1.2E+02  0.0026   21.4   4.3   33   23-55    122-154 (240)
165 KOG0863|consensus               31.7      23  0.0005   25.2   0.9   24   20-43    162-185 (264)
166 cd01523 RHOD_Lact_B Member of   31.7      67  0.0015   18.1   2.8   20   12-31     63-82  (100)
167 COG0187 GyrB Type IIA topoisom  31.5      70  0.0015   25.7   3.5   39   27-65    186-224 (635)
168 cd07945 DRE_TIM_CMS Leptospira  31.5      99  0.0021   21.7   4.0   34   13-48    163-196 (280)
169 PF12876 Cellulase-like:  Sugar  31.2      50  0.0011   18.8   2.1   27   23-49     37-63  (88)
170 PF01903 CbiX:  CbiX;  InterPro  31.1      14  0.0003   21.4  -0.3   35   24-58     65-99  (105)
171 PRK10341 DNA-binding transcrip  30.8      85  0.0018   21.3   3.5   37   10-51     97-133 (312)
172 PLN02870 Probable galacturonos  30.7      42 0.00092   26.3   2.2   25    1-31      1-25  (533)
173 PF08073 CHDNT:  CHDNT (NUC034)  30.6      71  0.0015   17.6   2.5   22   25-46     15-36  (55)
174 PF14363 AAA_assoc:  Domain ass  30.3      82  0.0018   18.6   3.0   30   24-53      4-35  (98)
175 cd01388 SOX-TCF_HMG-box SOX-TC  30.2      38 0.00082   18.5   1.4   19   28-46     11-29  (72)
176 PRK13337 putative lipid kinase  29.8 1.3E+02  0.0028   20.8   4.4   42   10-52      2-43  (304)
177 PRK12684 transcriptional regul  28.8      95  0.0021   21.2   3.5   29   23-51    101-129 (313)
178 TIGR02336 1,3-beta-galactosyl-  28.6      58  0.0013   26.5   2.7   27   23-49    184-210 (719)
179 PRK15421 DNA-binding transcrip  28.6      84  0.0018   21.6   3.2   25   27-51    101-125 (317)
180 PF13552 DUF4127:  Protein of u  28.5      53  0.0011   25.1   2.3   19   32-50     92-110 (497)
181 PRK11013 DNA-binding transcrip  28.4      97  0.0021   21.0   3.5   26   27-52    106-131 (309)
182 PRK11914 diacylglycerol kinase  28.2   1E+02  0.0023   21.2   3.7   41    8-49      7-47  (306)
183 KOG3239|consensus               28.1      31 0.00067   23.6   1.0   26   12-37     20-45  (193)
184 cd00552 RaiA RaiA ("ribosome-a  28.1      78  0.0017   17.8   2.6   25   20-44      9-33  (93)
185 PF00505 HMG_box:  HMG (high mo  27.7      52  0.0011   17.3   1.7   18   28-45     10-27  (69)
186 cd03005 PDI_a_ERp46 PDIa famil  27.7      79  0.0017   17.4   2.6   40   11-50     19-58  (102)
187 TIGR02424 TF_pcaQ pca operon t  27.4 1.1E+02  0.0023   20.5   3.5   28   24-51    102-129 (300)
188 TIGR03418 chol_sulf_TF putativ  27.4      86  0.0019   20.8   3.1   26   27-52    101-126 (291)
189 PF02886 LBP_BPI_CETP_C:  LBP /  27.3      48   0.001   22.0   1.8   33   29-61     80-112 (238)
190 TIGR03851 chitin_NgcE carbohyd  27.2      81  0.0018   22.6   3.1   24   27-50     53-76  (450)
191 TIGR00411 redox_disulf_1 small  27.2 1.1E+02  0.0023   16.2   4.3   27   11-37      2-28  (82)
192 cd02066 GRX_family Glutaredoxi  27.1      68  0.0015   16.1   2.1   21   12-32      2-22  (72)
193 TIGR03850 bind_CPR_0540 carboh  26.9 1.2E+02  0.0027   21.4   3.9   25   27-51     47-71  (437)
194 cd02976 NrdH NrdH-redoxin (Nrd  26.9      75  0.0016   16.1   2.2   21   12-32      2-22  (73)
195 PRK11233 nitrogen assimilation  26.6 1.3E+02  0.0028   20.3   3.9   26   26-51    103-128 (305)
196 PLN02495 oxidoreductase, actin  26.5      80  0.0017   23.5   3.0   28   22-50     93-120 (385)
197 PF09508 Lact_bio_phlase:  Lact  26.5      59  0.0013   26.4   2.3   28   22-49    180-207 (716)
198 PF00781 DAGK_cat:  Diacylglyce  26.3 1.4E+02   0.003   17.8   3.6   38   11-51      1-38  (130)
199 PRK10216 DNA-binding transcrip  26.3 1.1E+02  0.0023   20.9   3.4   26   26-51    108-133 (319)
200 PRK15092 DNA-binding transcrip  25.9 1.3E+02  0.0028   20.8   3.8   27   25-51    109-135 (310)
201 PF01624 MutS_I:  MutS domain I  25.9      62  0.0013   19.3   2.0   21   31-51      4-24  (113)
202 PRK10324 translation inhibitor  25.8 1.6E+02  0.0035   17.8   4.2   32   12-44      3-34  (113)
203 cd02975 PfPDO_like_N Pyrococcu  25.7 1.5E+02  0.0033   17.5   4.5   36   11-50     24-60  (113)
204 TIGR01256 modA molybdenum ABC   25.2      93   0.002   19.9   2.8   25   25-50      3-27  (216)
205 PF13905 Thioredoxin_8:  Thiore  25.1      62  0.0013   17.8   1.8   38   13-51      6-43  (95)
206 TIGR03339 phn_lysR aminoethylp  25.0 1.1E+02  0.0023   20.0   3.1   24   28-51     97-120 (279)
207 COG1393 ArsC Arsenate reductas  24.7      74  0.0016   19.6   2.2   23   11-33      2-24  (117)
208 PF02669 KdpC:  K+-transporting  24.4      63  0.0014   21.9   1.9   44   17-60     85-134 (188)
209 PRK11242 DNA-binding transcrip  24.4 1.1E+02  0.0024   20.2   3.1   26   26-51    102-127 (296)
210 TIGR00550 nadA quinolinate syn  24.3 1.3E+02  0.0028   21.7   3.6   35   15-49    210-257 (310)
211 PF11943 DUF3460:  Protein of u  24.2      49  0.0011   18.6   1.2   14   32-45      9-22  (60)
212 PRK13055 putative lipid kinase  24.1 2.4E+02  0.0051   20.0   4.9   40   10-50      3-42  (334)
213 PF08885 GSCFA:  GSCFA family;   24.0 1.3E+02  0.0029   21.0   3.5   31   23-53    147-177 (251)
214 PF09345 DUF1987:  Domain of un  23.7 1.4E+02   0.003   18.0   3.2   36   11-48     48-83  (99)
215 PRK12682 transcriptional regul  23.7 1.3E+02  0.0028   20.3   3.4   26   26-51    104-129 (309)
216 COG5575 ORC2 Origin recognitio  23.7      62  0.0014   25.0   2.0   35   17-51    484-519 (535)
217 cd08443 PBP2_CysB The C-termin  23.6      54  0.0012   19.8   1.4   25   27-51     12-36  (198)
218 PRK10680 molybdopterin biosynt  23.6      64  0.0014   24.0   2.0   39   19-62    250-289 (411)
219 cd02996 PDI_a_ERp44 PDIa famil  23.4 1.6E+02  0.0034   16.8   3.3   33   11-43     21-53  (108)
220 cd02873 GH18_IDGF The IDGF's (  23.3      72  0.0016   23.5   2.2   21   32-52     63-83  (413)
221 KOG1454|consensus               23.1      82  0.0018   22.4   2.4   26   33-58    282-307 (326)
222 PRK12680 transcriptional regul  23.1 1.2E+02  0.0027   21.0   3.3   37   10-51     93-129 (327)
223 PF14606 Lipase_GDSL_3:  GDSL-l  23.1   1E+02  0.0022   20.6   2.8   31   21-51     71-101 (178)
224 KOG0907|consensus               23.1 1.8E+02  0.0039   17.4   3.9   30   15-48     28-57  (106)
225 CHL00180 rbcR LysR transcripti  23.1 1.3E+02  0.0027   20.4   3.2   25   27-51    107-131 (305)
226 TIGR03521 GldG gliding-associa  22.9 2.1E+02  0.0046   21.9   4.7   39   11-49     51-90  (552)
227 PF10307 DUF2410:  Hypothetical  22.8 1.1E+02  0.0025   20.8   3.0   27    6-33    130-156 (197)
228 PHA00684 hypothetical protein   22.8      95  0.0021   20.0   2.4   28   24-52     56-83  (128)
229 cd03409 Chelatase_Class_II Cla  22.7 1.6E+02  0.0034   16.5   3.7   33   25-57     14-46  (101)
230 PF05159 Capsule_synth:  Capsul  22.5 1.3E+02  0.0027   20.3   3.2   27   26-52    138-164 (269)
231 PF14421 LmjF365940-deam:  A di  22.3   1E+02  0.0023   21.1   2.7   25   31-55    161-185 (193)
232 TIGR03087 stp1 sugar transfera  22.1 1.5E+02  0.0032   20.9   3.5   26   25-50    241-266 (397)
233 cd03027 GRX_DEP Glutaredoxin (  22.0 1.4E+02   0.003   15.9   2.7   22   11-32      2-23  (73)
234 PF06891 P2_Phage_GpR:  P2 phag  21.9      78  0.0017   19.9   1.9   27   24-50      5-31  (135)
235 PRK10632 transcriptional regul  21.8 1.5E+02  0.0032   20.2   3.4   26   26-51    103-128 (309)
236 PRK09986 DNA-binding transcrip  21.8 1.3E+02  0.0028   19.9   3.1   25   27-51    109-133 (294)
237 cd02988 Phd_like_VIAF Phosduci  21.7   2E+02  0.0043   19.0   3.9   35   12-50    106-140 (192)
238 cd03045 GST_N_Delta_Epsilon GS  21.7 1.2E+02  0.0027   15.8   2.5   20   12-31      1-20  (74)
239 PF02944 BESS:  BESS motif;  In  21.7      67  0.0015   15.7   1.3   18   26-43      4-21  (37)
240 PF00309 Sigma54_AID:  Sigma-54  21.6      70  0.0015   16.7   1.4   16   31-46     32-47  (49)
241 PF06121 DUF959:  Domain of Unk  21.5      58  0.0013   22.4   1.3   10   24-33    129-138 (202)
242 PHA00440 host protein H-NS-int  21.4      73  0.0016   19.6   1.6   15   24-38     68-82  (98)
243 PF10607 CLTH:  CTLH/CRA C-term  21.3      70  0.0015   19.4   1.6   29   21-49     15-43  (145)
244 PF02960 K1:  K1 glycoprotein;   21.3      34 0.00074   21.9   0.2   42   22-63     30-71  (130)
245 PF06183 DinI:  DinI-like famil  21.2 1.7E+02  0.0036   16.3   3.0   30   24-53      3-33  (65)
246 cd07941 DRE_TIM_LeuA3 Desulfob  21.1   2E+02  0.0042   19.9   3.9   34   13-48    167-200 (273)
247 PRK11062 nhaR transcriptional   21.0 1.3E+02  0.0028   20.3   3.0   25   26-50    104-128 (296)
248 cd03052 GST_N_GDAP1 GST_N fami  20.9 1.1E+02  0.0023   16.6   2.2   20   12-31      1-20  (73)
249 cd04502 SGNH_hydrolase_like_7   20.8 1.9E+02  0.0041   17.6   3.5   28   23-50     69-96  (171)
250 cd03419 GRX_GRXh_1_2_like Glut  20.7      97  0.0021   16.5   2.0   22   12-33      2-23  (82)
251 PRK05972 ligD ATP-dependent DN  20.7 1.2E+02  0.0025   25.2   3.0   41   23-63    742-782 (860)
252 PRK10094 DNA-binding transcrip  20.7 1.3E+02  0.0028   20.5   3.0   38   10-51     92-129 (308)
253 cd02413 40S_S3_KH K homology R  20.5 1.4E+02   0.003   17.2   2.6   31   22-52     48-78  (81)
254 PF01507 PAPS_reduct:  Phosphoa  20.5      40 0.00087   20.7   0.3   34   12-50     26-59  (174)
255 cd01836 FeeA_FeeB_like SGNH_hy  20.5   2E+02  0.0043   17.8   3.6   29   22-50     85-113 (191)
256 PRK12683 transcriptional regul  20.3 1.5E+02  0.0033   20.2   3.2   25   27-51    105-129 (309)
257 cd02872 GH18_chitolectin_chito  20.3      84  0.0018   22.2   2.0   19   33-51     60-78  (362)
258 cd06548 GH18_chitinase The GH1  20.2      90  0.0019   21.9   2.1   20   33-52     74-93  (322)
259 PF10691 DUF2497:  Protein of u  20.2      99  0.0021   17.8   1.9   14   26-39     47-60  (73)

No 1  
>KOG3445|consensus
Probab=99.96  E-value=4.2e-30  Score=165.36  Aligned_cols=67  Identities=28%  Similarity=0.480  Sum_probs=64.4

Q ss_pred             CcccccCcceEEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEecCCCCCEEEEEecCCCC
Q psy15302          1 MAARFGSKLKELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRECSGVTPVVWASGKGTHN   67 (68)
Q Consensus         1 Ms~r~v~qlk~l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~~~~~~P~v~a~Y~nGr~   67 (68)
                      |.-||++||++|+|+||+|||||+|||+||++.|++|+++||+|+|++.+++|.||.|+|+|.|||+
T Consensus        15 Glgryv~ql~rit~sfCnwggSSrGmR~Fle~~L~~~a~enP~v~i~v~~rrg~hP~lraeY~NGre   81 (145)
T KOG3445|consen   15 GLGRYVWQLRRITVSFCNWGGSSRGMREFLESELPDLARENPGVVIYVEPRRGQHPLLRAEYLNGRE   81 (145)
T ss_pred             chhhhhheeeEEEEEEecCCCccHHHHHHHHHHHHHHHhhCCCeEEEEeccCCCCceEEEEecCCce
Confidence            3458999999999999999999999999999999999999999999999999999999999999986


No 2  
>KOG3446|consensus
Probab=99.89  E-value=1.2e-24  Score=131.34  Aligned_cols=61  Identities=59%  Similarity=1.014  Sum_probs=59.1

Q ss_pred             CcceEEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEecCCCCCEEEEEecCCCC
Q psy15302          7 SKLKELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRECSGVTPVVWASGKGTHN   67 (68)
Q Consensus         7 ~qlk~l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~~~~~~P~v~a~Y~nGr~   67 (68)
                      +.||||||+.|+.|+.|+|+|+||++.|+++|+.||++||+||+++|..|.++|+|.+|-+
T Consensus        13 ~~lkElRI~lcqkspaSagvR~fvEk~Y~~lKkaNP~lPILIREcSgVqPrl~ARY~~G~E   73 (97)
T KOG3446|consen   13 LKLKELRIHLCQKSPASAGVREFVEKFYVNLKKANPDLPILIRECSGVQPRLWARYGNGVE   73 (97)
T ss_pred             hhhhhheeeecCCCCcchhHHHHHHHhhhhhhhcCCCCcEeehhhcCCchHHHHHhcCCce
Confidence            4699999999999999999999999999999999999999999999999999999999964


No 3  
>PF05047 L51_S25_CI-B8:  Mitochondrial ribosomal protein L51 / S25 / CI-B8 domain ;  InterPro: IPR007741 Proteins containing this domain are located in the mitochondrion and include ribosomal protein L51, and S25. This domain is also found in mitochondrial NADH-ubiquinone oxidoreductase B8 subunit (CI-B8) 1.6.5.3 from EC. It is not known whether all members of this family form part of the NADH-ubiquinone oxidoreductase and whether they are also all ribosomal proteins.; PDB: 1S3A_A.
Probab=99.67  E-value=1.1e-16  Score=87.27  Aligned_cols=42  Identities=31%  Similarity=0.396  Sum_probs=33.0

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEecCCCCCEEEEEecCCCC
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVRECSGVTPVVWASGKGTHN   67 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~~~~~P~v~a~Y~nGr~   67 (68)
                      +|+|++++||+||..||+|+|+|+++++.||.|+|+|.||++
T Consensus         1 ~R~F~~~~lp~l~~~NP~v~~~v~~~~~~~P~~~~~y~~G~~   42 (52)
T PF05047_consen    1 ARDFLKNNLPTLKYHNPQVQFEVRRRRGRHPFLTAEYLNGRE   42 (52)
T ss_dssp             HHHHHHHTHHHHHHHSTT--EEEE---SSS-EEEEEESS--E
T ss_pred             CHhHHHHhHHHHHHHCCCcEEEEEECCCCCCEEEEEEcCCCE
Confidence            799999999999999999999999999999999999999975


No 4  
>KOG4079|consensus
Probab=98.53  E-value=1.7e-08  Score=66.03  Aligned_cols=61  Identities=18%  Similarity=0.290  Sum_probs=57.5

Q ss_pred             cceEEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEecCCCCCEEEEEecCCCCC
Q psy15302          8 KLKELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRECSGVTPVVWASGKGTHNF   68 (68)
Q Consensus         8 qlk~l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~~~~~~P~v~a~Y~nGr~~   68 (68)
                      .++-.++.|..+|+...|+|+|+--++|+++.+||.|+++........|++++.+++||+.
T Consensus        27 ~V~vfsvnynt~g~~~~GARdFVfwNipQiQykNP~VQ~~~~knmtpsPF~R~YlddGr~v   87 (169)
T KOG4079|consen   27 NVNVFSVNYNTNGPEQSGARDFVFWNIPQIQYKNPKVQLVKHKNMTPSPFARAYLDDGREV   87 (169)
T ss_pred             cceEEEEeccCCCccccCccceEEecchhhcccCCceEEEeeccCCCChHHHheecCcceE
Confidence            4677889999999999999999999999999999999999999999999999999999973


No 5  
>PF10780 MRP_L53:  39S ribosomal protein L53/MRP-L53;  InterPro: IPR019716 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ].  Mitochondrial ribosomal protein L53 (also known as L44) is part of the 39S ribosome []. 
Probab=97.51  E-value=0.00016  Score=39.59  Aligned_cols=49  Identities=18%  Similarity=0.123  Sum_probs=42.3

Q ss_pred             ecCCCCCCHHHHHHHHhC--HHHHHHhCCCCeEEEEecCCCCCEEEEEecCC
Q psy15302         16 LCQKGGSSSGVRDFLAQH--YVPLKQANPKFPILVRECSGVTPVVWASGKGT   65 (68)
Q Consensus        16 yc~~~~sS~G~R~Fl~~~--l~~~~~~NP~v~i~v~~~~~~~P~v~a~Y~nG   65 (68)
                      ||..+..++.+|+||..-  -+....-||+.++..+.. ...|.|...|.||
T Consensus         1 FnPF~~~aksaR~FL~~ip~s~k~~~tni~~~vl~~~~-~~~P~v~V~fkdg   51 (51)
T PF10780_consen    1 FNPFSPNAKSARLFLSLIPPSAKARGTNINCEVLPRVS-RSEPSVTVTFKDG   51 (51)
T ss_pred             CCCCCcccHHHHHHHHhcCCccccccCCCceEEecCCC-CCCCeEEEEeccC
Confidence            688999999999999864  445667899999999888 7799999999998


No 6  
>PF13701 DDE_Tnp_1_4:  Transposase DDE domain group 1
Probab=75.14  E-value=4.8  Score=30.11  Aligned_cols=35  Identities=37%  Similarity=0.445  Sum_probs=31.7

Q ss_pred             CCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEecCC
Q psy15302         19 KGGSSSGVRDFLAQHYVPLKQANPKFPILVRECSG   53 (68)
Q Consensus        19 ~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~~~~   53 (68)
                      +-.|++|+-+||+.-+..+.+.-|+++|++|-.+|
T Consensus       193 n~~sa~g~~~fL~~~l~~lr~~~~~~~ILvR~DSg  227 (448)
T PF13701_consen  193 NVHSAKGAAEFLKRVLRRLRQRWPDTRILVRGDSG  227 (448)
T ss_pred             CCChHHHHHHHHHHHHHHHhhhCccceEEEEecCc
Confidence            45689999999999999999999999999998764


No 7  
>PF13692 Glyco_trans_1_4:  Glycosyl transferases group 1; PDB: 3OY2_A 3OY7_B 2Q6V_A 2HY7_A 3CV3_A 3CUY_A.
Probab=74.39  E-value=4.7  Score=23.69  Aligned_cols=39  Identities=13%  Similarity=0.267  Sum_probs=27.6

Q ss_pred             EEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         13 RIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        13 ~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      .|-|-......+|+..+++.-+..++++.|++.+.+.-.
T Consensus         4 ~i~~~g~~~~~k~~~~li~~~~~~l~~~~p~~~l~i~G~   42 (135)
T PF13692_consen    4 YIGYLGRIRPDKGLEELIEAALERLKEKHPDIELIIIGN   42 (135)
T ss_dssp             EEE--S-SSGGGTHHHHHH-HHHHHHHHSTTEEEEEECE
T ss_pred             cccccccccccccccchhhhHHHHHHHHCcCEEEEEEeC
Confidence            344443333458999999999999999999999998544


No 8  
>COG4837 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=72.71  E-value=5.6  Score=24.68  Aligned_cols=32  Identities=22%  Similarity=0.383  Sum_probs=27.4

Q ss_pred             cCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         17 CQKGGSSSGVRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        17 c~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      |=+.+||+-+-+||+   +.+|++.|..+|..+--
T Consensus        19 CV~aPtsKdt~eWLe---aalkRKyp~~~F~~~Yi   50 (106)
T COG4837          19 CVNAPTSKDTYEWLE---AALKRKYPNQPFKYTYI   50 (106)
T ss_pred             hcCCCcchhHHHHHH---HHHhccCCCCCcEEEEE
Confidence            778999999999998   46799999999987643


No 9  
>COG1182 AcpD Acyl carrier protein phosphodiesterase [Lipid metabolism]
Probab=71.64  E-value=7.2  Score=26.80  Aligned_cols=53  Identities=17%  Similarity=0.196  Sum_probs=35.2

Q ss_pred             EEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEe-cCCCCCEEEEEecCC
Q psy15302         12 LRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRE-CSGVTPVVWASGKGT   65 (68)
Q Consensus        12 l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~-~~~~~P~v~a~Y~nG   65 (68)
                      |.|.-+..+..|. -+...+.-+..+|++||+.+|..+. ....-|.|..+..+|
T Consensus         5 L~I~as~~~~~S~-S~~l~~~Fi~~yk~~~P~dev~~~DL~~e~iP~ld~~~~~a   58 (202)
T COG1182           5 LVIKASPLGENSV-SRKLADEFIETYKEKHPNDEVIERDLAAEPIPHLDEELLAA   58 (202)
T ss_pred             EEEecCCCccccH-HHHHHHHHHHHHHHhCCCCeEEEeecccCCCcccCHHHHhc
Confidence            4455555533332 2334455566899999999999976 567788887776653


No 10 
>cd08429 PBP2_NhaR The C-terminal substrate binding domain of LysR-type transcriptional activator of the nhaA gene, encoding Na+/H+ antiporter, contains the type 2 periplasmic binding fold. NhaR is a positive regulator of the LysR family and is known to be an activator of the nhaA gene encoding a Na(+)/H(+) antiporter. In Escherichia coli, NhaA is the vital antiporter that protects against high sodium stress, and it is essential for growth in high sodium levels, while NhaB becomes essential only if NhaA is not available. The nhaA gene of nhaAR operon is induced by monovalent cations. The nhaR of the operon activates nhaAR, as well as the osmC transcription which is induced at elevated osmolarity. OsmC is transcribed from the two overlapping promoters (osmCp1 and osmP2) and that NhaR is shown to activate only the expression of osmCp1. NhaR also activates the transcription of the pgaABCD operon which is required for production of the biofilm adhesion, poly-beta-1,6-N-acetyl-d-glucosamine 
Probab=70.56  E-value=7.8  Score=24.20  Aligned_cols=29  Identities=10%  Similarity=0.122  Sum_probs=24.6

Q ss_pred             HHHHHHHHhCHHHHHHhCCCCeEEEEecC
Q psy15302         24 SGVRDFLAQHYVPLKQANPKFPILVRECS   52 (68)
Q Consensus        24 ~G~R~Fl~~~l~~~~~~NP~v~i~v~~~~   52 (68)
                      .-...|+...+.+|.+.+|++++.+....
T Consensus         9 ~~~~~~l~~~l~~f~~~~P~v~l~i~~~~   37 (204)
T cd08429           9 AVPKSIAYRLLEPAMDLHEPIRLVCREGK   37 (204)
T ss_pred             hhhHHHHHHHHHHHHHhCCCcEEEEEeCC
Confidence            34578999999999999999999998743


No 11 
>cd08418 PBP2_TdcA The C-terminal substrate binding domain of LysR-type transcriptional regulator TdcA, which is involved in the degradation of L-serine and L-threonine, contains the type 2 periplasmic binding fold. TdcA, a member of the LysR family, activates the expression of the anaerobically-regulated tdcABCDEFG operon which is involved in the degradation of L-serine and L-threonine to acetate and propionate, respectively. The tdc operon is comprised of one regulatory gene tdcA and six structural genes, tdcB to tdcG. The expression of the tdc operon is affected by several transcription factors including the cAMP receptor protein (CRP), integration host factor (IHF), histone-like protein (HU), and the operon specific regulators TdcA and TcdR. TcdR is divergently transcribed from the operon and encodes a small protein that is required for efficient expression of the Escherichia coli tdc operon.  This substrate-binding domain shows significant homology to the type 2 periplasmic binding
Probab=70.28  E-value=7.6  Score=23.19  Aligned_cols=29  Identities=17%  Similarity=0.138  Sum_probs=24.1

Q ss_pred             CHHHHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         23 SSGVRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        23 S~G~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ......++...+.+|++++|++.|.+...
T Consensus         8 ~~~~~~~l~~~l~~~~~~~P~i~l~i~~~   36 (201)
T cd08418           8 SLIAHTLMPAVINRFKEQFPDVQISIYEG   36 (201)
T ss_pred             hHHHHhhhHHHHHHHHHHCCCceEEEEeC
Confidence            34567788899999999999999999753


No 12 
>cd08470 PBP2_CrgA_like_1 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding domain. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 1. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene
Probab=69.74  E-value=8.1  Score=23.14  Aligned_cols=25  Identities=20%  Similarity=0.219  Sum_probs=21.9

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      ...++...+.+|++++|++.|.+..
T Consensus        12 ~~~~l~~~l~~f~~~~P~v~l~i~~   36 (197)
T cd08470          12 GERFIAPLVNDFMQRYPKLEVDIEL   36 (197)
T ss_pred             HHHHHHHHHHHHHHHCCCeEEEEEe
Confidence            3567889999999999999999975


No 13 
>cd05466 PBP2_LTTR_substrate The substrate binding domain of LysR-type transcriptional regulators (LTTRs), a member of the type 2 periplasmic binding fold protein superfamily. This model and hierarchy represent the the substrate-binding domain of the LysR-type transcriptional regulators that form the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA bin
Probab=69.66  E-value=9.4  Score=22.09  Aligned_cols=27  Identities=15%  Similarity=0.130  Sum_probs=22.6

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         25 GVRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        25 G~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ....++...+.+|.+++|++.|.+...
T Consensus        10 ~~~~~l~~~i~~~~~~~p~i~i~~~~~   36 (197)
T cd05466          10 IAAYLLPPLLAAFRQRYPGVELSLVEG   36 (197)
T ss_pred             hHHHHhHHHHHHHHHHCCCCEEEEEEC
Confidence            456678888899999999999998764


No 14 
>TIGR01159 DRP1 density-regulated protein DRP1. This protein family shows weak but suggestive similarity to translation initiation factor SUI1 and its prokaryotic homologs.
Probab=69.61  E-value=3  Score=27.91  Aligned_cols=25  Identities=16%  Similarity=0.279  Sum_probs=22.0

Q ss_pred             EEecCCCCCCHHHHHHHHhCHHHHH
Q psy15302         14 IHLCQKGGSSSGVRDFLAQHYVPLK   38 (68)
Q Consensus        14 ~~yc~~~~sS~G~R~Fl~~~l~~~~   38 (68)
                      ..||+.|++-+-=++||.++.|++-
T Consensus        14 ~EyCEf~~~~~kCk~WL~~n~p~l~   38 (173)
T TIGR01159        14 PEYCEFSGDLKRCKVWLSENAPDLY   38 (173)
T ss_pred             hHHhcCCCCHHHHHHHHHHhChHHH
Confidence            4699999999999999999888654


No 15 
>TIGR02136 ptsS_2 phosphate binding protein. Members of this family are phosphate-binding proteins. Most are found in phosphate ABC-transporter operons, but some are found in phosphate regulatory operons. This model separates members of the current family from the phosphate ABC transporter phosphate binding protein described by TIGRFAMs model TIGR00975.
Probab=67.60  E-value=6.8  Score=26.97  Aligned_cols=26  Identities=12%  Similarity=0.208  Sum_probs=22.8

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      +-.++..-+.+|++++|++.+.+.+.
T Consensus        46 ~~~~lp~~l~~f~~~~P~i~v~i~~~   71 (287)
T TIGR02136        46 VAPLAEAAAEEFQKIHPGVSVTVQGA   71 (287)
T ss_pred             HHHHHHHHHHHHHhhCCCceEEEccC
Confidence            44689999999999999999999774


No 16 
>PF02601 Exonuc_VII_L:  Exonuclease VII, large subunit;  InterPro: IPR020579 Exonuclease VII 3.1.11.6 from EC is composed of two nonidentical subunits; one large subunit and 4 small ones []. Exonuclease VII catalyses exonucleolytic cleavage in either 5'-3' or 3'-5' direction to yield 5'-phosphomononucleotides. The large subunit also contains the OB-fold domains (IPR004365 from INTERPRO) that bind to nucleic acids at the N terminus.  This entry represents Exonuclease VII, large subunit, C-terminal. ; GO: 0008855 exodeoxyribonuclease VII activity
Probab=66.61  E-value=11  Score=26.44  Aligned_cols=30  Identities=30%  Similarity=0.535  Sum_probs=24.5

Q ss_pred             CCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEecC
Q psy15302         19 KGGSSSGVRDFLAQHYVPLKQANPKFPILVRECS   52 (68)
Q Consensus        19 ~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~~~   52 (68)
                      +|+++.|++||+..    +++.+|.++|.+.+..
T Consensus        21 Ts~~gAa~~D~~~~----~~~r~~~~~~~~~p~~   50 (319)
T PF02601_consen   21 TSPTGAAIQDFLRT----LKRRNPIVEIILYPAS   50 (319)
T ss_pred             eCCchHHHHHHHHH----HHHhCCCcEEEEEecc
Confidence            46678999999864    5569999999998865


No 17 
>cd08465 PBP2_ToxR The C-terminal substrate binding domain of LysR-type transcriptional regulator ToxR regulates the expression of the toxoflavin biosynthesis genes; contains the type 2 periplasmic bindinig fold. In soil bacterium Burkholderia glumae, ToxR regulates the toxABCDE and toxFGHI operons in the presence of toxoflavin as a coinducer. Additionally, the expression of both operons requires a transcriptional activator, ToxJ, whose expression is regulated by the TofI or TofR quorum-sensing system. The biosynthesis of toxoflavin is suggested to be synthesized in a pathway common to the synthesis of riboflavin. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After
Probab=65.38  E-value=8.8  Score=23.47  Aligned_cols=26  Identities=19%  Similarity=0.267  Sum_probs=22.3

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ...++...+..|.+++|++++.+...
T Consensus        11 ~~~~l~~~l~~f~~~~P~i~l~i~~~   36 (200)
T cd08465          11 ARLVLPALMRQLRAEAPGIDLAVSQA   36 (200)
T ss_pred             HHHhhhHHHHHHHHHCCCcEEEEecC
Confidence            35788899999999999999998753


No 18 
>cd08488 PBP2_AmpR The C-terminal substrate domain of LysR-type transcriptional regulator AmpR that involved in control of the expression of beta-lactamase gene ampC, contains the type 2 periplasmic binding fold. AmpR acts as a transcriptional activator by binding to a DNA region immediately upstream of the ampC promoter. In the absence of a beta-lactam inducer, AmpR represses the synthesis of beta-lactamase, whereas expression is induced in the presence of a beta-lactam inducer. The AmpD, AmpG, and AmpR proteins are involved in the induction of AmpC-type beta-lactamase (class C) which produced by enterobacterial strains and many other gram-negative bacilli. The activation of ampC by AmpR requires ampG for induction or high-level expression of AmpC. It is probable that the AmpD and AmpG work together to modulate the ability of AmpR to activate ampC expression. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsibl
Probab=65.27  E-value=13  Score=22.31  Aligned_cols=26  Identities=8%  Similarity=0.193  Sum_probs=22.0

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEecC
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVRECS   52 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~~   52 (68)
                      ..++...+.+|.+++|++.|.+....
T Consensus        12 ~~~l~~~l~~f~~~~P~v~i~~~~~~   37 (191)
T cd08488          12 VGWLLPRLADFQNRHPFIDLRLSTNN   37 (191)
T ss_pred             HHHHHhHHHHHHHHCCCcEEEEEecC
Confidence            35777789999999999999998654


No 19 
>cd08481 PBP2_GcdR_like The C-terminal substrate binding domain of LysR-type transcriptional regulators GcdR-like, contains the type 2 periplasmic binding fold. GcdR is involved in the glutaconate/glutarate-specific activation of the Pg promoter driving expression of a glutaryl-CoA dehydrogenase-encoding gene (gcdH). The GcdH protein is essential for the anaerobic catabolism of many aromatic compounds and some alicyclic and dicarboxylic acids.  The structural topology of this substrate-binding domain is most similar to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplas
Probab=64.66  E-value=12  Score=22.14  Aligned_cols=26  Identities=8%  Similarity=0.153  Sum_probs=22.0

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEecC
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVRECS   52 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~~   52 (68)
                      ..++...+.+|.+++|++.|.+....
T Consensus        12 ~~~l~~~l~~f~~~~P~i~i~i~~~~   37 (194)
T cd08481          12 TRWLIPRLPDFLARHPDITVNLVTRD   37 (194)
T ss_pred             HHHHHhhhhHHHHHCCCceEEEEecc
Confidence            46778889999999999999998643


No 20 
>cd08456 PBP2_LysR The C-terminal substrate binding domain of LysR, transcriptional regulator for lysine biosynthesis, contains the type 2 periplasmic binding fold. LysR, the transcriptional activator of lysA encoding diaminopimelate decarboxylase, catalyses the decarboxylation of diaminopimelate to produce lysine. The LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational
Probab=64.66  E-value=11  Score=22.47  Aligned_cols=27  Identities=19%  Similarity=0.265  Sum_probs=22.7

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         25 GVRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        25 G~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      -...++...+.+|.+++|++.+.+...
T Consensus        10 ~~~~~l~~~l~~~~~~~P~i~~~i~~~   36 (196)
T cd08456          10 LSQSFLPRAIKAFLQRHPDVTISIHTR   36 (196)
T ss_pred             HHHhhHHHHHHHHHHHCCCcEEEEEeC
Confidence            345678899999999999999999764


No 21 
>cd08460 PBP2_DntR_like_1 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold. This CD includes an uncharacterized LysR-type transcriptional regulator similar to DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded.  This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytra
Probab=64.41  E-value=9.8  Score=23.05  Aligned_cols=27  Identities=11%  Similarity=0.006  Sum_probs=23.2

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         25 GVRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        25 G~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      -...|+...+..|++++|+++|.+...
T Consensus        10 ~~~~~l~~~l~~~~~~~P~v~v~l~~~   36 (200)
T cd08460          10 FVAAFGPALLAAVAAEAPGVRLRFVPE   36 (200)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEecC
Confidence            457888999999999999999999753


No 22 
>cd08439 PBP2_LrhA_like The C-terminal substrate domain of LysR-like regulator LrhA (LysR homologue A) and that of closely related homologs, contains the type 2 periplasmic binding fold. This CD represents the LrhA subfamily of LysR-like bacterial transcriptional regulators, including LrhA, HexA, PecT, and DgdR.  LrhA is involved in control of the transcription of flagellar, motility, and chemotaxis genes by regulating the synthesis and concentration of FlhD(2)C(2), the master regulator for the expression of flagellar and chemotaxis genes. The LrhA protein has strong homology to HexA and PecT from plant pathogenic bacteria, in which HexA and PecT act as repressors of motility and of virulence factors, such as exoenzymes required for lytic reactions. DgdR also shares similar characteristics to those of LrhA, HexA and PecT. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a vari
Probab=64.38  E-value=14  Score=22.17  Aligned_cols=27  Identities=15%  Similarity=0.044  Sum_probs=22.6

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         25 GVRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        25 G~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      -...++...+.+|++++|++.+.+...
T Consensus        10 ~~~~~l~~~l~~~~~~~P~v~i~~~~~   36 (185)
T cd08439          10 YADTILPFLLNRFASVYPRLAIEVVCK   36 (185)
T ss_pred             HhHHHHHHHHHHHHHHCCCeEEEEEEC
Confidence            345677889999999999999999764


No 23 
>cd08435 PBP2_GbpR The C-terminal substrate binding domain of galactose-binding protein regulator contains the type 2 periplasmic binding fold. Galactose-binding protein regulator (GbpR), a member of the LysR family of bacterial transcriptional regulators, regulates the expression of chromosomal virulence gene chvE.   The chvE gene is involved in the uptake of specific sugars, in chemotaxis to these sugars, and in the VirA-VirG two-component signal transduction system. In the presence of an inducing sugar such as L-arabinose, D-fucose, or D-galactose, GbpR activates chvE expression, while in the absence of an inducing sugar, GbpR represses expression. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a ma
Probab=64.09  E-value=12  Score=22.18  Aligned_cols=26  Identities=19%  Similarity=0.241  Sum_probs=22.2

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ...++...+.+|++++|++.|.+...
T Consensus        11 ~~~~l~~~l~~~~~~~P~v~i~i~~~   36 (201)
T cd08435          11 APVLLPPAIARLLARHPRLTVRVVEG   36 (201)
T ss_pred             HHHHHHHHHHHHHHHCCCeEEEEEeC
Confidence            45778899999999999999999753


No 24 
>cd08482 PBP2_TrpI The C-terminal substrate binding domain of LysR-type transcriptional regulator TrpI, which is involved in control of tryptophan synthesis, contains type 2 periplasmic binding fold. TrpI and indoleglycerol phosphate (InGP), are required to activate transcription of the trpBA, the genes for tryptophan synthase. The trpBA is induced by the InGp substrate, rather than by tryptophan, but the exact mechanism of the activation event is not known. This substrate-binding domain of TrpI shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cy
Probab=63.35  E-value=13  Score=22.43  Aligned_cols=27  Identities=11%  Similarity=0.188  Sum_probs=22.7

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         25 GVRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        25 G~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ....++...+.+|.+++|++.+.+...
T Consensus        10 ~~~~~l~~~i~~f~~~~P~v~i~~~~~   36 (195)
T cd08482          10 LLMRWLIPRLPAFQAALPDIDLQLSAS   36 (195)
T ss_pred             HHHHHHHhhHHHHHHHCCCceEEEEec
Confidence            345788889999999999999998754


No 25 
>cd08461 PBP2_DntR_like_3 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold. This CD includes an uncharacterized LysR-type transcriptional regulator similar to DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded.  This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytra
Probab=63.35  E-value=11  Score=22.50  Aligned_cols=26  Identities=19%  Similarity=0.388  Sum_probs=22.5

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ...++...+.+|++++|++.|.+...
T Consensus        11 ~~~~l~~~l~~f~~~~P~v~i~i~~~   36 (198)
T cd08461          11 QKAILPPLLAALRQEAPGVRVAIRDL   36 (198)
T ss_pred             HHHHhHHHHHHHHHHCCCcEEEEeeC
Confidence            45678899999999999999999764


No 26 
>cd08452 PBP2_AlsR The C-terminal substrate binding domain of LysR-type trnascriptional regulator AlsR, which regulates acetoin formation under stationary phase growth conditions; contains the type 2 periplasmic binding fold. AlsR is responsible for activating the expression of the acetoin operon (alsSD) in response to inducing signals such as glucose and acetate.  Like many other LysR family proteins, AlsR is transcribed divergently from the alsSD operon. The alsS gene encodes acetolactate synthase, an enzyme involved in the production of acetoin in cells of stationary-phase. AlsS catalyzes the conversion of two pyruvate molecules to acetolactate and carbon dioxide. Acetolactate is then converted to acetoin at low pH by acetolactate decarboxylase which encoded by the alsD gene. Acetoin is an important physiological metabolite excreted by many microorganisms grown on glucose or other fermentable carbon sources. This substrate-binding domain shows significant homology to the type 2 perip
Probab=63.16  E-value=10  Score=22.94  Aligned_cols=26  Identities=19%  Similarity=0.336  Sum_probs=22.0

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ...++...+.+|++++|++.|.+...
T Consensus        11 ~~~~l~~~l~~~~~~~P~v~i~i~~~   36 (197)
T cd08452          11 IYEFLPPIVREYRKKFPSVKVELREL   36 (197)
T ss_pred             HHhHHHHHHHHHHHHCCCcEEEEEec
Confidence            45778899999999999999998653


No 27 
>cd08487 PBP2_BlaA The C-terminal substrate-binding domain of LysR-type trnascriptional regulator BlaA which involved in control of the beta-lactamase gene expression; contains the type 2 periplasmic binding fold. This CD represents the C-terminal substrate binding domain of LysR-type transcriptional regulator, BlaA, that involved in control of the expression of beta-lactamase genes, blaA and blaB.  Beta-lactamases are responsible for bacterial resistance to beta-lactam antibiotics such as penicillins.  The blaA gene is located just upstream of blaB in the opposite direction and regulates the expression of the blaB. BlaA also negatively auto-regulates the expression of its own gene, blaA. BlaA (a constitutive class A penicllinase) belongs to the LysR family of transcriptional regulators, whereas BlaB (an inducible class C cephalosporinase or AmpC) can be referred to as a penicillin binding protein but it does not act as a beta-lactamase. The topology of this substrate-binding domain is 
Probab=62.73  E-value=14  Score=21.97  Aligned_cols=26  Identities=15%  Similarity=0.284  Sum_probs=21.8

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ...++...+.+|++++|++.+.+...
T Consensus        11 ~~~~l~~~l~~f~~~~P~i~l~i~~~   36 (189)
T cd08487          11 AVGWLLPRLAEFRQLHPFIELRLRTN   36 (189)
T ss_pred             HHHHHhHHHHHHHHHCCCceEEeeec
Confidence            35677778999999999999999763


No 28 
>cd08440 PBP2_LTTR_like_4 TThe C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor.  The genes controlled by the LTTRs have diverse funct
Probab=62.62  E-value=12  Score=22.03  Aligned_cols=25  Identities=12%  Similarity=0.367  Sum_probs=21.7

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ..++...+..|.+++|++.|.+...
T Consensus        12 ~~~l~~~l~~~~~~~p~v~i~i~~~   36 (197)
T cd08440          12 ATLLPPVLAAFRRRHPGIRVRLRDV   36 (197)
T ss_pred             hhHHHHHHHHHHHhCCCcEEEEEeC
Confidence            4677889999999999999999763


No 29 
>cd08473 PBP2_CrgA_like_4 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 4. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene a
Probab=62.28  E-value=17  Score=21.60  Aligned_cols=26  Identities=15%  Similarity=0.264  Sum_probs=21.9

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ...++...+.+|++++|++.|.+...
T Consensus        14 ~~~~l~~~l~~~~~~~P~i~i~~~~~   39 (202)
T cd08473          14 AQELLAPLLPRFMAAYPQVRLQLEAT   39 (202)
T ss_pred             HHHHHHHHHHHHHHHCCCeEEEEEEc
Confidence            34677889999999999999999764


No 30 
>cd08450 PBP2_HcaR The C-terminal substrate binding domain of LysR-type transcriptional regulator HcaR in involved in 3-phenylpropionic acid catabolism, contains the type2 periplasmic binding fold. HcaR, a member of the LysR family of transcriptional regulators, controls the expression of the hcA1, A2, B, C, and D operon, encoding for the 3-phenylpropionate dioxygenase complex and 3-phenylpropionate-2',3'-dihydrodiol dehydrogenase, that oxidizes 3-phenylpropionate to 3-(2,3-dihydroxyphenyl) propionate.  Dioxygenases play an important role in protecting the cell against the toxic effects of dioxygen. The expression of hcaR is negatively auto-regulated, as for other members of the LysR family, and is strongly repressed in the presence of glucose. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, an
Probab=62.25  E-value=11  Score=22.43  Aligned_cols=26  Identities=12%  Similarity=0.256  Sum_probs=22.3

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ...++...+.+|.+++|++.+.+...
T Consensus        11 ~~~~l~~~l~~~~~~~P~i~l~i~~~   36 (196)
T cd08450          11 EVQWLPEVLPILREEHPDLDVELSSL   36 (196)
T ss_pred             hhhhHHHHHHHHHhhCCCcEEEEEec
Confidence            35778899999999999999999764


No 31 
>cd08444 PBP2_Cbl The C-terminal substrate binding domain of LysR-type transcriptional regulator Cbl, which is required for expression of sulfate starvation-inducible (ssi) genes, contains the type 2 periplasmic binding fold. Cbl is a member of the LysR transcriptional regulators that comprise the largest family of prokaryotic transcription factor. Cbl shows high sequence similarity to CysB, the LysR-type transcriptional activator of genes involved in sulfate and thiosulfate transport, sulfate reduction, and cysteine synthesis. In Escherichia coli, the function of Cbl is required for expression of sulfate starvation-inducible (ssi) genes, coupled with the biosynthesis of cysteine from the organic sulfur sources (sulfonates). The ssi genes include the ssuEADCB and tauABCD operons encoding uptake systems for organosulfur compounds, aliphatic sulfonates, and taurine. The genes in these operons encode an ABC-type transport system required for uptake of aliphatic sulfonates and a desulfonati
Probab=62.17  E-value=13  Score=22.57  Aligned_cols=26  Identities=15%  Similarity=0.190  Sum_probs=21.8

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ...++...+.+|++.+|++.+.+...
T Consensus        11 ~~~~l~~~l~~~~~~~P~v~l~i~~~   36 (198)
T cd08444          11 ARYALPWVVQAFKEQFPNVHLVLHQG   36 (198)
T ss_pred             hhhhhhHHHHHHHHHCCCeEEEEEeC
Confidence            45678889999999999999998764


No 32 
>PF07315 DUF1462:  Protein of unknown function (DUF1462);  InterPro: IPR009190 There are currently no experimental data for members of this group of bacterial proteins or their homologues. A crystal structure of Q7A6J8 from SWISSPROT revealed a thioredoxin-like fold, its core consisting of three layers alpha/beta/alpha.; PDB: 1XG8_A.
Probab=61.84  E-value=16  Score=22.36  Aligned_cols=32  Identities=25%  Similarity=0.379  Sum_probs=23.5

Q ss_pred             cCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         17 CQKGGSSSGVRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        17 c~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      |=+.+||+-+-+||+-   .++++.|+.+|.++-.
T Consensus        12 CVn~PsSkeTyeWL~a---al~RKyp~~~f~~~Yi   43 (93)
T PF07315_consen   12 CVNAPSSKETYEWLEA---ALKRKYPDQPFEFTYI   43 (93)
T ss_dssp             GSSS--HHHHHHHHHH---HHHHH-TTS-EEEEEE
T ss_pred             hcCCCCchhHHHHHHH---HHhCcCCCCceEEEEE
Confidence            6788999999999984   6789999999988654


No 33 
>KOG0183|consensus
Probab=61.67  E-value=4.9  Score=28.31  Aligned_cols=18  Identities=44%  Similarity=0.685  Sum_probs=15.3

Q ss_pred             CCCCCHHHHHHHHhCHHH
Q psy15302         19 KGGSSSGVRDFLAQHYVP   36 (68)
Q Consensus        19 ~~~sS~G~R~Fl~~~l~~   36 (68)
                      +|-+|+-+|+||+++|.+
T Consensus       162 iGr~sk~VrEflEK~y~e  179 (249)
T KOG0183|consen  162 IGRSSKTVREFLEKNYKE  179 (249)
T ss_pred             cccccHHHHHHHHHhccc
Confidence            677999999999987654


No 34 
>cd08448 PBP2_LTTR_aromatics_like_2 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to regulators involved in the catabolism of aromatic compounds, contains type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type regulator similar to CbnR which is involved in the regulation of chlorocatechol breakdown. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Ve
Probab=61.65  E-value=13  Score=21.94  Aligned_cols=25  Identities=12%  Similarity=0.194  Sum_probs=21.8

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      ...++...+.+|.+++|++.|.+..
T Consensus        11 ~~~~l~~~l~~~~~~~P~i~i~i~~   35 (197)
T cd08448          11 LYRGLPRILRAFRAEYPGIEVALHE   35 (197)
T ss_pred             HHHHHHHHHHHHHHHCCCCeEEEEe
Confidence            4578889999999999999999875


No 35 
>cd08416 PBP2_MdcR The C-terminal substrate-binding domian of LysR-type transcriptional regulator MdcR, which involved in the malonate catabolism contains the type 2 periplasmic binding fold. This family includes the C-terminal substrate binding domain of LysR-type transcriptional regulator (LTTR) MdcR that controls the expression of the malonate decarboxylase (mdc) genes. Like other members of the LTTRs, MdcR is a positive regulatory protein for its target promoter and composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins (PBP2). The PBP2 are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these dom
Probab=61.59  E-value=15  Score=21.93  Aligned_cols=27  Identities=15%  Similarity=0.097  Sum_probs=22.8

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         25 GVRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        25 G~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ....++...+.+|.+++|+++|.+...
T Consensus        10 ~~~~~l~~~l~~~~~~~P~i~l~i~~~   36 (199)
T cd08416          10 LTVNTVPRIIMGLKLRRPELDIELTLG   36 (199)
T ss_pred             HHHhhhHHHHHHHHHhCCCeEEEEEEc
Confidence            346678899999999999999999764


No 36 
>cd08412 PBP2_PAO1_like The C-terminal substrate-binding domain of putative LysR-type transcriptional regulator PAO1-like, a member of the type 2 periplasmic binding fold protein superfamily. This family includes the C-terminal substrate domain of a putative LysR-type transcriptional regulator from the plant pathogen Pseudomonas aeruginosa PAO1and its closely related homologs. The LysR-type transcriptional regulators (LTTRs) are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor.  The genes controll
Probab=61.42  E-value=11  Score=22.34  Aligned_cols=25  Identities=20%  Similarity=0.232  Sum_probs=21.6

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ..++...+.+|.+++|++.+.+...
T Consensus        12 ~~~l~~~l~~~~~~~P~i~l~i~~~   36 (198)
T cd08412          12 PYYLPGLLRRFREAYPGVEVRVVEG   36 (198)
T ss_pred             hhhhHHHHHHHHHHCCCcEEEEEEC
Confidence            4677899999999999999999754


No 37 
>cd08477 PBP2_CrgA_like_8 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 8. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene a
Probab=61.08  E-value=15  Score=21.81  Aligned_cols=25  Identities=8%  Similarity=-0.007  Sum_probs=21.6

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      ...++...+.+|++++|++.|.+..
T Consensus        12 ~~~~l~~~l~~~~~~~P~i~l~i~~   36 (197)
T cd08477          12 GSHVLTPALAEYLARYPDVRVDLVL   36 (197)
T ss_pred             HHHHHHHHHHHHHHHCCCcEEEEEe
Confidence            3567788999999999999999975


No 38 
>cd08431 PBP2_HupR The C-terminal substrate binding domain of LysR-type transcriptional regulator, HupR, which regulates expression of the heme uptake receptor HupA; contains the type 2 periplasmic binding fold. HupR, a member of the LysR family, activates hupA transcription under low-iron conditions in the presence of hemin. The expression of many iron-uptake genes, such as hupA,  is regulated at the transcriptional level by iron and an iron-binding repressor protein called Fur (ferric uptake regulation). Under iron-abundant conditions with heme, the active Fur repressor protein represses transcription of the iron-uptake gene hupA, and prevents transcriptional activation via HupR. Under low-iron conditions with heme, the Fur repressor is inactive and transcription of the hupA is allowed. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, p
Probab=61.06  E-value=13  Score=22.31  Aligned_cols=25  Identities=20%  Similarity=-0.016  Sum_probs=21.4

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ..++...+..|.+.+|++.|.+...
T Consensus        12 ~~~l~~~l~~~~~~~P~v~i~i~~~   36 (195)
T cd08431          12 LQPLYPLIAEFYQLNKATRIRLSEE   36 (195)
T ss_pred             hHHHHHHHHHHHHHCCCCceEEEEe
Confidence            4577889999999999999999764


No 39 
>cd08436 PBP2_LTTR_like_3 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor.  The genes controlled by the LTTRs have diverse functi
Probab=60.77  E-value=13  Score=22.02  Aligned_cols=27  Identities=15%  Similarity=0.151  Sum_probs=22.7

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         25 GVRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        25 G~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      -...++...+.+|.+++|++.+.+...
T Consensus        10 ~~~~~l~~~l~~~~~~~P~v~i~i~~~   36 (194)
T cd08436          10 LAAVDLPELLARFHRRHPGVDIRLRQA   36 (194)
T ss_pred             HHHHHHHHHHHHHHHHCCCcEEEEecC
Confidence            345678899999999999999999764


No 40 
>cd08426 PBP2_LTTR_like_5 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor.  The genes controlled by the LTTRs have diverse functi
Probab=60.77  E-value=13  Score=22.12  Aligned_cols=26  Identities=15%  Similarity=0.193  Sum_probs=22.1

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ...++...+..|++++|++.+.+...
T Consensus        11 ~~~~l~~~l~~~~~~~P~i~l~i~~~   36 (199)
T cd08426          11 AAELLPSLIARFRQRYPGVFFTVDVA   36 (199)
T ss_pred             HHHHHHHHHHHHHHhCCCeEEEEEeC
Confidence            35677889999999999999999764


No 41 
>cd08478 PBP2_CrgA The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA, contains the type 2 periplasmic binding domain. This CD represents the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene wh
Probab=60.52  E-value=11  Score=22.61  Aligned_cols=25  Identities=16%  Similarity=0.264  Sum_probs=21.6

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      ...++...+.+|.+++|++.|.+..
T Consensus        14 ~~~~l~~~l~~f~~~~P~v~i~~~~   38 (199)
T cd08478          14 VLHLLAPLIAKFRERYPDIELELVS   38 (199)
T ss_pred             HHHHHHHHHHHHHHHCCCeEEEEEe
Confidence            4567889999999999999999863


No 42 
>cd08464 PBP2_DntR_like_2 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold. This CD includes an uncharacterized LysR-type transcriptional regulator similar to DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded.  This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytra
Probab=60.32  E-value=18  Score=21.59  Aligned_cols=25  Identities=12%  Similarity=0.229  Sum_probs=21.6

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ..++...+.+|++++|++.|.+...
T Consensus        12 ~~~l~~~l~~~~~~~P~v~l~i~~~   36 (200)
T cd08464          12 SWLAPPLLAALRAEAPGVRLVFRQV   36 (200)
T ss_pred             HHHHHHHHHHHHHHCCCcEEEEecC
Confidence            4677888999999999999999764


No 43 
>cd08486 PBP2_CbnR The C-terminal substrate binding domain of LysR-type transcriptional regulator, CbnR, involved in the chlorocatechol catabolism, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of LysR-type regulator CbnR which is involved in the regulation of chlorocatechol breakdown. The chlorocatechol-degradative pathway is often found in bacteria that can use chlorinated aromatic compounds as carbon and energy sources. CbnR is found in the 3-chlorobenzoate degradative bacterium Ralstonia eutropha NH9 and forms a tetramer. CbnR activates the expression of the cbnABCD genes, which are responsible for the degradation of chlorocatechol converted from 3-chlorobenzoate and are transcribed divergently from cbnR. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccha
Probab=60.13  E-value=13  Score=22.74  Aligned_cols=25  Identities=8%  Similarity=0.046  Sum_probs=21.6

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ..++...+.+|++.+|+++|.+.+.
T Consensus        13 ~~~l~~~l~~f~~~~P~v~i~i~~~   37 (198)
T cd08486          13 YRSLPLLLRAFLTSTPTATVSLTHM   37 (198)
T ss_pred             HHHHHHHHHHHHHhCCCeEEEEEEC
Confidence            5677888999999999999998764


No 44 
>cd08466 PBP2_LeuO The C-terminal substrate binding domain of LysR-type transcriptional regulator LeuO, an activator of  leucine synthesis operon, contains the type 2 periplasmic binding fold. LeuO, a LysR-type transcriptional regulator, was originally identified as an activator of the leucine synthesis operon (leuABCD). Subsequently, LeuO was found to be not a specific regulator of the leu gene but a global regulator of unrelated various genes. LeuO activates bglGFB (utilization of beta-D-glucoside) and represses cadCBA (lysine decarboxylation) and dsrA (encoding a regulatory small RNA for translational control of rpoS and hns). LeuO also regulates the yjjQ-bglJ operon which coding for a LuxR-type transcription factor. In Salmonella enterica serovar Typhi, LeuO is a positive regulator of ompS1 (encoding an outer membrane), ompS2 (encoding a pathogenicity determinant), and assT, while LeuO represses the expression of OmpX and Tpx. Both osmS1 and osmS2 influence virulence in the mouse mo
Probab=59.78  E-value=16  Score=21.89  Aligned_cols=26  Identities=19%  Similarity=0.160  Sum_probs=22.3

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ...++..-+.+|.+++|++.|.+...
T Consensus        11 ~~~~l~~~l~~f~~~~P~v~l~~~~~   36 (200)
T cd08466          11 DLLLLPRLLARLKQLAPNISLRESPS   36 (200)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEecC
Confidence            35677889999999999999999764


No 45 
>PF03466 LysR_substrate:  LysR substrate binding domain;  InterPro: IPR005119 The structure of this domain is known and is similar to the periplasmic binding proteins []. This domain is found in members of the LysR family of prokaryotic transcriptional regulatory proteins IPR000847 from INTERPRO which share sequence similarities over approximately 280 residues including a putative helix-turn-helix DNA-binding motif at their N terminus.; PDB: 3ONM_B 3FZJ_J 3FXR_B 3N6T_A 3FXQ_A 3FXU_A 3N6U_A 2QSX_B 3HO7_B 1IZ1_B ....
Probab=59.73  E-value=12  Score=22.62  Aligned_cols=27  Identities=19%  Similarity=0.381  Sum_probs=23.2

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEecC
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVRECS   52 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~~   52 (68)
                      ...++...+.+|.+++|++.|.+....
T Consensus        17 ~~~~l~~~l~~~~~~~P~i~i~~~~~~   43 (209)
T PF03466_consen   17 ASSLLPPLLAEFRERHPNIRIEIREGD   43 (209)
T ss_dssp             HHHTHHHHHHHHHHHSTTEEEEEEEES
T ss_pred             HHHHHHHHHHHHHHHCCCcEEEEEecc
Confidence            367778999999999999999998754


No 46 
>cd08432 PBP2_GcdR_TrpI_HvrB_AmpR_like The C-terminal substrate domain of LysR-type GcdR, TrPI, HvR and beta-lactamase regulators, and that of other closely related homologs; contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate domain of LysR-type transcriptional regulators involved in controlling the expression of glutaryl-CoA dehydrogenase (GcdH), S-adenosyl-L-homocysteine hydrolase, cell division protein FtsW, tryptophan synthase, and beta-lactamase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex compris
Probab=59.53  E-value=18  Score=21.35  Aligned_cols=28  Identities=7%  Similarity=0.185  Sum_probs=22.8

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEecC
Q psy15302         25 GVRDFLAQHYVPLKQANPKFPILVRECS   52 (68)
Q Consensus        25 G~R~Fl~~~l~~~~~~NP~v~i~v~~~~   52 (68)
                      ....++...+.+|.+++|++.|.+....
T Consensus        10 ~~~~~l~~~l~~~~~~~P~v~i~~~~~~   37 (194)
T cd08432          10 FAARWLIPRLARFQARHPDIDLRLSTSD   37 (194)
T ss_pred             HHHHHHHHHhHHHHHHCCCeEEEEEecC
Confidence            3455778889999999999999997643


No 47 
>cd08414 PBP2_LTTR_aromatics_like The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of aromatic compounds and that of other related regulators, contains type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LTTRs involved in degradation of aromatic compounds, such as CbnR, BenM, CatM, ClcR and TfdR, as well as that of other transcriptional regulators clustered together in phylogenetic trees, including XapR, HcaR, MprR, IlvR, BudR, AlsR, LysR, and OccR. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they ca
Probab=59.38  E-value=16  Score=21.64  Aligned_cols=26  Identities=15%  Similarity=0.290  Sum_probs=22.2

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ...++...+.+|.+++|++.|.+...
T Consensus        11 ~~~~l~~~l~~~~~~~p~i~i~i~~~   36 (197)
T cd08414          11 LYGLLPRLLRRFRARYPDVELELREM   36 (197)
T ss_pred             HHHHHHHHHHHHHHHCCCcEEEEecC
Confidence            45678899999999999999998753


No 48 
>PF05762 VWA_CoxE:  VWA domain containing CoxE-like protein;  InterPro: IPR008912 This group of proteins contains a VWA type domain and the function of this family is unknown. It is found as part of a CO oxidising (Cox) system operon in several bacteria [].
Probab=59.36  E-value=22  Score=23.77  Aligned_cols=40  Identities=20%  Similarity=0.397  Sum_probs=34.0

Q ss_pred             EEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEecC
Q psy15302         13 RIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRECS   52 (68)
Q Consensus        13 ~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~~~   52 (68)
                      .+..||.|||=.+.-.|+-.-+-.+..+.+.+.+.+....
T Consensus        60 lvvl~DvSGSM~~~s~~~l~~~~~l~~~~~~~~~f~F~~~   99 (222)
T PF05762_consen   60 LVVLCDVSGSMAGYSEFMLAFLYALQRQFRRVRVFVFSTR   99 (222)
T ss_pred             EEEEEeCCCChHHHHHHHHHHHHHHHHhCCCEEEEEEeee
Confidence            4567999999999888888888899999999988886643


No 49 
>cd08453 PBP2_IlvR The C-terminal substrate binding domain of LysR-type transcriptional regulator, IlvR, involved in the biosynthesis of isoleucine, leucine and valine; contains type 2 periplasmic binding fold. The IlvR is an activator of the upstream and divergently transcribed ilvD gene, which encodes dihydroxy acid dehydratase that participates in isoleucine, leucine, and valine biosynthesis. As in the case of other members of the LysR family, the expression of ilvR gene is repressed in the presence of its own gene product. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport
Probab=58.78  E-value=16  Score=21.99  Aligned_cols=25  Identities=20%  Similarity=0.345  Sum_probs=21.9

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ..++...+.+|.+++|++.+.+...
T Consensus        12 ~~~l~~~l~~~~~~~P~i~l~i~~~   36 (200)
T cd08453          12 YSVLPELVRRFREAYPDVELQLREA   36 (200)
T ss_pred             hHHHHHHHHHHHHhCCCceEEEEeC
Confidence            5688899999999999999999763


No 50 
>cd08479 PBP2_CrgA_like_9 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 9. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene a
Probab=58.72  E-value=17  Score=21.69  Aligned_cols=27  Identities=11%  Similarity=0.127  Sum_probs=22.6

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         25 GVRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        25 G~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ....++...+.+|++++|++.|.+...
T Consensus        11 ~~~~~l~~~l~~f~~~~P~i~i~~~~~   37 (198)
T cd08479          11 FGRRHIAPALSDFAKRYPELEVQLELT   37 (198)
T ss_pred             HHHHHHHHHHHHHHHHCCCeEEEEEec
Confidence            345778899999999999999998753


No 51 
>cd08425 PBP2_CynR The C-terminal substrate-binding domain of the LysR-type transcriptional regulator CynR, contains the type 2 periplasmic binding fold. CynR is a LysR-like transcriptional regulator of the cyn operon, which encodes genes that allow cyanate to be used as a sole source of nitrogen. The operon includes three genes in the following order: cynT (cyanate permease), cynS (cyanase), and cynX (a protein of unknown function).  CynR negatively regulates its own expression independently of cyanate. CynR binds to DNA and induces bending of DNA in the presence or absence of cyanate, but the amount of bending is decreased by cyanate. The CynR of LysR-type transcriptional regulator family is composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding 
Probab=58.70  E-value=15  Score=21.89  Aligned_cols=27  Identities=11%  Similarity=0.103  Sum_probs=22.9

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         25 GVRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        25 G~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ....++...+.+|.+++|++.|.+...
T Consensus        11 ~~~~~l~~~l~~~~~~~P~v~i~i~~~   37 (197)
T cd08425          11 FTAYLIGPLIDRFHARYPGIALSLREM   37 (197)
T ss_pred             hhhhhhHHHHHHHHHHCCCcEEEEEEC
Confidence            456777899999999999999999764


No 52 
>cd08472 PBP2_CrgA_like_3 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 3. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene a
Probab=58.50  E-value=21  Score=21.29  Aligned_cols=25  Identities=12%  Similarity=0.089  Sum_probs=21.6

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      ...++...+.+|.+++|++.|.+..
T Consensus        12 ~~~~l~~~l~~~~~~~P~i~v~~~~   36 (202)
T cd08472          12 ARLLLIPALPDFLARYPDIELDLGV   36 (202)
T ss_pred             HHHHHHHHHHHHHHHCCCcEEEEEE
Confidence            4567889999999999999999864


No 53 
>PF04690 YABBY:  YABBY protein;  InterPro: IPR006780 YABBY proteins are a group of plant-specific transcription factors involved in the specification of abaxial polarity in lateral organs such as leaves and floral organs [, ].
Probab=58.00  E-value=7.1  Score=26.14  Aligned_cols=19  Identities=21%  Similarity=0.483  Sum_probs=17.0

Q ss_pred             HHHHHhCHHHHHHhCCCCe
Q psy15302         27 RDFLAQHYVPLKQANPKFP   45 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~   45 (68)
                      ..||++.+..||+.||++.
T Consensus       130 n~f~k~ei~rik~~~p~is  148 (170)
T PF04690_consen  130 NRFMKEEIQRIKAENPDIS  148 (170)
T ss_pred             HHHHHHHHHHHHhcCCCCC
Confidence            4699999999999999975


No 54 
>cd08437 PBP2_MleR The substrate binding domain of LysR-type transcriptional regulator MleR which required for malolactic fermentation, contains type 2 periplasmic binidning fold. MleR, a transcription activator of malolactic fermentation system, is found in gram-positive bacteria and belongs to the lysR family of bacterial transcriptional regulators. The mleR gene is required for the expression and induction of malolactic fermentation. This substrate binding domain has significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase dom
Probab=58.00  E-value=14  Score=22.12  Aligned_cols=25  Identities=12%  Similarity=0.018  Sum_probs=21.5

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      -.++...+.+|.+.+|++.|.+...
T Consensus        12 ~~~l~~~l~~~~~~~P~v~i~~~~~   36 (198)
T cd08437          12 NYYFPKLAKDLIKTGLMIQIDTYEG   36 (198)
T ss_pred             HHHhHHHHHHHHHhCCceEEEEEEc
Confidence            4677899999999999999999753


No 55 
>cd08438 PBP2_CidR The C-terminal substrate binding domain of LysR-like transcriptional regulator CidR, contains the type 2 periplasmic binding fold. This CD includes the substrate binding domain of CidR which positively up-regulates the expression of cidABC operon in the presence of acetic acid produced by the metabolism of excess glucose. The CidR affects the control of murein hydrolase activity by enhancing cidABC expression in the presence of acetic acid. Thus, up-regulation of cidABC expression results in increased murein hydrolase activity. This substrate binding domain has significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate 
Probab=57.81  E-value=13  Score=22.01  Aligned_cols=25  Identities=16%  Similarity=0.238  Sum_probs=21.5

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ..++...+.+|++++|++.|.+...
T Consensus        12 ~~~l~~~l~~~~~~~p~v~i~i~~~   36 (197)
T cd08438          12 SLLFAPLLAAFRQRYPNIELELVEY   36 (197)
T ss_pred             hhhcHHHHHHHHHHCcCeEEEEEEc
Confidence            4677889999999999999999764


No 56 
>cd08434 PBP2_GltC_like The substrate binding domain of LysR-type transcriptional regulator GltC, which activates gltA expression of glutamate synthase operon, contains type 2 periplasmic binding fold. GltC, a member of the LysR family of bacterial transcriptional factors, activates the expression of gltA gene of glutamate synthase operon and is essential for cell growth in the absence of glutamate. Glutamate synthase is a heterodimeric protein that encoded by gltA and gltB, whose expression is subject to nutritional regulation. GltC also negatively auto-regulates its own expression. This substrate-binding domain has strong homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, 
Probab=57.79  E-value=14  Score=21.76  Aligned_cols=25  Identities=4%  Similarity=0.198  Sum_probs=21.6

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ..++...+.+|.+++|++++.+...
T Consensus        12 ~~~l~~~l~~~~~~~P~i~i~i~~~   36 (195)
T cd08434          12 TSLVPDLIRAFRKEYPNVTFELHQG   36 (195)
T ss_pred             hhhhHHHHHHHHHhCCCeEEEEecC
Confidence            4677888999999999999999864


No 57 
>cd08420 PBP2_CysL_like C-terminal substrate binding domain of LysR-type transcriptional regulator CysL, which activates the transcription of the cysJI operon encoding sulfite reductase, contains the type 2 periplasmic binding fold. CysL, also known as YwfK, is a regular of sulfur metabolism in Bacillus subtilis. Sulfur is required for the synthesis of proteins and essential cofactors in all living organism. Sulfur can be assimilated either from inorganic sources (sulfate and thiosulfate), or from organic sources (sulfate esters, sulfamates, and sulfonates). CysL activates the transcription of the cysJI operon encoding sulfite reductase, which reduces sulfite to sulfide. Both cysL mutant and cysJI mutant are unable to grow using sulfate or sulfite as the sulfur source. Like other LysR-type regulators, CysL also negatively regulates its own transcription. In Escherichia coli, three LysR-type activators are involved in the regulation of sulfur metabolism: CysB, Cbl and MetR.  The topology
Probab=57.76  E-value=17  Score=21.46  Aligned_cols=26  Identities=8%  Similarity=0.124  Sum_probs=22.0

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ...++...+.+|++.+|++.+.+...
T Consensus        11 ~~~~l~~~l~~~~~~~P~~~l~~~~~   36 (201)
T cd08420          11 GEYLLPRLLARFRKRYPEVRVSLTIG   36 (201)
T ss_pred             hhhhhHHHHHHHHHHCCCceEEEEeC
Confidence            45677889999999999999998764


No 58 
>PRK14003 potassium-transporting ATPase subunit C; Provisional
Probab=57.41  E-value=16  Score=24.93  Aligned_cols=45  Identities=13%  Similarity=0.160  Sum_probs=36.2

Q ss_pred             cCCCCCCHHHHHHHHhCHHHHHHhCCCC--eEEEEecCCCCCEEEEE
Q psy15302         17 CQKGGSSSGVRDFLAQHYVPLKQANPKF--PILVRECSGVTPVVWAS   61 (68)
Q Consensus        17 c~~~~sS~G~R~Fl~~~l~~~~~~NP~v--~i~v~~~~~~~P~v~a~   61 (68)
                      ++-++++.-+.+-+++....++++||..  ..++...+|-+|.|.-.
T Consensus        93 SNl~psnp~l~~~v~~r~~~~~~~~~~pp~DlVTaSgSGLDPhISp~  139 (194)
T PRK14003         93 SNLAPSNPALIERIKEEANRLQDAGIQPTADLVYTSGSGLDPHISPE  139 (194)
T ss_pred             cCCCCCCHHHHHHHHHHHHHHHHcCCCCChhheecccccCCCCCCHH
Confidence            4567889999999999999999999654  66667778889987543


No 59 
>cd08480 PBP2_CrgA_like_10 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 10. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene
Probab=57.19  E-value=18  Score=21.90  Aligned_cols=25  Identities=12%  Similarity=0.085  Sum_probs=21.4

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      ...++...+.+|.+++|++.+.+..
T Consensus        12 ~~~~l~~~l~~~~~~~P~i~i~i~~   36 (198)
T cd08480          12 GTHFLLPLLPAFLARYPEILVDLSL   36 (198)
T ss_pred             HhHhhHHHHHHHHHHCCCeEEEEEe
Confidence            3467889999999999999999864


No 60 
>cd08415 PBP2_LysR_opines_like The C-terminal substrate-domain of LysR-type transcriptional regulators involved in the catabolism of opines and that of related regulators, contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate-domain of LysR-type transcriptional regulators, OccR and NocR, involved in the catabolism of opines and that of LysR for lysine biosynthesis which clustered together in phylogenetic trees. Opines, such as octopine and nopaline, are low molecular weight compounds found in plant crown gall tumors that are produced by the parasitic bacterium Agrobacterium. There are at least 30 different opines identified so far. Opines are utilized by tumor-colonizing bacteria as a source of carbon, nitrogen, and energy. NocR and OccR belong to the family of LysR-type transcriptional regulators that positively regulates the catabolism of nopaline and octopine, respectively. Both nopaline and octopalin are arginine derivatives. In Agrobacterium tumefa
Probab=56.61  E-value=7.9  Score=23.02  Aligned_cols=26  Identities=12%  Similarity=0.245  Sum_probs=21.6

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ...++...+.+|.+++|++.+.+...
T Consensus        11 ~~~~l~~~l~~~~~~~P~i~l~i~~~   36 (196)
T cd08415          11 ALSLLPRAIARFRARHPDVRISLHTL   36 (196)
T ss_pred             cccccHHHHHHHHHHCCCcEEEEEec
Confidence            34677888999999999999998764


No 61 
>cd08445 PBP2_BenM_CatM_CatR The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in benzoate catabolism; contains the type 2 periplasmic binding fold. This CD includes the C-terminal of LysR-type transcription regulators, BenM, CatM, and CatR, which are involved in the benzoate catabolism. The BenM and CatM are paralogs with overlapping functions. BenM responds synergistically to two effectors, benzoate and cis,cis-muconate, to activate expression of the benABCDE operon which is involved in benzoate catabolism, while CatM responses only to muconate. BenM and CatM share high protein sequence identity and bind to the operator-promoter regions that have similar DNA sequences. In Pseudomonas species, phenolic compounds are converted by different enzymes to central intermediates, such as protocatechuate and catechols. Generally, unsubstituted compounds, such as benzoate, are metabolized by an ortho-cleavage pathway. The catBCA operon encodes three enzymes
Probab=56.26  E-value=19  Score=21.84  Aligned_cols=25  Identities=24%  Similarity=0.285  Sum_probs=21.8

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ..++...+.+|.+.+|++.+.+...
T Consensus        13 ~~~l~~~l~~~~~~~P~i~l~i~~~   37 (203)
T cd08445          13 YGLLPELIRRFRQAAPDVEIELIEM   37 (203)
T ss_pred             HhHHHHHHHHHHHHCCCeEEEEEeC
Confidence            5678899999999999999998754


No 62 
>cd08421 PBP2_LTTR_like_1 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor.  The genes controlled by the LTTRs have diverse functi
Probab=55.85  E-value=17  Score=21.61  Aligned_cols=24  Identities=25%  Similarity=0.429  Sum_probs=20.8

Q ss_pred             HHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         28 DFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        28 ~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      .++...+.+|.+.+|+++|.+...
T Consensus        13 ~~l~~~l~~~~~~~P~i~i~~~~~   36 (198)
T cd08421          13 EFLPEDLASFLAAHPDVRIDLEER   36 (198)
T ss_pred             hhhHHHHHHHHHHCCCceEEEEec
Confidence            567889999999999999999754


No 63 
>PRK13996 potassium-transporting ATPase subunit C; Provisional
Probab=55.82  E-value=9.8  Score=26.06  Aligned_cols=44  Identities=14%  Similarity=0.276  Sum_probs=33.9

Q ss_pred             cCCCCCCHHHHHHHHhCHHHHHHhCCC-----CeEE--EEecCCCCCEEEE
Q psy15302         17 CQKGGSSSGVRDFLAQHYVPLKQANPK-----FPIL--VRECSGVTPVVWA   60 (68)
Q Consensus        17 c~~~~sS~G~R~Fl~~~l~~~~~~NP~-----v~i~--v~~~~~~~P~v~a   60 (68)
                      ++.+++|.-+++-+++....|++.||.     ||..  +...+|-+|.|.-
T Consensus        91 SNlgpsnp~L~~~v~~r~~~~~~~~~~v~~~~vP~DlvTaSgSGLDPhISp  141 (197)
T PRK13996         91 SNLSPASKEYEALVQERVEKIRANHPEQDEKPIPVDLVTCSGSGLDPHISV  141 (197)
T ss_pred             cCCCCCCHHHHHHHHHHHHHHHHhCCCCCCCCCCHHHHhccccCCCCCCCH
Confidence            567889999999999999999999995     4433  3445677887653


No 64 
>cd08471 PBP2_CrgA_like_2 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 2. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene a
Probab=55.42  E-value=24  Score=21.06  Aligned_cols=25  Identities=12%  Similarity=0.041  Sum_probs=21.6

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      ...++...+.+|.+.+|++.|.+..
T Consensus        12 ~~~~l~~~l~~~~~~~P~v~i~i~~   36 (201)
T cd08471          12 GRLHVLPIITDFLDAYPEVSVRLLL   36 (201)
T ss_pred             HHHHHHHHHHHHHHHCCCcEEEEEE
Confidence            3567789999999999999999975


No 65 
>cd08476 PBP2_CrgA_like_7 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 7. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene a
Probab=55.23  E-value=15  Score=21.76  Aligned_cols=24  Identities=13%  Similarity=0.128  Sum_probs=20.0

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      ..++...+.+|++++|++.|.+..
T Consensus        11 ~~~l~~~l~~~~~~~P~v~i~~~~   34 (197)
T cd08476          11 GGLLLPVLAAFMQRYPEIELDLDF   34 (197)
T ss_pred             HHHHHHHHHHHHHHCCCeEEEEEe
Confidence            356667899999999999999854


No 66 
>cd08423 PBP2_LTTR_like_6 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor.  The genes controlled by the LTTRs have diverse functi
Probab=55.06  E-value=19  Score=21.28  Aligned_cols=25  Identities=20%  Similarity=0.420  Sum_probs=21.5

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      -.++...+.+|.+++|++.|.+...
T Consensus        12 ~~~l~~~l~~~~~~~P~i~i~~~~~   36 (200)
T cd08423          12 AALLPPALAALRARHPGLEVRLREA   36 (200)
T ss_pred             HHhhhHHHHHHHHhCCCCeEEEEeC
Confidence            4577889999999999999999764


No 67 
>cd08441 PBP2_MetR The C-terminal substrate binding domain of LysR-type transcriptional regulator metR, which regulates the expression of methionine biosynthetic genes, contains type 2 periplasmic binding fold. MetR, a member of the LysR family, is a positive regulator for the metA, metE, metF, and metH genes. The sulfur-containing amino acid methionine is the universal initiator of protein synthesis in all known organisms and its derivative S-adenosylmethionine (SAM) and autoinducer-2 (AI-2) are involved in various cellular processes. SAM plays a central role as methyl donor in methylation reactions, which are essential for the biosynthesis of phospholipids, proteins, DNA and RNA.  The interspecies signaling molecule AI-2 is involved in cell-cell communication process (quorum sensing) and gene regulation in bacteria. Although methionine biosynthetic enzymes and metabolic pathways are well conserved in bacteria, the regulation of methionine biosynthesis involves various regulatory mecha
Probab=54.60  E-value=25  Score=21.00  Aligned_cols=24  Identities=13%  Similarity=0.207  Sum_probs=20.4

Q ss_pred             HHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         28 DFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        28 ~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      .++...+.+|.+++|++.|.+...
T Consensus        13 ~~~~~~l~~~~~~~P~i~i~i~~~   36 (198)
T cd08441          13 DWLMPVLDQFRERWPDVELDLSSG   36 (198)
T ss_pred             hhhHHHHHHHHHhCCCeEEEEEeC
Confidence            467788899999999999998764


No 68 
>cd08474 PBP2_CrgA_like_5 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 5. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene a
Probab=54.54  E-value=25  Score=21.05  Aligned_cols=26  Identities=15%  Similarity=0.091  Sum_probs=22.0

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ...++...+.+|++++|++.|.+...
T Consensus        14 ~~~~l~~~l~~~~~~~P~v~i~~~~~   39 (202)
T cd08474          14 ARLLLAPLLARFLARYPDIRLELVVD   39 (202)
T ss_pred             HHHHHHHHHHHHHHHCCCeEEEEEec
Confidence            35677889999999999999999753


No 69 
>cd08483 PBP2_HvrB The C-terminal substrate-binding domain of LysR-type transcriptional regulator HvrB, an activator of S-adenosyl-L-homocysteine hydrolase expression, contains the type 2 periplasmic binding fold. The transcriptional regulator HvrB of the LysR family is required for the light-dependent activation of both ahcY, which encoding the enzyme S-adenosyl-L-homocysteine hydrolase (AdoHcyase) that responsible for the reversible hydrolysis of AdoHcy to adenosine and homocysteine,  and orf5, a gene of unknown.  The topology of this C-terminal domain of HvrB is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transp
Probab=54.39  E-value=22  Score=21.07  Aligned_cols=25  Identities=8%  Similarity=0.198  Sum_probs=21.3

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      ...++...+.+|.+++|++.+.+..
T Consensus        11 ~~~~l~~~l~~~~~~~P~i~l~~~~   35 (190)
T cd08483          11 ASNWLMPRLGSFWAKHPEIELSLLP   35 (190)
T ss_pred             HHhhHHhhHHHHHHHCCCceEEEEe
Confidence            4567788899999999999999974


No 70 
>cd08422 PBP2_CrgA_like The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own 
Probab=54.20  E-value=16  Score=21.48  Aligned_cols=24  Identities=17%  Similarity=0.092  Sum_probs=21.0

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      ..++...+.+|++++|++.|.+..
T Consensus        13 ~~~l~~~l~~~~~~~P~v~i~i~~   36 (197)
T cd08422          13 RLHLAPLLAEFLARYPDVRLELVL   36 (197)
T ss_pred             HHHHHHHHHHHHHhCCceEEEEec
Confidence            466788999999999999999975


No 71 
>cd08459 PBP2_DntR_NahR_LinR_like The C-terminal substrate binding domain of LysR-type transcriptional regulators that are involved in the catabolism of dinitrotoluene, naphthalene and gamma-hexachlorohexane; contains the type 2 periplasmic binding fold. This CD includes LysR-like bacterial transcriptional regulators, DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded.  DntR from Burkholderia species controls genes encoding enzymes for oxidative degradation of the nitro-aromatic compound 2,4-dinitrotoluene. The active form of DntR is homotetrameric, consisting of a dimer of dimers. NahR is a salicylate-dependent transcription activator of the nah and sal operons for naphthalene degradation.  Salicylic acid is an intermediate o
Probab=54.18  E-value=30  Score=20.74  Aligned_cols=26  Identities=19%  Similarity=0.248  Sum_probs=22.0

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEecC
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVRECS   52 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~~   52 (68)
                      ..++..-+.+|++++|++.+.+....
T Consensus        12 ~~~l~~~l~~~~~~~P~v~v~i~~~~   37 (201)
T cd08459          12 MYFLPRLLAALREVAPGVRIETVRLP   37 (201)
T ss_pred             HHHHHHHHHHHHHHCCCCeEEEEecC
Confidence            45778899999999999999997643


No 72 
>cd08411 PBP2_OxyR The C-terminal substrate-binding domain of the LysR-type transcriptional regulator OxyR, a member of the type 2 periplasmic binding fold protein superfamily. OxyR senses hydrogen peroxide and is activated through the formation of an intramolecular disulfide bond. The OxyR activation induces the transcription of genes necessary for the bacterial defense against oxidative stress. The OxyR of LysR-type transcriptional regulator family is composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repre
Probab=52.95  E-value=22  Score=21.21  Aligned_cols=24  Identities=33%  Similarity=0.499  Sum_probs=20.6

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      ..++..-+.+|++++|++.|.+..
T Consensus        13 ~~~l~~~l~~~~~~~P~i~i~i~~   36 (200)
T cd08411          13 PYLLPRLLPALRQAYPKLRLYLRE   36 (200)
T ss_pred             hhhhHHHHHHHHHHCCCcEEEEEe
Confidence            347788899999999999999875


No 73 
>cd08446 PBP2_Chlorocatechol The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the chlorocatechol catabolism, contains the type 2 periplasmic binding fold. This CD includes the substrate binding domain of LysR-type regulators CbnR, ClcR and TfdR, which are involved in the regulation of chlorocatechol breakdown. The chlorocatechol-degradative pathway is often found in bacteria that can use chlorinated aromatic compounds as carbon and energy sources. CbnR is found in the 3-chlorobenzoate degradative bacterium Ralstonia eutropha NH9 and forms a tetramer. CbnR activates the expression of the cbnABCD genes, which are responsible for the degradation of chlorocatechol converted from 3-chlorobenzoate and are transcribed divergently from cbnR.   In soil bacterium Pseudomonas putida, the 3-chlorocatechol-degradative pathway is encoded by clcABD operon, which requires the divergently transcribed clcR for activation. TfdR is involved in the activation of tf
Probab=52.86  E-value=22  Score=21.19  Aligned_cols=25  Identities=12%  Similarity=0.196  Sum_probs=21.2

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      -.++...+.+|++++|++.+.+...
T Consensus        13 ~~~l~~~i~~~~~~~P~v~l~i~~~   37 (198)
T cd08446          13 LDTVPRLLRAFLTARPDVTVSLHNM   37 (198)
T ss_pred             HHHHHHHHHHHHHHCCCeEEEEeeC
Confidence            4577888999999999999998763


No 74 
>cd08419 PBP2_CbbR_RubisCO_like The C-terminal substrate binding of LysR-type transcriptional regulator (CbbR) of RubisCO operon, which is involved in the carbon dioxide fixation, contains the type 2 periplasmic binding fold. CbbR, a LysR-type transcriptional regulator, is required to activate expression of RubisCO, one of two unique enzymes in the Calvin-Benson-Bassham (CBB) cycle pathway. All plants, cyanobacteria, and many autotrophic bacteria use the CBB cycle to fix carbon dioxide. Thus, this cycle plays an essential role in assimilating CO2 into organic carbon on earth. The key CBB cycle enzyme is ribulose 1,5-bisphosphate carboxylase/oxygenase (RubisCO), which catalyzes the actual CO2 fixation reaction. The CO2 concentration affects the expression of RubisCO genes.  It has also shown that NADPH enhances the DNA-binding ability of the CbbR. RubisCO is composed of eight large (CbbL) and eight small subunits (CbbS).  The topology of this substrate-binding domain is most similar to t
Probab=52.33  E-value=23  Score=20.92  Aligned_cols=25  Identities=12%  Similarity=0.183  Sum_probs=21.7

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ..++..-+..|.+++|++.+.+...
T Consensus        11 ~~~l~~~l~~~~~~~P~i~l~i~~~   35 (197)
T cd08419          11 KYFAPRLLGAFCRRHPGVEVSLRVG   35 (197)
T ss_pred             HhHhhHHHHHHHHHCCCceEEEEEC
Confidence            4678899999999999999999763


No 75 
>cd08458 PBP2_NocR The C-terminal substrate-domain of LysR-type transcriptional regulator, NocR, involved in the catabolism of nopaline, contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate-domain of LysR-type transcriptional regulator NocR, which is involved in the catabolism of nopaline. Opines are low molecular weight compounds found in plant crown gall tumors produced by the parasitic bacterium Agrobacterium. There are at least 30 different opines identified so far. Opines are utilized by tumor-colonizing bacteria as a source of carbon, nitrogen, and energy. In Agrobacterium tumefaciens,  NocR regulates expression of the divergently transcribed nocB and nocR genes of the nopaline catabolism (noc) region.   This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, an
Probab=52.24  E-value=20  Score=21.66  Aligned_cols=26  Identities=8%  Similarity=0.220  Sum_probs=22.1

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ...++...+.+|++++|++.|.+...
T Consensus        11 ~~~~l~~~l~~f~~~~P~v~i~~~~~   36 (196)
T cd08458          11 ALSFMSGVIQTFIADRPDVSVYLDTV   36 (196)
T ss_pred             hhhhhHHHHHHHHHHCCCcEEEEecc
Confidence            45778889999999999999998764


No 76 
>cd08442 PBP2_YofA_SoxR_like The C-terminal substrate binding domain of LysR-type transcriptional regulators, YofA and SoxR, contains the type 2 periplasmic binding fold. YofA is a LysR-like transcriptional regulator of cell growth in Bacillus subtillis. YofA controls cell viability and the formation of constrictions during cell division. YofaA positively regulates expression of the cell division gene ftsW, and thus is essential for cell viability during stationary-phase growth of Bacillus substilis. YofA shows significant homology to SoxR from Arthrobacter sp. TE1826. SoxR is a negative regulator for the sarcosine oxidase gene soxA. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine, which is involved in the metabolism of creatine and choline. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides
Probab=52.03  E-value=19  Score=21.26  Aligned_cols=25  Identities=12%  Similarity=0.065  Sum_probs=21.2

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ..++...+.+|.+++|++.+.+...
T Consensus        12 ~~~l~~~l~~~~~~~P~i~l~i~~~   36 (193)
T cd08442          12 AVRLPPLLAAYHARYPKVDLSLSTG   36 (193)
T ss_pred             hhhhHHHHHHHHHHCCCceEEEEeC
Confidence            3567888999999999999999864


No 77 
>cd08449 PBP2_XapR The C-terminal substrate binding domain of LysR-type transcriptional regulator XapR involved in xanthosine catabolism, contains the type 2 periplasmic binding fold. In Escherichia coli, XapR is a positive regulator for the expression of xapA gene, encoding xanthosine phosphorylase, and xapB gene, encoding a polypeptide similar to the nucleotide transport protein NupG. As an operon, the expression of both xapA and xapB is fully dependent on the presence of both XapR and the inducer xanthosine. Expression of the xapR is constitutive but not auto-regulated, unlike many other LysR family proteins. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their 
Probab=51.94  E-value=19  Score=21.39  Aligned_cols=24  Identities=17%  Similarity=0.180  Sum_probs=20.8

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      ..++...+.+|.+++|++.|.+..
T Consensus        12 ~~~l~~~l~~~~~~~P~i~i~~~~   35 (197)
T cd08449          12 WGGLGPALRRFKRQYPNVTVRFHE   35 (197)
T ss_pred             hhhHHHHHHHHHHHCCCeEEEEEE
Confidence            467788999999999999999875


No 78 
>cd08467 PBP2_SyrM The C-terminal substrate binding of LysR-type symbiotic regulator SyrM, which activates expression of nodulation gene NodD3, contains the type 2 periplasmic binding fold. Rhizobium is a nitrogen fixing bacteria present in the roots of leguminous plants, which fixes atmospheric nitrogen to the soil. Most Rhizobium species possess multiple nodulation (nod) genes for the development of nodules. For example, Rhizobium meliloti possesses three copies of nodD genes. NodD1 and NodD2 activate nod operons when  Rhizobium is exposed to inducers synthesized by the host plant, while NodD3 acts independent of plant inducers and requires the symbiotic regulator SyrM for nod gene expression. SyrM activates the expression of the regulatory nodulation gene nodD3. In turn, NodD3 activates expression of syrM. In addition, SyrM is involved in exopolysaccharide synthesis. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are 
Probab=51.89  E-value=22  Score=21.60  Aligned_cols=26  Identities=12%  Similarity=0.139  Sum_probs=22.0

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ...++..-+.+|++++|++.|.+...
T Consensus        11 ~~~~l~~~l~~~~~~~P~i~l~~~~~   36 (200)
T cd08467          11 EVALLPRLAPRLRERAPGLDLRLCPI   36 (200)
T ss_pred             HHHHHHHHHHHHHhhCCCCEEEEecC
Confidence            45677888899999999999999764


No 79 
>PTZ00062 glutaredoxin; Provisional
Probab=51.66  E-value=45  Score=22.57  Aligned_cols=37  Identities=14%  Similarity=0.055  Sum_probs=27.5

Q ss_pred             EEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEecC
Q psy15302         12 LRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRECS   52 (68)
Q Consensus        12 l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~~~   52 (68)
                      |-+...+|.+.++-    |..-++++++++|++.|....+.
T Consensus        21 vl~f~a~w~~~C~~----m~~vl~~l~~~~~~~~F~~V~~d   57 (204)
T PTZ00062         21 VLYVKSSKEPEYEQ----LMDVCNALVEDFPSLEFYVVNLA   57 (204)
T ss_pred             EEEEeCCCCcchHH----HHHHHHHHHHHCCCcEEEEEccc
Confidence            33444788888884    45567789999999999987654


No 80 
>PRK13997 potassium-transporting ATPase subunit C; Provisional
Probab=51.51  E-value=13  Score=25.43  Aligned_cols=44  Identities=20%  Similarity=0.272  Sum_probs=34.1

Q ss_pred             cCCCCCCHHHHHHHHhCHHHHHHhCCC-----CeEE--EEecCCCCCEEEE
Q psy15302         17 CQKGGSSSGVRDFLAQHYVPLKQANPK-----FPIL--VRECSGVTPVVWA   60 (68)
Q Consensus        17 c~~~~sS~G~R~Fl~~~l~~~~~~NP~-----v~i~--v~~~~~~~P~v~a   60 (68)
                      ++-|+++.-+.+-+++....+++.||.     ||..  +...+|-+|.|.-
T Consensus        87 SNl~psnp~l~~~v~~r~~~~~~~~~~~~~~~vP~DlVTaSgSGLDPhISp  137 (193)
T PRK13997         87 NNYAPSNPDLEKRVEKSIEEWKKQNPSVPVTEVPIDLVTNSGSGLDPDISP  137 (193)
T ss_pred             cCCCCCCHHHHHHHHHHHHHHHHhCCCCCCCCCCHHHHhccccCCCCCCCH
Confidence            567889999999999999999999984     4433  3445677887753


No 81 
>cd08447 PBP2_LTTR_aromatics_like_1 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to regulators involved in the catabolism of aromatic compounds, contains type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type regulator similar to CbnR which is involved in the regulation of chlorocatechol breakdown. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Ve
Probab=50.85  E-value=25  Score=20.88  Aligned_cols=26  Identities=23%  Similarity=0.413  Sum_probs=21.9

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ...++...+.+|.+++|++.+.+...
T Consensus        11 ~~~~l~~~l~~~~~~~P~i~v~~~~~   36 (198)
T cd08447          11 AYSFLPRLLAAARAALPDVDLVLREM   36 (198)
T ss_pred             HHHHHHHHHHHHHHHCCCeEEEEEeC
Confidence            35677899999999999999998653


No 82 
>COG1653 UgpB ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism]
Probab=50.35  E-value=53  Score=22.54  Aligned_cols=26  Identities=19%  Similarity=0.281  Sum_probs=23.4

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEecC
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVRECS   52 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~~   52 (68)
                      .++++....+|.++||+|+|.+....
T Consensus        45 ~~~~~~~i~~f~~~~p~ikv~~~~~~   70 (433)
T COG1653          45 ADALEELIKEFEKENPGIKVKVVNVP   70 (433)
T ss_pred             hHHHHHHHHHHHHhCCCeEEEEEecC
Confidence            78899999999999999999987754


No 83 
>cd08485 PBP2_ClcR The C-terminal substrate binding domain of LysR-type transcriptional regulator ClcR involved in the chlorocatechol catabolism, contains type 2 periplasmic binding fold. In soil bacterium Pseudomonas putida, the ortho-pathways of catechol and 3-chlorocatechol are central catabolic pathways that convert aromatic and chloroaromaric compounds to tricarboxylic acid (TCA) cycle intermediates. The 3-chlorocatechol-degradative pathway is encoded by clcABD operon, which requires the divergently transcribed clcR and an intermediate of the pathway, 2-chloromuconate, as an inducer for activation. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding th
Probab=50.33  E-value=18  Score=22.01  Aligned_cols=26  Identities=15%  Similarity=0.115  Sum_probs=21.7

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ...++...+.+|.+++|++.+.+...
T Consensus        12 ~~~~l~~~l~~~~~~~P~i~l~~~~~   37 (198)
T cd08485          12 VLHTLPLLLRQLLSVAPSATVSLTQM   37 (198)
T ss_pred             hhHHHHHHHHHHHHhCCCcEEEEEEC
Confidence            34577888999999999999999763


No 84 
>cd08469 PBP2_PnbR The C-terminal substrate binding domain of LysR-type transcriptional regulator PnbR, which is involved in regulating the pnb genes encoding enzymes for 4-nitrobenzoate catabolism, contains the type 2 periplasmic binding fold. PnbR is the regulator of one or both of the two pnb genes that encoding enzymes for 4-nitrobenzoate catabolism. In Pseudomonas putida strain, pnbA encodes a 4-nitrobenzoate  reductase, which is responsible for catalyzing the direct reduction of 4-nitrobenzoate to 4-hydroxylaminobenzoate, and pnbB encodes a 4-hydroxylaminobenzoate lyase, which catalyzes the conversion of 4-hydroxylaminobenzoate to 3, 4-dihydroxybenzoic acid and ammonium. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft bet
Probab=50.18  E-value=27  Score=21.49  Aligned_cols=26  Identities=15%  Similarity=0.230  Sum_probs=22.1

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEecC
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVRECS   52 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~~   52 (68)
                      ..++...+.+|.+++|++.+.+....
T Consensus        12 ~~~l~~~l~~f~~~~P~v~l~i~~~~   37 (221)
T cd08469          12 AVLLPALVRRLETEAPGIDLRIRPVT   37 (221)
T ss_pred             HHHHHHHHHHHHHHCCCcEEEEeeCC
Confidence            46788899999999999999997643


No 85 
>cd08427 PBP2_LTTR_like_2 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor.  The genes controlled by the LTTRs have diverse functi
Probab=49.97  E-value=24  Score=20.86  Aligned_cols=25  Identities=12%  Similarity=0.325  Sum_probs=21.5

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ..++...+.+|.+.+|++.+.+...
T Consensus        12 ~~~l~~~l~~~~~~~P~i~l~~~~~   36 (195)
T cd08427          12 TGLLPRALARLRRRHPDLEVHIVPG   36 (195)
T ss_pred             HHHhHHHHHHHHHHCCCceEEEEeC
Confidence            5677889999999999999998753


No 86 
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides. AhpF contains an NTD containing two contiguous TRX-fold subdomains similar to Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO). It also contains a catalytic core similar to TRX reductase containing FAD and NADH binding domains with an active site disulfide. The proposed mechanism of action of AhpF is similar to a TRX/TRX reductase system. The flow of reducing equivalents goes from NADH - catalytic core of AhpF - NTD of AhpF - AhpC - peroxide substrates. The catalytic CXXC motif of the NTD of AhpF is contained in its C-terminal TRX subdomain.
Probab=49.85  E-value=49  Score=19.06  Aligned_cols=37  Identities=11%  Similarity=0.055  Sum_probs=29.8

Q ss_pred             EEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         11 ELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        11 ~l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      +|.+.+.++.+..+-++.++    .++++.+|.+.+.+...
T Consensus        15 ~i~~F~~~~C~~C~~~~~~~----~~l~~~~~~i~~~~vd~   51 (89)
T cd03026          15 NFETYVSLSCHNCPDVVQAL----NLMAVLNPNIEHEMIDG   51 (89)
T ss_pred             EEEEEECCCCCCcHHHHHHH----HHHHHHCCCceEEEEEh
Confidence            47777878888888887776    67888999999988764


No 87 
>TIGR00237 xseA exodeoxyribonuclease VII, large subunit. This family consist of exodeoxyribonuclease VII, large subunit XseA which catalyses exonucleolytic cleavage in either the 5'-3' or 3'-5' direction to yield 5'-phosphomononucleotides. Exonuclease VII consists of one large subunit and four small subunits.
Probab=49.80  E-value=28  Score=25.91  Aligned_cols=30  Identities=17%  Similarity=0.368  Sum_probs=24.5

Q ss_pred             CCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEecC
Q psy15302         19 KGGSSSGVRDFLAQHYVPLKQANPKFPILVRECS   52 (68)
Q Consensus        19 ~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~~~   52 (68)
                      +|+++.+++||+.    .+++.+|.++|.+.+..
T Consensus       136 ts~~~aa~~D~~~----~~~~r~p~~~~~~~~~~  165 (432)
T TIGR00237       136 TSQTGAALADILH----ILKRRDPSLKVVIYPTL  165 (432)
T ss_pred             eCCccHHHHHHHH----HHHhhCCCceEEEeccc
Confidence            5778999999975    46778899999988754


No 88 
>PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed
Probab=49.43  E-value=28  Score=25.55  Aligned_cols=30  Identities=17%  Similarity=0.365  Sum_probs=24.1

Q ss_pred             CCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEecC
Q psy15302         19 KGGSSSGVRDFLAQHYVPLKQANPKFPILVRECS   52 (68)
Q Consensus        19 ~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~~~   52 (68)
                      +|+++.|++||+..    +++.+|.++|.+.+..
T Consensus       142 Ts~~gAa~~D~~~~----~~~r~p~~~~~~~~~~  171 (438)
T PRK00286        142 TSPTGAAIRDILTV----LRRRFPLVEVIIYPTL  171 (438)
T ss_pred             eCCccHHHHHHHHH----HHhcCCCCeEEEecCc
Confidence            56778999999874    5577899999998764


No 89 
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif. The gene name for the human protein is TxnDC9. The two characterized members are described as Phd-like proteins, PLP1 of Saccharomyces cerevisiae and PhLP3 of Dictyostelium discoideum. Gene disruption experiments show that both PLP1 and PhLP3 are non-essential proteins. Unlike Phd and most Phd-like proteins, members of this group do not contain the Phd N-terminal helical domain which is implicated in binding to the G protein betagamma subunit.
Probab=49.24  E-value=43  Score=19.94  Aligned_cols=34  Identities=6%  Similarity=-0.139  Sum_probs=24.3

Q ss_pred             EEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEE
Q psy15302         11 ELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILV   48 (68)
Q Consensus        11 ~l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v   48 (68)
                      -|...|.+|.+.++-+...+    .++++++|++.|.-
T Consensus        25 vvV~f~a~~c~~C~~~~p~l----~~la~~~~~i~f~~   58 (113)
T cd02989          25 VVCHFYHPEFFRCKIMDKHL----EILAKKHLETKFIK   58 (113)
T ss_pred             EEEEEECCCCccHHHHHHHH----HHHHHHcCCCEEEE
Confidence            46677889999898776554    45666778877654


No 90 
>cd08417 PBP2_Nitroaromatics_like The C-terminal substrate binding domain of LysR-type transcriptional regulators that involved in the catabolism of nitroaromatic/naphthalene compounds and that of related regulators; contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of dinitrotoluene and similar compounds, such as DntR, NahR, and LinR. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. Also included are related LysR-type regulators clustered together in phylogenetic trees, including NodD, ToxR, LeuO, SyrM, TdcA, and PnbR. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrate
Probab=48.92  E-value=28  Score=20.68  Aligned_cols=26  Identities=15%  Similarity=0.110  Sum_probs=21.9

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ...++...+.+|.+++|++.|.+...
T Consensus        11 ~~~~~~~~i~~~~~~~P~i~l~~~~~   36 (200)
T cd08417          11 EALLLPPLLARLRQEAPGVRLRFVPL   36 (200)
T ss_pred             HHHHHHHHHHHHHhhCCCeEEEeccC
Confidence            35677888999999999999999754


No 91 
>cd08433 PBP2_Nac The C-teminal substrate binding domain of LysR-like nitrogen assimilation control (NAC) protein, contains the type 2 periplasmic binding fold. The NAC is a LysR-type transcription regulator that activates expression of operons such as hut (histidine utilization) and ure (urea utilization), allowing use of non-preferred (poor) nitrogen sources, and represses expression of operons, such as glutamate dehydrogenase (gdh), allowing assimilation of the preferred nitrogen source.  The expression of the nac gene is fully dependent on the nitrogen regulatory system (NTR) and the sigma54-containing RNA polymerase (sigma54-RNAP). In response to nitrogen starvation, NTR system activates the expression of nac, and NAC activates the expression of hut, ure, and put (proline utilization). NAC is not involved in the transcription of Sigma70-RNAP operons such as glnA, which directly respond by the NTR system, but activates the transcription of sigma70-RNAP dependent operons such as hut.
Probab=48.86  E-value=19  Score=21.48  Aligned_cols=25  Identities=8%  Similarity=0.108  Sum_probs=20.7

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ..++...+..|.+++|++.|.+...
T Consensus        12 ~~~l~~~l~~~~~~~P~i~i~~~~~   36 (198)
T cd08433          12 SVLAVPLLRAVRRRYPGIRLRIVEG   36 (198)
T ss_pred             hhcchHHHHHHHHHCCCcEEEEEec
Confidence            4566788899999999999999763


No 92 
>cd08475 PBP2_CrgA_like_6 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 6. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene a
Probab=48.43  E-value=27  Score=20.70  Aligned_cols=25  Identities=16%  Similarity=0.184  Sum_probs=21.3

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      ...++...+..|++++|+++|.+..
T Consensus        12 ~~~~l~~~l~~~~~~~P~v~i~i~~   36 (199)
T cd08475          12 GRLCVAPLLLELARRHPELELELSF   36 (199)
T ss_pred             HHhhHHHHHHHHHHHCCCeEEEEEe
Confidence            3567788899999999999999964


No 93 
>cd08462 PBP2_NodD The C-terminal substsrate binding domain of NodD family of LysR-type transcriptional regulators that regulates the expression of nodulation (nod) genes; contains the type 2 periplasmic binding fold. The nodulation (nod) genes in soil bacteria play important roles in the development of nodules. nod genes are involved in synthesis of Nod factors that are required for bacterial entry into root hairs. Thirteen nod genes have been identified and are classified into five transcription units: nodD, nodABCIJ, nodFEL, nodMNT, and nodO. NodD is negatively auto-regulates its own expression of nodD gene, while other nod genes are inducible and positively regulated by NodD in the presence of flavonoids released by plant roots. This substrate-binding domain has significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. T
Probab=47.96  E-value=31  Score=20.81  Aligned_cols=26  Identities=8%  Similarity=0.042  Sum_probs=22.2

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ...++..-+.+|++.+|++.|.+...
T Consensus        11 ~~~~l~~~i~~~~~~~P~i~l~i~~~   36 (200)
T cd08462          11 ITVLLPPVIERVAREAPGVRFELLPP   36 (200)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEecC
Confidence            45778889999999999999999763


No 94 
>cd08430 PBP2_IlvY The C-terminal substrate binding of LysR-type transcriptional regulator IlvY, which activates the expression of ilvC gene that encoding acetohydroxy acid isomeroreductase for the biosynthesis of branched amino acids; contains the type 2 periplasmic binding fold. In Escherichia coli, IlvY is required for the regulation of ilvC gene expression that encodes acetohydroxy acid isomeroreductase (AHIR), a key enzyme in the biosynthesis of branched-chain amino acids (isoleucine, valine, and leucine). The ilvGMEDA operon genes encode remaining enzyme activities required for the biosynthesis of these amino acids. Activation of ilvC transcription by IlvY requires the additional binding of a co-inducer molecule (either alpha-acetolactate or alpha-acetohydoxybutyrate, the substrates for AHIR) to a preformed complex of IlvY protein-DNA.  Like many other LysR-family members, IlvY negatively auto-regulates the transcription of its own divergently transcribed ilvY gene in an inducer-i
Probab=47.69  E-value=17  Score=21.61  Aligned_cols=25  Identities=16%  Similarity=0.284  Sum_probs=21.1

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ..++...+.+|.+.+|++.|.+...
T Consensus        12 ~~~l~~~l~~~~~~~P~v~l~~~~~   36 (199)
T cd08430          12 YSFLPPILERFRAQHPQVEIKLHTG   36 (199)
T ss_pred             eeeccHHHHHHHHHCCCceEEEEeC
Confidence            3567788999999999999999764


No 95 
>PF06244 DUF1014:  Protein of unknown function (DUF1014);  InterPro: IPR010422 This family consists of several hypothetical eukaryotic proteins of unknown function.
Probab=47.61  E-value=17  Score=23.12  Aligned_cols=20  Identities=25%  Similarity=0.428  Sum_probs=16.9

Q ss_pred             HHHHHHhCHHHHHHhCCCCe
Q psy15302         26 VRDFLAQHYVPLKQANPKFP   45 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~   45 (68)
                      -..|-+..||.+++.||.+-
T Consensus        80 y~afeE~~Lp~lK~E~PgLr   99 (122)
T PF06244_consen   80 YKAFEERRLPELKEENPGLR   99 (122)
T ss_pred             HHHHHHHHhHHHHhhCCCch
Confidence            35678899999999999874


No 96 
>cd08468 PBP2_Pa0477 The C-terminal substrate biniding domain of an uncharacterized LysR-like transcriptional regulator Pa0477 related to DntR, contains the type 2 periplasmic binding fold. LysR-type transcriptional regulator Pa0477 is related to DntR, which controls genes encoding enzymes for oxidative degradation of the nitro-aromatic compound 2,4-dinitrotoluene. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded.  The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their spec
Probab=47.49  E-value=34  Score=20.67  Aligned_cols=25  Identities=8%  Similarity=0.163  Sum_probs=21.5

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ..++...+.+|++.+|++.|.+...
T Consensus        12 ~~~l~~~l~~~~~~~P~v~i~~~~~   36 (202)
T cd08468          12 LAVMPRLMARLEELAPSVRLNLVHA   36 (202)
T ss_pred             HHHhHHHHHHHHhhCCCCEEEEEEC
Confidence            5677889999999999999999864


No 97 
>PLN02757 sirohydrochlorine ferrochelatase
Probab=47.38  E-value=14  Score=23.81  Aligned_cols=32  Identities=13%  Similarity=0.190  Sum_probs=22.9

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEecCCCCCEE
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVRECSGVTPVV   58 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~~~~~P~v   58 (68)
                      ++=|...+.++++++|+++|.+-+.-|.||.+
T Consensus        89 ~~DIp~~v~~~~~~~p~~~i~~~~pLG~~p~l  120 (154)
T PLN02757         89 QEDIPALTAEAAKEHPGVKYLVTAPIGLHELM  120 (154)
T ss_pred             HhHHHHHHHHHHHHCCCcEEEECCCCCCCHHH
Confidence            44455566677888888888887777777754


No 98 
>TIGR00681 kdpC K+-transporting ATPase, C subunit. This chain has a single predicted transmembrane region near the amino end. It is part of a K+-transport ATPase that contains two other membrane-bound subunits, KdpA and KdpB, and a small subunit KdpF. KdpA is the K+-translocating subunit, KdpB the ATP-hydrolyzing subunit. During assembly of the complex, KdpA and KdpC bind to each other. This interaction is thought to stabilize the complex [PubMed:9858692]. Data indicates that KdpC might connect the KdpA, the K+-transporting subunit, to KdpB, the ATP-hydrolyzing (energy providing) subunit [PubMed:9858692].
Probab=47.25  E-value=11  Score=25.67  Aligned_cols=44  Identities=16%  Similarity=0.194  Sum_probs=33.8

Q ss_pred             cCCCCCCHHHHHHHHhCHHHHHHhCCC----CeEEE--EecCCCCCEEEE
Q psy15302         17 CQKGGSSSGVRDFLAQHYVPLKQANPK----FPILV--RECSGVTPVVWA   60 (68)
Q Consensus        17 c~~~~sS~G~R~Fl~~~l~~~~~~NP~----v~i~v--~~~~~~~P~v~a   60 (68)
                      ++-++|+.-+.+-+++....|++.||.    ||...  ...+|-+|.|.-
T Consensus        84 SNl~psnp~l~~~v~~r~~~~~~~~~~~~~~vP~DlvTaSgSGLDPhISp  133 (187)
T TIGR00681        84 SNLAPSNPDLLSRIAARVEAQRLENLDAAVQVPVDLVTSSGSGLDPHISP  133 (187)
T ss_pred             cCCCCCCHHHHHHHHHHHHHHHHhCCCCCCCCCHHHHhcccccCCCCCCH
Confidence            567889999999999999999999984    55443  445577887653


No 99 
>cd08484 PBP2_LTTR_beta_lactamase The C-terminal substrate-domain of LysR-type transcriptional regulators for beta-lactamase genes, contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LysR-type transcriptional regulators, BlaA and AmpR, that are involved in control of the expression of beta-lactamase genes.  Beta-lactamases are responsible for bacterial resistance to beta-lactam antibiotics such as penicillins. BlaA (a constitutive class A penicillinase) belongs to the LysR family of transcriptional regulators, while BlaB (an inducible class C cephalosporinase or AmpC) can be referred to as a penicillin-binding protein, but it does not act as a beta-lactamase. AmpR regulates the expression of beta-lactamases in many enterobacterial strains and many other gram-negative bacilli. In contrast to BlaA, AmpR acts an activator only in the presence of the beta-lactam inducer. In the absence of the inducer, AmpR acts as a repressor. The topol
Probab=46.85  E-value=36  Score=20.22  Aligned_cols=26  Identities=12%  Similarity=0.218  Sum_probs=21.9

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ...++...+.+|.+++|++.+.+...
T Consensus        11 ~~~~l~~~l~~f~~~~P~i~l~~~~~   36 (189)
T cd08484          11 AVGWLLPRLAEFRQLHPFIDLRLSTN   36 (189)
T ss_pred             HHHHHHhhhHHHHHHCCCceEEEecc
Confidence            35677888999999999999999754


No 100
>cd08463 PBP2_DntR_like_4 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold. This CD includes an uncharacterized LysR-type transcriptional regulator similar to DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded.  This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytra
Probab=46.58  E-value=32  Score=21.15  Aligned_cols=24  Identities=13%  Similarity=0.238  Sum_probs=21.1

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      -.++...+.+|++.+|++.+.+.+
T Consensus        12 ~~~~~~~l~~~~~~~P~~~v~~~~   35 (203)
T cd08463          12 ALFLPELVARFRREAPGARLEIHP   35 (203)
T ss_pred             HHHhHHHHHHHHHHCCCCEEEEEe
Confidence            457788999999999999999985


No 101
>cd08451 PBP2_BudR The C-terminal substrate binding domain of LysR-type transcrptional regulator BudR, which is responsible for activation of the expression of the butanediol operon genes; contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of BudR regulator, which is responsible for induction of the butanediol formation pathway under fermentative growth conditions. Three enzymes are involved in the production of 1 mol of 2,3 butanediol from the condensation of 2 mol of pyruvate with acetolactate and acetoin as intermediates: acetolactate synthetase, acetolactate decarboxylase, and acetoin reductase. In Klebsiella terrigena, BudR regulates the expression of the budABC operon genes, encoding these three enzymes of the butanediol pathway. In many bacterial species, the use of this pathway can prevent intracellular acidification by diverting metabolism from acid production to the formation of neutral compounds (acetoin and butanediol). This substra
Probab=46.27  E-value=21  Score=21.15  Aligned_cols=23  Identities=13%  Similarity=0.299  Sum_probs=19.9

Q ss_pred             HHHhCHHHHHHhCCCCeEEEEec
Q psy15302         29 FLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        29 Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ++...+.+|++.+|++.+.+...
T Consensus        15 ~l~~~l~~~~~~~P~i~l~i~~~   37 (199)
T cd08451          15 LVPGLIRRFREAYPDVELTLEEA   37 (199)
T ss_pred             ccHHHHHHHHHHCCCcEEEEecC
Confidence            66788999999999999999754


No 102
>smart00329 BPI2 BPI/LBP/CETP C-terminal domain. Bactericidal permeability-increasing protein (BPI) / Lipopolysaccharide-binding protein (LBP) / Cholesteryl ester transfer protein (CETP) C-terminal domain
Probab=46.16  E-value=55  Score=21.55  Aligned_cols=33  Identities=9%  Similarity=0.026  Sum_probs=27.7

Q ss_pred             HHHhCHHHHHHhCCCCeEEEEecCCCCCEEEEE
Q psy15302         29 FLAQHYVPLKQANPKFPILVRECSGVTPVVWAS   61 (68)
Q Consensus        29 Fl~~~l~~~~~~NP~v~i~v~~~~~~~P~v~a~   61 (68)
                      ++..-+|++++++|+-++.+.-.....|.+...
T Consensus        48 ~~~~~iP~l~~~yPn~~~~L~i~~~~~P~v~i~   80 (202)
T smart00329       48 CFGTLVPEVAEQYPDSTLQLEISVLSPPRVTLQ   80 (202)
T ss_pred             HHHHHHHHHHHHCCCCcEEEEEEeCCCCEEEEe
Confidence            778889999999999888887777779988764


No 103
>cd08413 PBP2_CysB_like The C-terminal substrate domain of LysR-type transcriptional regulators CysB-like contains type 2 periplasmic binding fold. CysB is a transcriptional activator of genes involved in sulfate and thiosulfate transport, sulfate reduction, and cysteine synthesis. In Escherichia coli, the regulation of transcription in response to sulfur source is attributed to two transcriptional regulators, CysB and Cbl. CysB, in association with Cbl, downregulates the expression of ssuEADCB operon which is required for the utilization of sulfur from aliphatic sulfonates, in the presence of cysteine. Also, Cbl and CysB together directly function as transcriptional activators of tauABCD genes, which are required for utilization of taurine as sulfur source for growth. Like many other members of the LTTR family, CysB is composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-bi
Probab=45.59  E-value=22  Score=21.54  Aligned_cols=26  Identities=15%  Similarity=0.273  Sum_probs=21.3

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ...++...+.+|.+++|++++.+...
T Consensus        11 ~~~~l~~~l~~~~~~~P~i~v~~~~~   36 (198)
T cd08413          11 ARYVLPPVIAAFRKRYPKVKLSLHQG   36 (198)
T ss_pred             hhhhccHHHHHHHHhCCceEEEEEeC
Confidence            35577888899999999999998764


No 104
>TIGR02200 GlrX_actino Glutaredoxin-like protein. This family of glutaredoxin-like proteins is limited to the Actinobacteria and contains the conserved CxxC motif.
Probab=45.36  E-value=24  Score=18.60  Aligned_cols=22  Identities=9%  Similarity=0.013  Sum_probs=18.8

Q ss_pred             EEEEEecCCCCCCHHHHHHHHh
Q psy15302         11 ELRIHLCQKGGSSSGVRDFLAQ   32 (68)
Q Consensus        11 ~l~~~yc~~~~sS~G~R~Fl~~   32 (68)
                      +|++.+-.|++.++-++.|+..
T Consensus         1 ~v~ly~~~~C~~C~~~~~~L~~   22 (77)
T TIGR02200         1 TITVYGTTWCGYCAQLMRTLDK   22 (77)
T ss_pred             CEEEEECCCChhHHHHHHHHHH
Confidence            3678888999999999999965


No 105
>cd02974 AhpF_NTD_N Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) family, N-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which in turn catalyzes the reduction of hydrogen peroxide and organic hydroperoxides. AhpF contains an NTD forming two contiguous TRX-fold subdomain similar to Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO). It also contains a catalytic core similar to TRX reductase containing FAD and NADH binding domains with an active site disulfide. The proposed mechanism of action of AhpF is similar to a TRX/TRX reductase system. The flow of reducing equivalents goes from NADH - catalytic core of AhpF - NTD of AhpF - AhpC - peroxide substrates. The N-terminal TRX-fold subdomain of AhpF NTD is redox inactive, but is proposed to contain an important residue that aids in the catalytic function of the redox-active CXXC motif contained in the C-terminal TRX-
Probab=45.15  E-value=65  Score=19.07  Aligned_cols=40  Identities=10%  Similarity=0.120  Sum_probs=29.2

Q ss_pred             CCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEecCCCCCEEEEE
Q psy15302         18 QKGGSSSGVRDFLAQHYVPLKQANPKFPILVRECSGVTPVVWAS   61 (68)
Q Consensus        18 ~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~~~~~~P~v~a~   61 (68)
                      +.+..|.=+++|++    +++..+|.+.+.+......-|.+...
T Consensus        28 ~~~~~~~e~~~ll~----e~a~lSdkI~~~~~~~~~~~P~~~i~   67 (94)
T cd02974          28 DDSEKSAELLELLE----EIASLSDKITLEEDNDDERKPSFSIN   67 (94)
T ss_pred             CCCcchHHHHHHHH----HHHHhCCceEEEEecCCCCCCEEEEe
Confidence            44477888888776    78999999999876644456777653


No 106
>PF09457 RBD-FIP:  FIP domain ;  InterPro: IPR019018 The Rab11 GTPase regulates recycling of internalized plasma membrane receptors and is essential for completion of cytokinesis. A family of Rab11 interacting proteins (FIPs) that conserve a C-terminal Rab-binding domain (RBD) selectively recognise the active form of Rab11. FIPs are diverse in sequence length and composition toward their N-termini, presumably a feature that underpins their specific roles in Rab11-mediated vesicle trafficking. They have been divided into three subfamilies (classe I, II, and III)on the basis of domain architecture. Class I FIPs comprises a subfamily of three proteins (Rip11/pp75/FIP5, Rab-coupling protein (RCP), and FIP2) that possess an N- terminal C2 domain, localize to recycling endosomes, and regulate plasma membrane recycling. The class II subfamily consists of two proteins (FIP3/eferin/arfophilin and FIP4) with tandem EF hands and a proline-rich region. Class II FIPs localize to recycling endosomes, the trans-Golgi network, and have been implicated in the regulation of membrane trafficking during cytokinesis. The class III subfamily consists of a single protein, FIP1, which does not contain obvious homology domains or motifs other than the FIP-RBD [, , , ]. The FIP-RBD domain is also found in Rab6-interacting protein Erc1/Elks. Erc1 is the regulatory subunit of the IKK complex and probably recruits IkappaBalpha/NFKBIA to the complex []. It may be involved in the organisation of the cytomatrix at the nerve terminals active zone (CAZ) which regulates neurotransmitter release. It may also be involved in vesicle trafficking at the CAZ, as well as in Rab-6 regulated endosomes to Golgi transport []. The FIB-RBD domain consists of an N-terminal long alpha-helix, followed by a 90 degrees bend at a conserved proline residue, a 3(10) helix and a C-terminal short beta-strand, adopting an "L" shape. The long alpha-helix forms a parallel coiled-coil homodimer that symmetrically interacts with two Rab11 molecules on both sides, forming a quaternary Rab11-(FIP)2-Rab11 complex. The Rab11-interacting region of FIP-RBD is confined to the C-terminal 24 amino acids, which cover the C-terminal half of the long alpha-helix and the short beta-strand [, , , ].  This entry represents the FIP-RBD domain.; PDB: 2HV8_E 2D7C_D 2K6S_B 2GZD_D 2GZH_B.
Probab=44.53  E-value=9  Score=20.58  Aligned_cols=20  Identities=15%  Similarity=0.436  Sum_probs=16.8

Q ss_pred             HHHHHHHhCHHHHHHhCCCC
Q psy15302         25 GVRDFLAQHYVPLKQANPKF   44 (68)
Q Consensus        25 G~R~Fl~~~l~~~~~~NP~v   44 (68)
                      -+++||.+-|..+...+|++
T Consensus        25 eLe~YiD~LL~rVmE~~P~I   44 (48)
T PF09457_consen   25 ELEDYIDNLLVRVMEQTPSI   44 (48)
T ss_dssp             HHHHHHHHHHHHHHCC-GGG
T ss_pred             HHHHHHHHHHHHHHHhCcch
Confidence            47899999999999999975


No 107
>PRK13999 potassium-transporting ATPase subunit C; Provisional
Probab=44.05  E-value=16  Score=25.15  Aligned_cols=44  Identities=25%  Similarity=0.382  Sum_probs=34.0

Q ss_pred             cCCCCCCHHHHHHHHhCHHHHHHhCC--CCeEEE--EecCCCCCEEEE
Q psy15302         17 CQKGGSSSGVRDFLAQHYVPLKQANP--KFPILV--RECSGVTPVVWA   60 (68)
Q Consensus        17 c~~~~sS~G~R~Fl~~~l~~~~~~NP--~v~i~v--~~~~~~~P~v~a   60 (68)
                      ++-++++.-+.+-+++....|+++||  .||...  ...+|-+|.|.-
T Consensus        97 SNlgpsnp~L~~~v~~r~~~~~~~~~~~~vP~DlvTaSgSGLDPhISp  144 (201)
T PRK13999         97 SNLGPTSKALADRVKEDVDALKAENPGAPVPVDLVTTSGSGLDPDISP  144 (201)
T ss_pred             cCCCCCCHHHHHHHHHHHHHHHHhCCCCCCCHHHHhcccccCCCCCCH
Confidence            45678899999999999999999998  565443  445677887753


No 108
>PRK14002 potassium-transporting ATPase subunit C; Provisional
Probab=43.95  E-value=20  Score=24.37  Aligned_cols=44  Identities=18%  Similarity=0.231  Sum_probs=33.5

Q ss_pred             cCCCCCCHHHHHHHHhCHHHHHHhCCC-----CeE--EEEecCCCCCEEEE
Q psy15302         17 CQKGGSSSGVRDFLAQHYVPLKQANPK-----FPI--LVRECSGVTPVVWA   60 (68)
Q Consensus        17 c~~~~sS~G~R~Fl~~~l~~~~~~NP~-----v~i--~v~~~~~~~P~v~a   60 (68)
                      ++-++++.-+.+=+++....|+++||+     ||.  ++...+|-+|.|.-
T Consensus        81 SNl~psnp~L~~~v~~r~~~~~~~~~~~~~~~vP~DlvTaSgSGLDPhISp  131 (186)
T PRK14002         81 SNKGPSNPEYLAEVQARIDTFLVHHPYLSRKDIPAEMVTASGSGLDPNISP  131 (186)
T ss_pred             cCCCCCCHHHHHHHHHHHHHHHHhCCCCCCCCCCHHHHhccccCCCCCCCH
Confidence            467888999999999999999999986     333  33445677887653


No 109
>TIGR02036 dsdC D-serine deaminase transcriptional activator. This family, part of the LysR family of transcriptional regulators, activates transcription of the gene for D-serine deaminase, dsdA. Trusted members of this family so far are found adjacent to dsdA and only in Gammaproteobacteria, including E. coli, Vibrio cholerae, and Colwellia psychrerythraea.
Probab=43.44  E-value=42  Score=22.79  Aligned_cols=27  Identities=11%  Similarity=0.175  Sum_probs=23.0

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEecC
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVRECS   52 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~~   52 (68)
                      ...++...+..|.+++|++.+.+....
T Consensus       107 ~~~~l~~~l~~f~~~~P~i~l~l~~~~  133 (302)
T TIGR02036       107 AQCWLVPRIGDFTRRYPSISLTVLTGN  133 (302)
T ss_pred             HHHHHHHHHHHHHHHCCCceEEEEeCC
Confidence            356788999999999999999997654


No 110
>PLN02958 diacylglycerol kinase/D-erythro-sphingosine kinase
Probab=43.26  E-value=51  Score=24.95  Aligned_cols=44  Identities=20%  Similarity=0.202  Sum_probs=34.7

Q ss_pred             eEEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEecCC
Q psy15302         10 KELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRECSG   53 (68)
Q Consensus        10 k~l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~~~~   53 (68)
                      |++.|-+.+.+|..++.+.|...--+.|++..-++.+.+.+..+
T Consensus       112 kr~lvIvNP~SGkg~a~k~~~~~v~~~L~~~gi~~~v~~T~~~g  155 (481)
T PLN02958        112 KRLLVFVNPFGGKKSASKIFFDVVKPLLEDADIQLTIQETKYQL  155 (481)
T ss_pred             cEEEEEEcCCCCCcchhHHHHHHHHHHHHHcCCeEEEEeccCcc
Confidence            67889999999998888887777777888888777776655543


No 111
>PF13516 LRR_6:  Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A ....
Probab=42.26  E-value=6.9  Score=17.11  Aligned_cols=21  Identities=19%  Similarity=0.259  Sum_probs=13.3

Q ss_pred             CcceEEEEEecCCCCCCHHHHHH
Q psy15302          7 SKLKELRIHLCQKGGSSSGVRDF   29 (68)
Q Consensus         7 ~qlk~l~~~yc~~~~sS~G~R~F   29 (68)
                      .+|+.|.|++|+-+  ..|++.+
T Consensus         2 ~~L~~L~l~~n~i~--~~g~~~l   22 (24)
T PF13516_consen    2 PNLETLDLSNNQIT--DEGASAL   22 (24)
T ss_dssp             TT-SEEE-TSSBEH--HHHHHHH
T ss_pred             CCCCEEEccCCcCC--HHHHHHh
Confidence            46889999998853  6666543


No 112
>PRK13994 potassium-transporting ATPase subunit C; Provisional
Probab=41.28  E-value=22  Score=24.80  Aligned_cols=44  Identities=14%  Similarity=0.321  Sum_probs=32.9

Q ss_pred             cCCCCCCHHHHHHHHhCHHHHHHhC--CC-------CeE--EEEecCCCCCEEEE
Q psy15302         17 CQKGGSSSGVRDFLAQHYVPLKQAN--PK-------FPI--LVRECSGVTPVVWA   60 (68)
Q Consensus        17 c~~~~sS~G~R~Fl~~~l~~~~~~N--P~-------v~i--~v~~~~~~~P~v~a   60 (68)
                      ++.++++.-+.+-+++....|++.|  |.       ||.  ++...+|-+|.|.-
T Consensus       111 SNlgpsnp~L~~~v~~r~~~~~~~~~~p~~~~~~~~VP~DlVTaSGSGLDPhISp  165 (222)
T PRK13994        111 TNRSADNEELIQWVKDAKAAVVEDNSVPGYEVKPSDVPADAVTSSGSGLDPDISP  165 (222)
T ss_pred             cCCCCCCHHHHHHHHHHHHHHHHhCCCCccccCCCCCCHHHHhcccccCCCCCCH
Confidence            5678899999999999999999999  45       333  23445677777653


No 113
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily.
Probab=40.57  E-value=22  Score=15.85  Aligned_cols=23  Identities=22%  Similarity=0.491  Sum_probs=17.4

Q ss_pred             CcceEEEEEecCCCCCCHHHHHHH
Q psy15302          7 SKLKELRIHLCQKGGSSSGVRDFL   30 (68)
Q Consensus         7 ~qlk~l~~~yc~~~~sS~G~R~Fl   30 (68)
                      ++|++|.+.+|..= +..|++...
T Consensus         2 ~~L~~L~l~~C~~i-tD~gl~~l~   24 (26)
T smart00367        2 PNLRELDLSGCTNI-TDEGLQALA   24 (26)
T ss_pred             CCCCEeCCCCCCCc-CHHHHHHHh
Confidence            57999999999843 477777653


No 114
>PRK10470 ribosome hibernation promoting factor HPF; Provisional
Probab=40.57  E-value=72  Score=18.36  Aligned_cols=32  Identities=19%  Similarity=0.325  Sum_probs=23.7

Q ss_pred             EEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCC
Q psy15302         12 LRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKF   44 (68)
Q Consensus        12 l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v   44 (68)
                      +.+.+ .+-.-|.++|+|+++.+..+.+-.+++
T Consensus         3 i~i~~-r~i~~t~al~~~v~~kl~kL~r~~~~i   34 (95)
T PRK10470          3 LNITG-HNVEITEALREFVTAKFAKLEQYFDRI   34 (95)
T ss_pred             EEEEE-EeeccCHHHHHHHHHHHHHHHHhcCCC
Confidence            33444 344568999999999888888888754


No 115
>cd08457 PBP2_OccR The C-terminal substrate-domain of LysR-type transcriptional regulator, OccR, involved in the catabolism of octopine, contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate-domain of LysR-type transcriptional regulator OccR, which is involved in the catabolism of octopine. Opines are low molecular weight compounds found in plant crown gall tumors produced by the parasitic bacterium Agrobacterium. There are at least 30 different opines identified so far. Opines are utilized by tumor-colonizing bacteria as a source of carbon, nitrogen, and energy. In Agrobacterium tumefaciens,  OccR protein activates the occQ operon of the Ti plasmid in response to octopine. This operon encodes proteins required for the uptake and catabolism of octopine, an arginine derivative. The occ operon also encodes the TraR protein, which is a quorum-sensing transcriptional regulator of the Ti plasmid tra regulon.  This substrate-binding domain shows significant h
Probab=40.56  E-value=22  Score=21.31  Aligned_cols=26  Identities=12%  Similarity=0.282  Sum_probs=21.2

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ...++...+.+|.+.+|++.|.+...
T Consensus        11 ~~~~l~~~l~~~~~~~P~i~l~~~~~   36 (196)
T cd08457          11 ANGFLPRFLAAFLRLRPNLHLSLMGL   36 (196)
T ss_pred             hccccHHHHHHHHHHCCCeEEEEEec
Confidence            34567788899999999999998764


No 116
>PRK00315 potassium-transporting ATPase subunit C; Reviewed
Probab=40.51  E-value=15  Score=25.04  Aligned_cols=44  Identities=23%  Similarity=0.378  Sum_probs=33.7

Q ss_pred             cCCCCCCHHHHHHHHhCHHHHHHhCC----CCeEEE--EecCCCCCEEEE
Q psy15302         17 CQKGGSSSGVRDFLAQHYVPLKQANP----KFPILV--RECSGVTPVVWA   60 (68)
Q Consensus        17 c~~~~sS~G~R~Fl~~~l~~~~~~NP----~v~i~v--~~~~~~~P~v~a   60 (68)
                      ++-++++.-+++-+++....|+++||    .||...  ...+|-+|.|.-
T Consensus        86 SNl~psnp~l~~~v~~r~~~~~~~~~~~~~~vP~DlvTaSgSGLDPhIS~  135 (193)
T PRK00315         86 SNLAPSNPALDDAIKARVAALRAANPGASSPVPVDLVTASGSGLDPHISP  135 (193)
T ss_pred             cCCCCCCHHHHHHHHHHHHHHHHhCCCCCCCCCHHHHhccccCCCCCCCH
Confidence            46678899999999999999999998    455443  445677887653


No 117
>cd00026 BPI2 BPI/LBP/CETP C-terminal domain; Bactericidal permeability-increasing protein (BPI) / Lipopolysaccharide-binding protein (LBP) / Cholesteryl ester transfer protein (CETP) C-terminal domain; binds to and neutralizes lipopolysaccharides from the outer membrane of Gram-negative bacteria.; Apolar pockets on the concave surface bind a molecule of phosphatidylcholine, primarily by interacting with their acyl chains; this suggests that the pockets may also bind the acyl chains of lipopolysaccharide.
Probab=40.21  E-value=82  Score=20.74  Aligned_cols=32  Identities=16%  Similarity=0.222  Sum_probs=25.1

Q ss_pred             HHhCHHHHHHhCCCCeEEEEecCCCCCEEEEE
Q psy15302         30 LAQHYVPLKQANPKFPILVRECSGVTPVVWAS   61 (68)
Q Consensus        30 l~~~l~~~~~~NP~v~i~v~~~~~~~P~v~a~   61 (68)
                      +..-+|++++++|+-++.+.-.....|.+...
T Consensus        44 ~~~~iP~l~~~yPn~~~~L~i~~~~~P~v~i~   75 (200)
T cd00026          44 FGIFIPELAKKYPNMPQQLKISVSSPPHLVLS   75 (200)
T ss_pred             HHHHHHHHHHHCCCCcEEEEEEeCCCCEEEEe
Confidence            34478999999999888887776678988754


No 118
>TIGR00741 yfiA ribosomal subunit interface protein. The member of this family from E. coli is now recognized as a protein at the interace between ribosomal large and small subunits, with about 1/3 as many copies per cell as the number of ribosomes.
Probab=40.02  E-value=71  Score=18.08  Aligned_cols=31  Identities=10%  Similarity=0.224  Sum_probs=24.4

Q ss_pred             EEEEecCCCCCCHHHHHHHHhCHHHHHHhCCC
Q psy15302         12 LRIHLCQKGGSSSGVRDFLAQHYVPLKQANPK   43 (68)
Q Consensus        12 l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~   43 (68)
                      |.|.+ .+-.-+.++++|+++.+..+.+-.|+
T Consensus         3 i~i~~-~~~~~t~~l~~~i~~k~~kl~k~~~~   33 (95)
T TIGR00741         3 INITG-KNVEITEALREYVEEKLARLERYFTH   33 (95)
T ss_pred             EEEEE-eccccCHHHHHHHHHHHHHHHHhcCC
Confidence            44555 55556899999999999998888876


No 119
>PF02482 Ribosomal_S30AE:  Sigma 54 modulation protein / S30EA ribosomal protein;  InterPro: IPR003489 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This family contains the sigma-54 modulation protein family and the S30Ae family of ribosomal proteins which includes the light-repressed protein (lrtA) [].; GO: 0005488 binding, 0044238 primary metabolic process; PDB: 1L4S_A 1VOX_a 1VOV_a 3V2E_Y 3V2C_Y 1N3G_A 1VOS_a 1VOZ_a 1VOQ_a 1IMU_A ....
Probab=38.76  E-value=72  Score=17.99  Aligned_cols=32  Identities=9%  Similarity=0.203  Sum_probs=22.5

Q ss_pred             EEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCC
Q psy15302         12 LRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKF   44 (68)
Q Consensus        12 l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v   44 (68)
                      |.|.+ .+-.-|..+++|+++.+..|.+-.|++
T Consensus         2 i~i~~-~~~~~t~~l~~~i~~kl~kl~~~~~~i   33 (97)
T PF02482_consen    2 IQITG-RNFELTDALREYIEEKLEKLERFFDDI   33 (97)
T ss_dssp             EEEEE-CSS---HHHHHHHHHHHHHHHTTSSC-
T ss_pred             EEEEE-EcccCCHHHHHHHHHHHHHHHhhcCCC
Confidence            44555 555679999999999999999888754


No 120
>PF02638 DUF187:  Glycosyl hydrolase like GH101;  InterPro: IPR003790 This entry describes proteins of unknown function.
Probab=38.67  E-value=49  Score=23.49  Aligned_cols=30  Identities=13%  Similarity=0.329  Sum_probs=25.5

Q ss_pred             CHHHHHHHHhCHHHHHHhCCCCeEEEEecC
Q psy15302         23 SSGVRDFLAQHYVPLKQANPKFPILVRECS   52 (68)
Q Consensus        23 S~G~R~Fl~~~l~~~~~~NP~v~i~v~~~~   52 (68)
                      ..-+-+||++-+..+|+.+|+|.|-+.+..
T Consensus       202 r~~I~~~V~~i~~~ik~~kP~v~~sisp~g  231 (311)
T PF02638_consen  202 RDNINNFVKRIYDAIKAIKPWVKFSISPFG  231 (311)
T ss_pred             HHHHHHHHHHHHHHHHHhCCCCeEEEEeec
Confidence            345778999999999999999999997753


No 121
>COG1570 XseA Exonuclease VII, large subunit [DNA replication, recombination, and repair]
Probab=38.45  E-value=52  Score=25.17  Aligned_cols=30  Identities=20%  Similarity=0.351  Sum_probs=25.1

Q ss_pred             CCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEecC
Q psy15302         19 KGGSSSGVRDFLAQHYVPLKQANPKFPILVRECS   52 (68)
Q Consensus        19 ~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~~~   52 (68)
                      ||+++..+||.+.    .+++..|.++|+|.+..
T Consensus       142 TS~tgAairDIl~----~~~rR~P~~~viv~pt~  171 (440)
T COG1570         142 TSPTGAALRDILH----TLSRRFPSVEVIVYPTL  171 (440)
T ss_pred             cCCchHHHHHHHH----HHHhhCCCCeEEEEecc
Confidence            6778899999886    47899999999998753


No 122
>KOG1909|consensus
Probab=38.19  E-value=30  Score=25.99  Aligned_cols=36  Identities=28%  Similarity=0.538  Sum_probs=29.0

Q ss_pred             CcceEEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEE
Q psy15302          7 SKLKELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILV   48 (68)
Q Consensus         7 ~qlk~l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v   48 (68)
                      ++|++|.+.||.-.  +.|+-.|+.    .|++.||.+++.-
T Consensus       241 ~~L~El~l~dcll~--~~Ga~a~~~----al~~~~p~L~vl~  276 (382)
T KOG1909|consen  241 PHLRELNLGDCLLE--NEGAIAFVD----ALKESAPSLEVLE  276 (382)
T ss_pred             chheeecccccccc--cccHHHHHH----HHhccCCCCceec
Confidence            36999999999974  788888874    5777799888764


No 123
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism]
Probab=38.04  E-value=52  Score=18.48  Aligned_cols=23  Identities=17%  Similarity=0.245  Sum_probs=19.4

Q ss_pred             eEEEEEecCCCCCCHHHHHHHHh
Q psy15302         10 KELRIHLCQKGGSSSGVRDFLAQ   32 (68)
Q Consensus        10 k~l~~~yc~~~~sS~G~R~Fl~~   32 (68)
                      .+-.+.||..|..|.-+-.+|..
T Consensus        61 ~~~ivv~C~~G~rS~~aa~~L~~   83 (110)
T COG0607          61 DDPIVVYCASGVRSAAAAAALKL   83 (110)
T ss_pred             CCeEEEEeCCCCChHHHHHHHHH
Confidence            45778999999999998888864


No 124
>PF02114 Phosducin:  Phosducin;  InterPro: IPR024253 The outer and inner segments of vertebrate rod photoreceptor cells contain phosducin, a soluble phosphoprotein that complexes with the beta/gamma-subunits of the GTP-binding protein, transducin. Light-induced changes in cyclic nucleotide levels modulate the phosphorylation of phosducin by protein kinase A []. The protein is thought to participate in the regulation of visual phototransduction or in the integration of photo-receptor metabolism. Similar proteins have been isolated from the pineal gland and it is believed that the functional role of the protein is the same in both retina and pineal gland []. This entry represents a domain found in members of the phosducin family. This domain has a thioredoxin-like fold [].; PDB: 2DBC_A 1A0R_P 1B9Y_C 1B9X_C 2TRC_P 3EVI_B.
Probab=37.65  E-value=1.1e+02  Score=21.58  Aligned_cols=50  Identities=8%  Similarity=-0.039  Sum_probs=31.9

Q ss_pred             EEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEecC----------CCCCEEEEEecCC
Q psy15302         11 ELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRECS----------GVTPVVWASGKGT   65 (68)
Q Consensus        11 ~l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~~~----------~~~P~v~a~Y~nG   65 (68)
                      -|+..|-+..+.++    .|.+.|..+|+++|.|.|.--...          ..-|.|.+.+ +|
T Consensus       149 VVVHiY~~~~~~C~----~mn~~L~~LA~kyp~vKFvkI~a~~~~~~~~f~~~~LPtllvYk-~G  208 (265)
T PF02114_consen  149 VVVHIYEPGFPRCE----IMNSCLECLARKYPEVKFVKIRASKCPASENFPDKNLPTLLVYK-NG  208 (265)
T ss_dssp             EEEEEE-TTSCCHH----HHHHHHHHHHHH-TTSEEEEEEECGCCTTTTS-TTC-SEEEEEE-TT
T ss_pred             EEEEEEeCCCchHH----HHHHHHHHHHHhCCceEEEEEehhccCcccCCcccCCCEEEEEE-CC
Confidence            45566666555554    477889999999999999854332          2367776654 55


No 125
>PF11247 DUF2675:  Protein of unknown function (DUF2675) ;  InterPro: IPR022611  Members in this family of proteins include Bacteriophage T7 gene 5.5; they have no known function. 
Probab=37.23  E-value=27  Score=21.54  Aligned_cols=15  Identities=13%  Similarity=0.366  Sum_probs=13.5

Q ss_pred             HHHHHHHHhCHHHHH
Q psy15302         24 SGVRDFLAQHYVPLK   38 (68)
Q Consensus        24 ~G~R~Fl~~~l~~~~   38 (68)
                      +|+|+||++.++++.
T Consensus        68 ~g~R~~IKe~~~E~s   82 (98)
T PF11247_consen   68 QGIREAIKEMLSEYS   82 (98)
T ss_pred             HHHHHHHHHHHHHhc
Confidence            699999999999887


No 126
>PF09217 EcoRII-N:  Restriction endonuclease EcoRII, N-terminal;  InterPro: IPR023372 There are four classes of restriction endonucleases: types I, II,III and IV. All types of enzymes recognise specific short DNA sequences and carry out the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. They differ in their recognition sequence, subunit composition, cleavage position, and cofactor requirements [, ], as summarised below:   Type I enzymes (3.1.21.3 from EC) cleave at sites remote from recognition site; require both ATP and S-adenosyl-L-methionine to function; multifunctional protein with both restriction and methylase (2.1.1.72 from EC) activities. Type II enzymes (3.1.21.4 from EC) cleave within or at short specific distances from recognition site; most require magnesium; single function (restriction) enzymes independent of methylase. Type III enzymes (3.1.21.5 from EC) cleave at sites a short distance from recognition site; require ATP (but doesn't hydrolyse it); S-adenosyl-L-methionine stimulates reaction but is not required; exists as part of a complex with a modification methylase methylase (2.1.1.72 from EC). Type IV enzymes target methylated DNA.   Type II restriction endonucleases (3.1.21.4 from EC) are components of prokaryotic DNA restriction-modification mechanisms that protect the organism against invading foreign DNA. These site-specific deoxyribonucleases catalyse the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. Of the 3000 restriction endonucleases that have been characterised, most are homodimeric or tetrameric enzymes that cleave target DNA at sequence-specific sites close to the recognition site. For homodimeric enzymes, the recognition site is usually a palindromic sequence 4-8 bp in length. Most enzymes require magnesium ions as a cofactor for catalysis. Although they can vary in their mode of recognition, many restriction endonucleases share a similar structural core comprising four beta-strands and one alpha-helix, as well as a similar mechanism of cleavage, suggesting a common ancestral origin []. However, there is still considerable diversity amongst restriction endonucleases [, ]. The target site recognition process triggers large conformational changes of the enzyme and the target DNA, leading to the activation of the catalytic centres. Like other DNA binding proteins, restriction enzymes are capable of non-specific DNA binding as well, which is the prerequisite for efficient target site location by facilitated diffusion. Non-specific binding usually does not involve interactions with the bases but only with the DNA backbone [].  This entry represents the N-terminal effector-binding domain of the type II restriction endonuclease EcoRII, which has a DNA recognition fold, allowing for binding to 5'-CCWGG sequences. It assumes a structure composed of an eight-stranded beta-sheet with the strands in the order of b2, b5, b4, b3, b7, b6, b1 and b8. They are mostly antiparallel to each other except that b3 is parallel to b7. Alternatively, it may also be viewed as consisting of two mini beta-sheets of four antiparallel beta-strands, sheet I from beta-strands b2, b5, b4, b3 and sheet II from strands b7, b6, b1, b8, folded into an open mixed beta-barrel with a novel topology. Sheet I has a simple Greek key motif while sheet II does not [].  The domain represented by this entry is only found in bacterial proteins.; PDB: 3HQF_A 1NA6_A.
Probab=36.87  E-value=31  Score=22.94  Aligned_cols=43  Identities=19%  Similarity=0.062  Sum_probs=26.6

Q ss_pred             HHHHHHHHhCHHHHHHhCCCCeEEEEecCCC-C-CEEEEEecCCC
Q psy15302         24 SGVRDFLAQHYVPLKQANPKFPILVRECSGV-T-PVVWASGKGTH   66 (68)
Q Consensus        24 ~G~R~Fl~~~l~~~~~~NP~v~i~v~~~~~~-~-P~v~a~Y~nGr   66 (68)
                      +...+.|--.++.-+..||++.+.++-..+- . -.+++.|=|.|
T Consensus        33 k~~~~~lFp~~~~~~~~Np~~~~~~~~~s~~~~~~~~r~iYYnn~   77 (156)
T PF09217_consen   33 KSAAELLFPSINHTKEENPDIWLKARWQSHFVTDSQVRFIYYNNR   77 (156)
T ss_dssp             HHHHHHH-GGG-SSSSSS-EEEEEEEETTTT---EEEEEEEE-CC
T ss_pred             ccHHHHhCCCCCcccccCCceeEEEEECCCCccceeEEEEEEccc
Confidence            3444444455666788999999999998873 3 33677776663


No 127
>PF07205 DUF1413:  Domain of unknown function (DUF1413);  InterPro: IPR010813 This family consists of several hypothetical bacterial proteins, which seem to be specific to Staphylococcus species. Members of this family are typically around 100 residues in length. The function of this family is unknown.
Probab=36.81  E-value=62  Score=17.94  Aligned_cols=33  Identities=15%  Similarity=0.118  Sum_probs=28.8

Q ss_pred             CCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         18 QKGGSSSGVRDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        18 ~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      +|..-|.|.|..+...+-.+-.++|.+.|.+-.
T Consensus        27 ~w~~~s~~~r~~~g~~F~~~V~~~~~~~i~~~~   59 (70)
T PF07205_consen   27 EWNTLSRAERQSLGRAFLYEVKQGPIVRIKIIG   59 (70)
T ss_pred             hhhhCCHHHHHHHHHHHHHHHHhCCCCceEEEe
Confidence            466689999999999999999999999887754


No 128
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions. It specifically binds G protein betagamma (Gbg)-subunits with high affinity, resulting in the solubilization of Gbg from the plasma membrane. This impedes the formation of a functional G protein trimer (G protein alphabetagamma), thereby inhibiting G protein-mediated signal transduction. Phd also inhibits the GTPase activity of G protein alpha. Phd can be phosphorylated by protein kinase A and G protein-coupled receptor kinase 2, leading to its inactivation. Phd was originally isolated from the retina, where it is highly expressed and has been implicated to play an important role in light adaptation. It is also found in the pineal gland, liver, spleen, striated muscle and the brain. The C-terminal domain of Phd adopts a thioredoxin fold, but it does not contain a CXXC motif. Phd interacts with G protein beta mostly through the N-terminal helical domain.
Probab=36.72  E-value=67  Score=20.85  Aligned_cols=35  Identities=6%  Similarity=-0.075  Sum_probs=24.7

Q ss_pred             EEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         12 LRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        12 l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      |...|-+|.+.++-|    ...|.++++++|.+.|.-..
T Consensus        87 VV~Fya~wc~~Ck~m----~~~l~~LA~~~~~vkF~kVd  121 (175)
T cd02987          87 VVHIYEPGIPGCAAL----NSSLLCLAAEYPAVKFCKIR  121 (175)
T ss_pred             EEEEECCCCchHHHH----HHHHHHHHHHCCCeEEEEEe
Confidence            445566788877744    45677888999998886543


No 129
>TIGR02174 CXXU_selWTH selT/selW/selH selenoprotein domain. This model represents a domain found in both bacteria and animals, including animal proteins SelT, SelW, and SelH, all of which are selenoproteins. In a CXXC motif near the N-terminus of the domain, selenocysteine may replace the second Cys. Proteins with this domain may include an insert of about 70 amino acids. This model is broader than the current SelW model pfam05169 in Pfam.
Probab=36.62  E-value=79  Score=17.61  Aligned_cols=38  Identities=18%  Similarity=0.250  Sum_probs=23.3

Q ss_pred             EEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEecCC
Q psy15302         12 LRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRECSG   53 (68)
Q Consensus        12 l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~~~~   53 (68)
                      |+|.||...+ ..+--..+.   .++....|+.++.+...++
T Consensus         1 V~IeyC~~C~-y~~Ra~~l~---q~L~~~Fp~~~v~~~~~~~   38 (72)
T TIGR02174         1 VEIEYCGSCG-YKPRAAWLK---QELLEEFPDLEIEGENTPP   38 (72)
T ss_pred             CEEEECCCCC-ChHHHHHHH---HHHHHHCCCCeeEEeeecC
Confidence            5789999887 333333333   3566677887666655443


No 130
>PF10262 Rdx:  Rdx family;  InterPro: IPR011893 This entry represents the Rdx family of selenoproteins, which includes mammalian selenoproteins SelW, SelV, SelT and SelH, bacterial SelW-like proteins and cysteine-containing proteins of unknown function in all three domains of life. Mammalian Rdx12 and its fish selenoprotein orthologues are also members of this family []. These proteins possess a thioredoxin-like fold and a conserved CXXC or CxxU (U is selenocysteine) motif near the N terminus, suggesting a redox function. Rdx proteins can use catalytic cysteine (or selenocysteine) to form transient mixed disulphides with substrate proteins. Selenium (Se) plays an essential role in cell survival and most of the effects of Se are probably mediated by selenoproteins.   Selenoprotein W (SelW) plays an important role in protection of neurons from oxidative stress during neuronal development [], [].   Selenoprotein T (SelT) is conserved from plants to humans. SelT is localized to the endoplasmic reticulum through a hydrophobic domain. The protein binds to UDP-glucose:glycoprotein glucosyltransferase (UGTR), the endoplasmic reticulum (ER)-resident protein, which is known to be involved in the quality control of protein folding [, ]. The function of SelT is unknown, although it may have a role in PACAP signaling during PC12 cell differentiation [, ].  Selenoprotein H (SelH) protects neurons against UVB-induced damage by inhibiting apoptotic cell death pathways, by preventing mitochondrial depolarization, and by promoting cell survival pathways [].; GO: 0008430 selenium binding, 0045454 cell redox homeostasis; PDB: 2OJL_B 2FA8_A 2P0G_C 2NPB_A 3DEX_C 2OKA_A 2OBK_G.
Probab=36.36  E-value=80  Score=17.59  Aligned_cols=37  Identities=16%  Similarity=0.200  Sum_probs=23.6

Q ss_pred             EEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCC--CeEEEEec
Q psy15302         11 ELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPK--FPILVREC   51 (68)
Q Consensus        11 ~l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~--v~i~v~~~   51 (68)
                      +|.|.||...+-..-.-+    .-..+....|+  ..|...+.
T Consensus         2 ~V~IeYC~~C~~~~~a~~----l~~~l~~~fp~~~~~v~~~~~   40 (76)
T PF10262_consen    2 KVTIEYCTSCGYRPRALE----LAQELLQTFPDRIAEVELSPG   40 (76)
T ss_dssp             EEEEEEETTTTCHHHHHH----HHHHHHHHSTTTCSEEEEEEE
T ss_pred             EEEEEECCCCCCHHHHHH----HHHHHHHHCCCcceEEEEEec
Confidence            689999998874433222    22345666777  67777663


No 131
>TIGR00269 conserved hypothetical protein TIGR00269.
Probab=35.29  E-value=20  Score=21.53  Aligned_cols=24  Identities=25%  Similarity=0.290  Sum_probs=20.5

Q ss_pred             CCHHHHHHHHhCHHHHHHhCCCCe
Q psy15302         22 SSSGVRDFLAQHYVPLKQANPKFP   45 (68)
Q Consensus        22 sS~G~R~Fl~~~l~~~~~~NP~v~   45 (68)
                      +....|..+++.|.++.+.||++.
T Consensus        34 ~~~a~R~~~k~~L~~LE~~~P~~k   57 (104)
T TIGR00269        34 SSLSVRARIRDFLYDLENKKPGVK   57 (104)
T ss_pred             CCCCchHHHHHHHHHHHHHCcChH
Confidence            456789999999999999999875


No 132
>PRK10837 putative DNA-binding transcriptional regulator; Provisional
Probab=35.11  E-value=58  Score=21.54  Aligned_cols=26  Identities=12%  Similarity=0.199  Sum_probs=21.8

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ...++...+..|.+++|++.|.+...
T Consensus       100 ~~~~~~~~l~~~~~~~P~i~i~v~~~  125 (290)
T PRK10837        100 GNYILPAMIARYRRDYPQLPLELSVG  125 (290)
T ss_pred             HhhhhHHHHHHHHHHCCCceEEEEEC
Confidence            34667889999999999999999754


No 133
>PF13504 LRR_7:  Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D ....
Probab=35.10  E-value=19  Score=14.83  Aligned_cols=11  Identities=18%  Similarity=0.317  Sum_probs=7.6

Q ss_pred             cceEEEEEecC
Q psy15302          8 KLKELRIHLCQ   18 (68)
Q Consensus         8 qlk~l~~~yc~   18 (68)
                      .|+.|.++.|+
T Consensus         2 ~L~~L~l~~n~   12 (17)
T PF13504_consen    2 NLRTLDLSNNR   12 (17)
T ss_dssp             T-SEEEETSS-
T ss_pred             ccCEEECCCCC
Confidence            58889888886


No 134
>PF00280 potato_inhibit:  Potato inhibitor I family;  InterPro: IPR000864 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.  This family of proteinase inhibitors belong to MEROPS inhibitor family I13, clan IG. They inhibit peptidases of the S1 (IPR001254 from INTERPRO) and S8 (IPR000209 from INTERPRO) families []. Potato inhibitor type I sequences are not solely restricted to potatoes but are found in other plant species for example: barley endosperm chymotrypsin inhibitor [], and pumpkin trypsin inhibitor. Exceptions are found in leech's, e.g.Hirudo medicinalis (Medicinal leech), but not other metazoa []. In general, the proteins have retained a specificity towards chymotrypsin-like and elastase-like proteases []. Structurally these inhibitors are small (60 to 90 residues) and in contrast with other families of protease inhibitors, they lack disulphide bonds. The inhibitor is a wedge-shaped molecule, its pointed edge formed by the protease-binding loop, which contains the scissile bond. The loop binds tightly to the protease active site, subsequent cleavage of the scissile bond causing inhibition of the enzyme [].  The inhibitors (designated type I and II) are synthesised in potato tubers, increasing in concentration as the tuber develops. Synthesis of the inhibitors throughout the plant is also induced by leaf damage; this systemic response being triggered by the release of a putative plant hormone []. Examples found in the bacteria and archaea are probable false positives.; GO: 0004867 serine-type endopeptidase inhibitor activity, 0009611 response to wounding; PDB: 1TEC_I 1SBN_I 1ACB_I 1EGP_A 3TEC_I 2SEC_I 1EGL_A 2TEC_I 1SIB_I 1MEE_I ....
Probab=35.04  E-value=36  Score=19.03  Aligned_cols=19  Identities=16%  Similarity=0.282  Sum_probs=15.1

Q ss_pred             HHHHHHhCCCCeEEEEecC
Q psy15302         34 YVPLKQANPKFPILVRECS   52 (68)
Q Consensus        34 l~~~~~~NP~v~i~v~~~~   52 (68)
                      -..|++.||++.+.+-+..
T Consensus        16 ~~~I~~e~P~v~v~vlp~g   34 (63)
T PF00280_consen   16 KAIIERENPDVTVVVLPEG   34 (63)
T ss_dssp             HHHHHHHSTTSEEEEEETT
T ss_pred             HHHHHHHCCCCeEEEEeCC
Confidence            4568899999999987643


No 135
>PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional
Probab=34.68  E-value=41  Score=22.96  Aligned_cols=25  Identities=8%  Similarity=-0.013  Sum_probs=21.0

Q ss_pred             CCHHHHHHHHhCHHHHHHhCCCCeE
Q psy15302         22 SSSGVRDFLAQHYVPLKQANPKFPI   46 (68)
Q Consensus        22 sS~G~R~Fl~~~l~~~~~~NP~v~i   46 (68)
                      .....|+.+++-+|.+.+.||++..
T Consensus       206 ~~~~~R~~ir~~l~~L~~~~P~~~~  230 (258)
T PRK10696        206 QENLQRQVVKEMLRDWEKEYPGRIE  230 (258)
T ss_pred             CchhHHHHHHHHHHHHHHHCccHHH
Confidence            3456899999999999999998754


No 136
>PRK11139 DNA-binding transcriptional activator GcvA; Provisional
Probab=34.62  E-value=64  Score=21.62  Aligned_cols=25  Identities=12%  Similarity=0.373  Sum_probs=22.0

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ..++...+.+|.+.+|++.|.+...
T Consensus       106 ~~~l~~~l~~f~~~~p~i~i~l~~~  130 (297)
T PRK11139        106 IQWLVPRLSSFNEAHPDIDVRLKAV  130 (297)
T ss_pred             HHHHHHHHHHHHHHCCCceEEEEeC
Confidence            5788889999999999999999754


No 137
>PRK11716 DNA-binding transcriptional regulator IlvY; Provisional
Probab=34.45  E-value=67  Score=20.76  Aligned_cols=25  Identities=12%  Similarity=0.121  Sum_probs=21.5

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ..++..-+..|.+.+|++.+.+...
T Consensus        79 ~~~~~~~l~~~~~~~p~i~l~i~~~  103 (269)
T PRK11716         79 YSHLPPILDRFRAEHPLVEIKLTTG  103 (269)
T ss_pred             HHHHHHHHHHHHHHCCCeEEEEEEC
Confidence            5678889999999999999998753


No 138
>PRK10597 DNA damage-inducible protein I; Provisional
Probab=34.34  E-value=1e+02  Score=18.19  Aligned_cols=43  Identities=19%  Similarity=0.254  Sum_probs=34.9

Q ss_pred             EEEEEecCCCCCCHHHHHHHH-hCHHHHHHhCCCCe--EEEEecCC
Q psy15302         11 ELRIHLCQKGGSSSGVRDFLA-QHYVPLKQANPKFP--ILVRECSG   53 (68)
Q Consensus        11 ~l~~~yc~~~~sS~G~R~Fl~-~~l~~~~~~NP~v~--i~v~~~~~   53 (68)
                      +|.+.|....+-+.|+.+-|+ +..-.+....|++.  +.|+....
T Consensus         2 rVEi~~dK~~~lp~ga~~AL~~EL~kRl~~~fPd~~~~v~Vr~~s~   47 (81)
T PRK10597          2 RIEVTIAKTSPLPAGAIDALAGELSRRIQYAFPDNEGHVSVRYAAA   47 (81)
T ss_pred             eEEEEEecCCCCChhHHHHHHHHHHHHHHhhCCCCCccEEEeecCC
Confidence            466777777788899999886 56779999999998  88877664


No 139
>PRK10974 glycerol-3-phosphate transporter periplasmic binding protein; Provisional
Probab=34.28  E-value=60  Score=23.25  Aligned_cols=25  Identities=8%  Similarity=0.121  Sum_probs=20.7

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      -.+.++..+.+|.++||+|.|.+..
T Consensus        38 ~~~~~~~~~~~F~~~~p~i~V~~~~   62 (438)
T PRK10974         38 LGKEVDSLAQRFNASQPDYKIVPVY   62 (438)
T ss_pred             hHHHHHHHHHHHHHhCCCeEEEEee
Confidence            3467888999999999999988753


No 140
>PRK13995 potassium-transporting ATPase subunit C; Provisional
Probab=34.18  E-value=65  Score=22.20  Aligned_cols=44  Identities=16%  Similarity=0.255  Sum_probs=33.2

Q ss_pred             cCCCCCCHHHHHHHHhCHHHHHHhCCC-----CeEEE--EecCCCCCEEEE
Q psy15302         17 CQKGGSSSGVRDFLAQHYVPLKQANPK-----FPILV--RECSGVTPVVWA   60 (68)
Q Consensus        17 c~~~~sS~G~R~Fl~~~l~~~~~~NP~-----v~i~v--~~~~~~~P~v~a   60 (68)
                      ++-+++|.-+.+-+++....|++.||.     ||+..  ...+|-+|.|.-
T Consensus        95 SNlgpsnp~L~~~v~~r~~~~~~~~p~~~~~~vP~DlvTaSgSGLDPhISp  145 (203)
T PRK13995         95 QNYAPTNPELHDRVQKDIDKFLKTNPTVKKEDIPTDLLTASGSGLDPHISP  145 (203)
T ss_pred             cCCCCCCHHHHHHHHHHHHHHHHhCCCCCCCCCCHHHHhccccCCCCCCCH
Confidence            456788899999999999999999985     44433  445677887643


No 141
>PF08109 Antimicrobial14:  Lactocin 705 family;  InterPro: IPR012517 This family consists of lactocin 705 which is a bacteriocin produced by Lactobacillus casei CRL 705. Lactocin 705 is a class IIb bacteriocin, whose activity depends upon the complementation of two peptides (705-alpha and 705-beta) of 33 amino acid residues each. Lactocin 705 is active against several Gram-positive bacteria, including food-borne pathogens and is a good candidate to be used for biopreservation of fermented meats [].
Probab=34.13  E-value=26  Score=16.94  Aligned_cols=23  Identities=30%  Similarity=0.426  Sum_probs=18.5

Q ss_pred             CCCHHHHHHHHhCHHHHHHhCCC
Q psy15302         21 GSSSGVRDFLAQHYVPLKQANPK   43 (68)
Q Consensus        21 ~sS~G~R~Fl~~~l~~~~~~NP~   43 (68)
                      |--+|+-+|+...|--+..+|.+
T Consensus         4 gyiqgipdflkgylhgisaankh   26 (31)
T PF08109_consen    4 GYIQGIPDFLKGYLHGISAANKH   26 (31)
T ss_pred             ccccccHHHHHHHHhhhhhhccc
Confidence            34578999999999888888765


No 142
>COG4097 Predicted ferric reductase [Inorganic ion transport and metabolism]
Probab=34.08  E-value=44  Score=25.52  Aligned_cols=44  Identities=16%  Similarity=0.190  Sum_probs=30.6

Q ss_pred             eEEEEEecCCCCCCHHHHHHH-HhCHHHHHHhCCCCeEEEEecCCCCCEEE
Q psy15302         10 KELRIHLCQKGGSSSGVRDFL-AQHYVPLKQANPKFPILVRECSGVTPVVW   59 (68)
Q Consensus        10 k~l~~~yc~~~~sS~G~R~Fl-~~~l~~~~~~NP~v~i~v~~~~~~~P~v~   59 (68)
                      +-|.+.||-.+-     .+=+ .+.+-+++++||.+.+.+ -.++..|++-
T Consensus       344 ~~V~L~Y~~~n~-----e~~~y~~eLr~~~qkl~~~~lHi-iDSs~~g~l~  388 (438)
T COG4097         344 PPVHLFYCSRNW-----EEALYAEELRALAQKLPNVVLHI-IDSSKDGYLD  388 (438)
T ss_pred             CceEEEEEecCC-----chhHHHHHHHHHHhcCCCeEEEE-ecCCCCCccC
Confidence            347889986542     2333 457888999999999999 4445566654


No 143
>PRK11151 DNA-binding transcriptional regulator OxyR; Provisional
Probab=34.06  E-value=72  Score=21.46  Aligned_cols=27  Identities=22%  Similarity=0.202  Sum_probs=22.8

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         25 GVRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        25 G~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ....++...+.+|.+.+|++.|.+...
T Consensus       101 ~~~~~~~~~l~~~~~~~P~v~i~~~~~  127 (305)
T PRK11151        101 VGPYLLPHIIPMLHQTFPKLEMYLHEA  127 (305)
T ss_pred             hHHHHHHHHHHHHHHHCCCcEEEEEeC
Confidence            346788889999999999999999864


No 144
>PRK12681 cysB transcriptional regulator CysB; Reviewed
Probab=33.64  E-value=63  Score=22.38  Aligned_cols=36  Identities=14%  Similarity=0.155  Sum_probs=27.1

Q ss_pred             EEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         11 ELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        11 ~l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      .|+|-.+.     .-...++...+.+|.+.+|++.|.+...
T Consensus        94 ~l~Ig~~~-----~~~~~~l~~~l~~f~~~~P~i~i~i~~~  129 (324)
T PRK12681         94 SLYIATTH-----TQARYALPPVIKGFIERYPRVSLHMHQG  129 (324)
T ss_pred             eEEEEech-----hHHHHhhHHHHHHHHHHCCCcEEEEEeC
Confidence            46664432     3345688899999999999999999764


No 145
>PRK09508 leuO leucine transcriptional activator; Reviewed
Probab=33.64  E-value=73  Score=21.68  Aligned_cols=26  Identities=15%  Similarity=0.310  Sum_probs=22.7

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEecC
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVRECS   52 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~~   52 (68)
                      ..++...+.+|.+++|++.|.+....
T Consensus       124 ~~~l~~~l~~f~~~~P~i~l~i~~~~  149 (314)
T PRK09508        124 IRLTSQIYNRIEQIAPNIHVVFKSSL  149 (314)
T ss_pred             HHHHHHHHHHHHHhCCCcEEEEEeCc
Confidence            56888999999999999999998753


No 146
>PRK09801 transcriptional activator TtdR; Provisional
Probab=33.58  E-value=76  Score=21.74  Aligned_cols=28  Identities=14%  Similarity=0.134  Sum_probs=23.0

Q ss_pred             HHHHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         24 SGVRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        24 ~G~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      .-...|+...+.+|.+++|++.|.+...
T Consensus       105 ~~~~~~l~~~l~~f~~~~P~i~l~i~~~  132 (310)
T PRK09801        105 GFGRSHIAPAITELMRNYPELQVHFELF  132 (310)
T ss_pred             HHHHHHHHHHHHHHHHHCCCeEEEEEec
Confidence            3345688899999999999999998754


No 147
>PF07735 FBA_2:  F-box associated;  InterPro: IPR012885 This domain is found is found towards the C terminus of proteins that contain an F-box, IPR001810 from INTERPRO, suggesting that they are effectors linked with ubiquitination. 
Probab=33.34  E-value=73  Score=16.99  Aligned_cols=35  Identities=17%  Similarity=0.344  Sum_probs=25.5

Q ss_pred             cceEEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEE
Q psy15302          8 KLKELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPIL   47 (68)
Q Consensus         8 qlk~l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~   47 (68)
                      .++.|.|..+..  +++.+..||.+.+.-   .||.++..
T Consensus        33 nc~~i~l~~~~~--t~~dln~Flk~W~~G---~~~~Le~l   67 (70)
T PF07735_consen   33 NCKKIELWNSKF--TNEDLNKFLKHWING---SNPRLEYL   67 (70)
T ss_pred             CCCEEEEECCCC--CHHHHHHHHHHHHcC---CCcCCcEE
Confidence            467788866655  589999999887654   67776654


No 148
>PF09822 ABC_transp_aux:  ABC-type uncharacterized transport system;  InterPro: IPR019196  This domain is found in various eukaryotic and prokaryotic intra-flagellar transport proteins involved in gliding motility, as well as in several hypothetical proteins. 
Probab=33.26  E-value=1.3e+02  Score=20.32  Aligned_cols=40  Identities=10%  Similarity=0.119  Sum_probs=29.4

Q ss_pred             EEEEEecCCCCC-CHHHHHHHHhCHHHHHHhCC-CCeEEEEe
Q psy15302         11 ELRIHLCQKGGS-SSGVRDFLAQHYVPLKQANP-KFPILVRE   50 (68)
Q Consensus        11 ~l~~~yc~~~~s-S~G~R~Fl~~~l~~~~~~NP-~v~i~v~~   50 (68)
                      +|++.+...-+. -...+.-+++.|.++++.+| ++.+...-
T Consensus        28 ~i~~~~s~~l~~~~~~~~~~v~~lL~~y~~~s~g~i~v~~iD   69 (271)
T PF09822_consen   28 TITVYFSRELPPELSPLRKQVRDLLDEYARYSPGKIKVEFID   69 (271)
T ss_pred             EEEEEECCCcchhhhHHHHHHHHHHHHHHHhCCCceEEEEEC
Confidence            466667663332 46677778889999999999 99888743


No 149
>PRK14001 potassium-transporting ATPase subunit C; Provisional
Probab=33.11  E-value=70  Score=21.78  Aligned_cols=44  Identities=16%  Similarity=0.268  Sum_probs=33.8

Q ss_pred             cCCCCCCHHHHHHHHhCHHHHHHhCCC-----CeEE--EEecCCCCCEEEE
Q psy15302         17 CQKGGSSSGVRDFLAQHYVPLKQANPK-----FPIL--VRECSGVTPVVWA   60 (68)
Q Consensus        17 c~~~~sS~G~R~Fl~~~l~~~~~~NP~-----v~i~--v~~~~~~~P~v~a   60 (68)
                      ++.++++.-+.+-+++....|+++||.     ||..  +...+|-+|.|.-
T Consensus        85 SNl~psnp~l~~~v~~r~~~~~~~~~~~~~~~vP~DlvTaSgSGLDPhIS~  135 (189)
T PRK14001         85 SNLGPTNEKLLAAVAERVTAYRKENNLPADTLVPVDAVTGSGSGLDPAISV  135 (189)
T ss_pred             cCCCCCCHHHHHHHHHHHHHHHHhCCCccCCCCCHHHHhcccccCCCCCCH
Confidence            567889999999999999999999984     4433  3445677887653


No 150
>PRK09791 putative DNA-binding transcriptional regulator; Provisional
Probab=32.95  E-value=66  Score=21.62  Aligned_cols=26  Identities=15%  Similarity=0.314  Sum_probs=22.3

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ...++...+..|.+++|++.|.++..
T Consensus       106 ~~~~l~~~l~~~~~~~p~i~~~~~~~  131 (302)
T PRK09791        106 ARSLMPAVISRFHQQHPQVKVRIMEG  131 (302)
T ss_pred             HHhhhHHHHHHHHHHCCCeEEEEEeC
Confidence            45677899999999999999999863


No 151
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family. This glutaredoxin-like protein family contains the conserved CxxC motif and includes the Clostridium pasteurianum protein YruB which has been cloned from a rubredoxin operon. Somewhat related to NrdH, it is unknown whether this protein actually interacts with glutathione/glutathione reducatase, or, like NrdH, some other reductant system.
Probab=32.85  E-value=54  Score=16.68  Aligned_cols=21  Identities=5%  Similarity=0.180  Sum_probs=18.1

Q ss_pred             EEEEecCCCCCCHHHHHHHHh
Q psy15302         12 LRIHLCQKGGSSSGVRDFLAQ   32 (68)
Q Consensus        12 l~~~yc~~~~sS~G~R~Fl~~   32 (68)
                      |++.+.++.+.++.++.++++
T Consensus         2 i~lf~~~~C~~C~~~~~~l~~   22 (74)
T TIGR02196         2 VKVYTTPWCPPCKKAKEYLTS   22 (74)
T ss_pred             EEEEcCCCChhHHHHHHHHHH
Confidence            678888999999999998864


No 152
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions. Phd and PhLPs specifically bind G protein betagamma (Gbg)-subunits with high affinity, resulting in the solubilization of Gbg from the plasma membrane and impeding G protein-mediated signal transduction by inhibiting the formation of a functional G protein trimer (G protein alphabetagamma). Phd also inhibits the GTPase activity of G protein alpha. Phd can be phosphorylated by protein kinase A and G protein-coupled receptor kinase 2, leading to its inactivation. Phd was originally isolated from the retina, where it is highly expressed and has been implicated to play an important role in light adaptation. It is also found in the pineal gland, liver, spleen, striated muscle and the brain. The C-terminal domain of Phd adopts a thioredoxin fold, but it does not contain a CXXC motif. Phd interacts with G protein beta mostly through the N-te
Probab=32.59  E-value=1.1e+02  Score=17.88  Aligned_cols=34  Identities=9%  Similarity=-0.053  Sum_probs=23.9

Q ss_pred             EEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEE
Q psy15302         11 ELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILV   48 (68)
Q Consensus        11 ~l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v   48 (68)
                      -|...|.+|.+.++-+..    .+.+++.++|++.|..
T Consensus        27 vvv~F~a~~c~~C~~l~~----~l~~la~~~~~v~f~~   60 (113)
T cd02957          27 VVVHFYEPGFPRCKILDS----HLEELAAKYPETKFVK   60 (113)
T ss_pred             EEEEEeCCCCCcHHHHHH----HHHHHHHHCCCcEEEE
Confidence            456678889888886554    5556777888876544


No 153
>PRK11074 putative DNA-binding transcriptional regulator; Provisional
Probab=32.56  E-value=54  Score=22.11  Aligned_cols=37  Identities=16%  Similarity=0.092  Sum_probs=28.9

Q ss_pred             eEEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         10 KELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        10 k~l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ..|+|-..+..     ...++...+..|++++|++.|.+...
T Consensus        92 g~l~Ig~~~~~-----~~~~l~~~l~~~~~~~p~i~i~i~~~  128 (300)
T PRK11074         92 GQLSIAVDNIV-----RPDRTRQLIVDFYRHFDDVELIIRQE  128 (300)
T ss_pred             ceEEEEEcCcc-----chhHHHHHHHHHHHhCCCceEEEEeh
Confidence            46777764433     36788899999999999999999763


No 154
>cd06544 GH18_narbonin Narbonin is a plant 2S protein from the globulin fraction of narbon bean (Vicia narbonensis L.) cotyledons with unknown function.  Narbonin has a glycosyl hydrolase family 18 (GH18) domain without the conserved catalytic residues and with no known enzymatic activity.  Narbonin amounts to up to 3% of the total seed globulins of mature seeds and was thought to be a storage protein but was found to degrade too slowly during germination.  This family also includes the VfNOD32 nodulin from Vicia faba.
Probab=32.54  E-value=39  Score=23.42  Aligned_cols=21  Identities=10%  Similarity=0.267  Sum_probs=17.7

Q ss_pred             hCHHHHHHhCCCCeEEEEecC
Q psy15302         32 QHYVPLKQANPKFPILVRECS   52 (68)
Q Consensus        32 ~~l~~~~~~NP~v~i~v~~~~   52 (68)
                      +.+.++|++||++++++.-.-
T Consensus        59 ~~~~~lK~~~p~lKvllSiGG   79 (253)
T cd06544          59 EAVKSIKAQHPNVKVVISIGG   79 (253)
T ss_pred             HHHHHHHHhCCCcEEEEEeCC
Confidence            568899999999999997644


No 155
>PRK09375 quinolinate synthetase; Provisional
Probab=32.53  E-value=70  Score=23.33  Aligned_cols=34  Identities=24%  Similarity=0.218  Sum_probs=27.2

Q ss_pred             ecCCCCCCHHHHHHHHhC-------------HHHHHHhCCCCeEEEE
Q psy15302         16 LCQKGGSSSGVRDFLAQH-------------YVPLKQANPKFPILVR   49 (68)
Q Consensus        16 yc~~~~sS~G~R~Fl~~~-------------l~~~~~~NP~v~i~v~   49 (68)
                      .+|.-|||.|+-+|++..             +-.+++++|+-+|..-
T Consensus       223 ~AD~vgSTs~~i~~v~~~~~~~~iigTE~~L~~~l~~~~P~K~fi~~  269 (319)
T PRK09375        223 LADFVGSTSQIIKAAKASPAKKFIVGTEIGIVHRLQKANPDKEFIPA  269 (319)
T ss_pred             hcCEEecHHHHHHHHHhCCCCeEEEEccHHHHHHHHHHCCCCEEEEC
Confidence            478889999999999643             4468888999988853


No 156
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO). All members contain a redox-active CXXC motif and may function as PDOs. The archaeal proteins Mj0307 and Mt807 show structures more similar to GRX, but activities more similar to TRX. Some members of the family are similar to PfPDO in that they contain a second CXXC motif located in a second TRX-fold subdomain at the N-terminus; the superimposable N- and C-terminal TRX subdomains form a compact structure. PfPDO is postulated to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI). The C-terminal CXXC motif of PfPDO is required for its oxidase, reductase and isomerase activities. Also included in the family is the C-terminal TRX-fold subdomain of the N-terminal domain (NTD) of bacteri
Probab=32.34  E-value=79  Score=16.34  Aligned_cols=36  Identities=6%  Similarity=0.106  Sum_probs=26.5

Q ss_pred             EEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         11 ELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        11 ~l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      +|.+.+-+|.+-++=++.+++    +++..+|++++....
T Consensus         2 ~v~~f~~~~C~~C~~~~~~l~----~l~~~~~~i~~~~id   37 (67)
T cd02973           2 NIEVFVSPTCPYCPDAVQAAN----RIAALNPNISAEMID   37 (67)
T ss_pred             EEEEEECCCCCCcHHHHHHHH----HHHHhCCceEEEEEE
Confidence            577888888888888877664    456678888876643


No 157
>PF01547 SBP_bac_1:  Bacterial extracellular solute-binding protein;  InterPro: IPR006059 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane. The protein components of these traffic systems include one or two transmembrane protein components, one or two membrane-associated ATP-binding proteins and a high affinity periplasmic solute-binding protein. In Gram-positive bacteria, which are surrounded by a single membrane and therefore have no periplasmic region, the equivalent proteins are bound to the membrane via an N-terminal lipid anchor. These homologue proteins do not play an integral role in the transport process per se, but probably serve as receptors to trigger or initiate translocation of the solute through the membrane by binding to external sites of the integral membrane proteins of the efflux system. In addition at least some solute-binding proteins function in the initiation of sensory transduction pathways. On the basis of sequence similarities, the vast majority of these solute-binding proteins can be grouped into eight family clusters [], which generally correlate with the nature of the solute bound. Family 1 includes the maltose/maltodextrin-binding proteins of Enterobacteriaceae (gene malE) [] and Streptococcus pneumoniae malX; multiple oligosaccharide binding protein of Streptococcus mutans (gene msmE); Escherichia coli glycerol-3-phosphate-binding protein; Serratia marcescens iron-binding protein (gene sfuA) and the homologous proteins (gene fbp) from Haemophilus influenzae and Neisseria; and the E. coli thiamine-binding protein (gene tbpA).; GO: 0005215 transporter activity, 0006810 transport; PDB: 3CFZ_A 2THI_A 3THI_A 4THI_A 1O7T_C 1D9Y_A 1URG_A 1URS_A 1URD_B 3OMB_A ....
Probab=32.29  E-value=44  Score=21.76  Aligned_cols=23  Identities=9%  Similarity=0.144  Sum_probs=19.0

Q ss_pred             HHHhCH-HHHHHhCCCCeEEEEec
Q psy15302         29 FLAQHY-VPLKQANPKFPILVREC   51 (68)
Q Consensus        29 Fl~~~l-~~~~~~NP~v~i~v~~~   51 (68)
                      +++..+ .+|.+.||.|.|.+...
T Consensus         9 ~~~~~~~~~f~k~~~~i~V~~~~~   32 (315)
T PF01547_consen    9 ALQELIIEEFEKEHPGIKVEIEFI   32 (315)
T ss_dssp             HHHHHHHHHHHHHHTTEEEEEEEE
T ss_pred             HHHHHHHHHHHHHCCCcEEEEEEC
Confidence            666667 88999999999998664


No 158
>KOG2559|consensus
Probab=32.28  E-value=55  Score=23.76  Aligned_cols=36  Identities=17%  Similarity=0.058  Sum_probs=30.2

Q ss_pred             CcccccCcceEEEEEecCCCCCCHHHHHHHHhCHHH
Q psy15302          1 MAARFGSKLKELRIHLCQKGGSSSGVRDFLAQHYVP   36 (68)
Q Consensus         1 Ms~r~v~qlk~l~~~yc~~~~sS~G~R~Fl~~~l~~   36 (68)
                      |...++|.|.-|--.|=+.|-+|+++|+-|..++-+
T Consensus         1 mg~~~i~kl~Gvl~VYKpsGik~khlr~~i~~~i~k   36 (318)
T KOG2559|consen    1 MGHLDIWKLSGVLCVYKPSGIKSKHLRKLITRKIAK   36 (318)
T ss_pred             CCccchhhhcceeEEecCCCccHHHHHHHHHHHHHh
Confidence            677788888888888989999999999999765543


No 159
>PRK14997 LysR family transcriptional regulator; Provisional
Probab=32.10  E-value=95  Score=20.78  Aligned_cols=27  Identities=4%  Similarity=0.144  Sum_probs=22.5

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEecC
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVRECS   52 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~~   52 (68)
                      ...++...+.+|.+++|++.|.+....
T Consensus       103 ~~~~l~~~l~~~~~~~P~i~i~~~~~~  129 (301)
T PRK14997        103 LHVHIGPMLAKFMARYPDVSLQLEATN  129 (301)
T ss_pred             HHHHHHHHHHHHHHHCCCeEEEEEecC
Confidence            346778899999999999999997643


No 160
>COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion]
Probab=31.91  E-value=94  Score=23.28  Aligned_cols=38  Identities=13%  Similarity=0.363  Sum_probs=29.1

Q ss_pred             ceEEEEEecCCCCCCHHHHHHH-HhCHHHHHHhCCCCeEEEEec
Q psy15302          9 LKELRIHLCQKGGSSSGVRDFL-AQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus         9 lk~l~~~yc~~~~sS~G~R~Fl-~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      =+||.|-|     ..+..|+-+ .+.+.+++++||+..-.+...
T Consensus       304 kRkis~WY-----GARS~rE~fY~Ed~d~L~ae~pNF~wH~aLS  342 (410)
T COG2871         304 KRKISFWY-----GARSLREMFYQEDFDQLQAENPNFHWHLALS  342 (410)
T ss_pred             cceeeeee-----ccchHHHhHHHHHHHHHHhhCCCcEEEEEec
Confidence            46788877     355667655 789999999999998887543


No 161
>PRK03601 transcriptional regulator HdfR; Provisional
Probab=31.87  E-value=89  Score=20.86  Aligned_cols=26  Identities=15%  Similarity=0.032  Sum_probs=22.2

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ...++...+.+|.+.+|++.|.+...
T Consensus       100 ~~~~l~~~l~~f~~~~P~v~v~~~~~  125 (275)
T PRK03601        100 WECMLTPWLGRLYQNQEALQFEARIA  125 (275)
T ss_pred             HHHHHHHHHHHHHHhCCCcEEEEEEC
Confidence            36778899999999999999988654


No 162
>cd04864 LigD_Pol_like_1 LigD_Pol_like_1: Polymerase (Pol) domain of mostly bacterial LigD proteins similar to Pseudomonas aeruginosa (Pae) LigD, subgroup 1. The LigD Pol domain belongs to the archaeal/eukaryal primase (AEP) superfamily. In prokaryotes, LigD along with Ku is required for non-homologous end joining (NHEJ)-mediated repair of DNA double-strand breaks (DSB). NHEJ-mediated DNA DSB repair is error-prone. It has been suggested that LigD Pol contributes to NHEJ-mediated DNA DSB repair in vivo, by filling in short 5'-overhangs with ribonucleotides; the filled in termini would then be sealed by the associated LigD ligase domain, resulting in short stretches of RNA incorporated into the genomic DNA. The Pol domains of PaeLigD and Mycobacterium tuberculosis (Mt)LigD are stimulated by manganese, are error-prone, and prefer adding rNTPs to dNTPs in vitro; however PaeLigD and MtLigD belong to other subgroups, proteins in this subgroup await functional characterization.
Probab=31.80  E-value=39  Score=23.58  Aligned_cols=45  Identities=16%  Similarity=0.090  Sum_probs=37.9

Q ss_pred             CCHHHHHHHHhCHHHHHHhCCCCeEEEEecCCCCCEEEEEec-CCC
Q psy15302         22 SSSGVRDFLAQHYVPLKQANPKFPILVRECSGVTPVVWASGK-GTH   66 (68)
Q Consensus        22 sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~~~~~~P~v~a~Y~-nGr   66 (68)
                      +..-+|.|.+.--..+.+++|+.-...+....+.-+|...|. |++
T Consensus       156 ~~~~~r~fa~~lA~~l~~~~P~~~t~~~~k~~R~grvfiDylqN~~  201 (228)
T cd04864         156 DFDDVRAFAAEAADALAKRDPDLLTTEARKAKRGDRVFLDIGRNAY  201 (228)
T ss_pred             CHHHHHHHHHHHHHHHHHHCchhhhHHhhHHhCCCcEEEECccCCC
Confidence            357789999999999999999998887777777789999998 665


No 163
>PRK10086 DNA-binding transcriptional regulator DsdC; Provisional
Probab=31.75  E-value=77  Score=21.59  Aligned_cols=28  Identities=7%  Similarity=0.160  Sum_probs=23.6

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEecC
Q psy15302         25 GVRDFLAQHYVPLKQANPKFPILVRECS   52 (68)
Q Consensus        25 G~R~Fl~~~l~~~~~~NP~v~i~v~~~~   52 (68)
                      -...++...+..|.+.+|++.|.+....
T Consensus       112 ~~~~~l~~~l~~f~~~~P~i~i~~~~~~  139 (311)
T PRK10086        112 IAQCWLVPRLADFTRRYPSISLTILTGN  139 (311)
T ss_pred             HHHHHHHHHHHHHHHHCCCeEEEEEeCC
Confidence            3557888999999999999999998643


No 164
>KOG3170|consensus
Probab=31.69  E-value=1.2e+02  Score=21.41  Aligned_cols=33  Identities=12%  Similarity=0.164  Sum_probs=26.8

Q ss_pred             CHHHHHHHHhCHHHHHHhCCCCeEEEEecCCCC
Q psy15302         23 SSGVRDFLAQHYVPLKQANPKFPILVRECSGVT   55 (68)
Q Consensus        23 S~G~R~Fl~~~l~~~~~~NP~v~i~v~~~~~~~   55 (68)
                      |...=..|...+..++.+.|++.|+--+...+-
T Consensus       122 gvp~c~Ll~~~l~~la~kfp~iKFVki~at~cI  154 (240)
T KOG3170|consen  122 GVPLCALLSHHLQSLACKFPQIKFVKIPATTCI  154 (240)
T ss_pred             ccHHHHHHHHHHHHHhhcCCcceEEeccccccc
Confidence            456677889999999999999999987665443


No 165
>KOG0863|consensus
Probab=31.67  E-value=23  Score=25.22  Aligned_cols=24  Identities=21%  Similarity=0.538  Sum_probs=20.2

Q ss_pred             CCCCHHHHHHHHhCHHHHHHhCCC
Q psy15302         20 GGSSSGVRDFLAQHYVPLKQANPK   43 (68)
Q Consensus        20 ~~sS~G~R~Fl~~~l~~~~~~NP~   43 (68)
                      |--|++.|.||+.++.+|-+.+|.
T Consensus       162 GsRSQsARTyLEr~~e~f~~~~~e  185 (264)
T KOG0863|consen  162 GSRSQSARTYLERNLEEFEDSSPE  185 (264)
T ss_pred             ccchhhHHHHHHHHHHHHhcCCHH
Confidence            446899999999999999887764


No 166
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily. This CD includes predicted proteins with rhodanese-like domains found N-terminal of the metallo-beta-lactamase domain.
Probab=31.65  E-value=67  Score=18.08  Aligned_cols=20  Identities=40%  Similarity=0.484  Sum_probs=14.3

Q ss_pred             EEEEecCCCCCCHHHHHHHH
Q psy15302         12 LRIHLCQKGGSSSGVRDFLA   31 (68)
Q Consensus        12 l~~~yc~~~~sS~G~R~Fl~   31 (68)
                      -.+.||..|..|.-+-..|.
T Consensus        63 ~ivv~C~~G~rs~~aa~~L~   82 (100)
T cd01523          63 EVTVICAKEGSSQFVAELLA   82 (100)
T ss_pred             eEEEEcCCCCcHHHHHHHHH
Confidence            35669999988876666654


No 167
>COG0187 GyrB Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit [DNA replication, recombination, and repair]
Probab=31.50  E-value=70  Score=25.65  Aligned_cols=39  Identities=13%  Similarity=-0.016  Sum_probs=30.2

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEecCCCCCEEEEEecCC
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVRECSGVTPVVWASGKGT   65 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~~~~~P~v~a~Y~nG   65 (68)
                      -+.|.+.+-++|-.||.|.|...-.+...+....+|.+|
T Consensus       186 ~~~l~~RlrelA~L~~gl~I~l~d~r~~~~~~~~~y~~G  224 (635)
T COG0187         186 YEILKRRLRELAFLNKGVKITLTDERTGEEKKEFHYEGG  224 (635)
T ss_pred             HHHHHHHHHHHhccCCCCEEEEEeccCCcccceeecccH
Confidence            467889999999999999999977665444335777766


No 168
>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain. Citramalate synthase (CMS) catalyzes the conversion of pyruvate and acetyl-CoA to (R)-citramalate in the first dedicated step of the citramalate pathway.  Citramalate is only found in Leptospira interrogans and a few other microorganisms.  This family belongs to the DRE-TIM metallolyase superfamily.  DRE-TIM metallolyases include 2-isopropylmalate synthase (IPMS), alpha-isopropylmalate synthase (LeuA), 3-hydroxy-3-methylglutaryl-CoA lyase, homocitrate synthase, citramalate synthase, 4-hydroxy-2-oxovalerate aldolase, re-citrate synthase, transcarboxylase 5S, pyruvate carboxylase, AksA, and FrbC.  These members all share a conserved  triose-phosphate isomerase (TIM) barrel domain consisting of a core beta(8)-alpha(8) motif with the eight parallel beta strands forming an enclosed barrel surrounded by eight alpha helices.  The domain has a catalytic center con
Probab=31.46  E-value=99  Score=21.66  Aligned_cols=34  Identities=18%  Similarity=0.077  Sum_probs=26.0

Q ss_pred             EEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEE
Q psy15302         13 RIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILV   48 (68)
Q Consensus        13 ~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v   48 (68)
                      +|.+||+.|....-+  +.+.+..+++..|+++|.+
T Consensus       163 ~i~l~DT~G~~~P~~--v~~l~~~l~~~~~~~~i~~  196 (280)
T cd07945         163 RIMLPDTLGILSPFE--TYTYISDMVKRYPNLHFDF  196 (280)
T ss_pred             EEEecCCCCCCCHHH--HHHHHHHHHhhCCCCeEEE
Confidence            588899988776654  5667777888888888765


No 169
>PF12876 Cellulase-like:  Sugar-binding cellulase-like;  InterPro: IPR024778 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. This entry represents a family of putative cellulase enzymes.; PDB: 3GYC_B.
Probab=31.23  E-value=50  Score=18.85  Aligned_cols=27  Identities=11%  Similarity=0.361  Sum_probs=20.4

Q ss_pred             CHHHHHHHHhCHHHHHHhCCCCeEEEE
Q psy15302         23 SSGVRDFLAQHYVPLKQANPKFPILVR   49 (68)
Q Consensus        23 S~G~R~Fl~~~l~~~~~~NP~v~i~v~   49 (68)
                      ..-+++++++-...+++.+|+.+|.+-
T Consensus        37 ~~~~~~~l~~~~~~iR~~dP~~pvt~g   63 (88)
T PF12876_consen   37 AEAYAEWLKEAFRWIRAVDPSQPVTSG   63 (88)
T ss_dssp             SHHHHHHHHHHHHHHHTT-TTS-EE--
T ss_pred             HHHHHHHHHHHHHHHHHhCCCCcEEee
Confidence            456889999999999999999998764


No 170
>PF01903 CbiX:  CbiX;  InterPro: IPR002762 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt. Cobalamin is usually found in one of two biologically active forms: methylcobalamin and adocobalamin. Most prokaryotes, as well as animals, have cobalamin-dependent enzymes, whereas plants and fungi do not appear to use it. In bacteria and archaea, these include methionine synthase, ribonucleotide reductase, glutamate and methylmalonyl-CoA mutases, ethanolamine ammonia lyase, and diol dehydratase []. In mammals, cobalamin is obtained through the diet, and is required for methionine synthase and methylmalonyl-CoA mutase [].  There are at least two distinct cobalamin biosynthetic pathways in bacteria []:  Aerobic pathway that requires oxygen and in which cobalt is inserted late in the pathway []; found in Pseudomonas denitrificans and Rhodobacter capsulatus. Anaerobic pathway in which cobalt insertion is the first committed step towards cobalamin synthesis []; found in Salmonella typhimurium, Bacillus megaterium, and Propionibacterium freudenreichii subsp. shermanii.   Either pathway can be divided into two parts: (1) corrin ring synthesis (differs in aerobic and anaerobic pathways) and (2) adenosylation of corrin ring, attachment of aminopropanol arm, and assembly of the nucleotide loop (common to both pathways) []. There are about 30 enzymes involved in either pathway, where those involved in the aerobic pathway are prefixed Cob and those of the anaerobic pathway Cbi. Several of these enzymes are pathway-specific: CbiD, CbiG, and CbiK are specific to the anaerobic route of S. typhimurium, whereas CobE, CobF, CobG, CobN, CobS, CobT, and CobW are unique to the aerobic pathway of P. denitrificans. This entry represents the CbiX protein, which functions as a cobalt-chelatase in the anaerobic biosynthesis of cobalamin. It catalyses the insertion of cobalt into sirohydrochlorin. The structure of CbiX from Archaeoglobus fulgidus consists of a central mixed beta-sheet flanked by four alpha-helices, although it is about half the size of other Class II tetrapyrrole chelatases []. The CbiX proteins found in archaea appear to be shorter than those found in eubacteria [].; GO: 0016829 lyase activity, 0046872 metal ion binding, 0009236 cobalamin biosynthetic process; PDB: 2XWQ_C 2DJ5_A 1TJN_A 2XWS_A 3LYH_B 2JH3_D.
Probab=31.15  E-value=14  Score=21.43  Aligned_cols=35  Identities=14%  Similarity=0.250  Sum_probs=25.2

Q ss_pred             HHHHHHHHhCHHHHHHhCCCCeEEEEecCCCCCEE
Q psy15302         24 SGVRDFLAQHYVPLKQANPKFPILVRECSGVTPVV   58 (68)
Q Consensus        24 ~G~R~Fl~~~l~~~~~~NP~v~i~v~~~~~~~P~v   58 (68)
                      .-++.=|.+.+...+..+|++.|.+-+.-|.||.|
T Consensus        65 ~h~~~DIp~~l~~~~~~~~~~~v~~~~pLG~~p~l   99 (105)
T PF01903_consen   65 YHVKRDIPEALAEARERHPGIEVRVAPPLGPHPLL   99 (105)
T ss_dssp             HHHHCHHHHHHCHHHHCSTTEEEEE---GGGSCCH
T ss_pred             cchHhHHHHHHHHHHhhCCceEEEECCCCCCCHHH
Confidence            44555566777889999999999998888888864


No 171
>PRK10341 DNA-binding transcriptional activator TdcA; Provisional
Probab=30.84  E-value=85  Score=21.33  Aligned_cols=37  Identities=14%  Similarity=0.113  Sum_probs=26.7

Q ss_pred             eEEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         10 KELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        10 k~l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ..|+|-.++.     -...++..-+..|.+.+|+++|.+...
T Consensus        97 ~~l~ig~~~~-----~~~~~l~~~l~~~~~~~p~v~i~~~~~  133 (312)
T PRK10341         97 VDVSFGFPSL-----IGFTFMSDMINKFKEVFPKAQVSMYEA  133 (312)
T ss_pred             eEEEEEechH-----HhHhhHHHHHHHHHHhCCCCEEEEEeC
Confidence            3466644322     234678899999999999999999754


No 172
>PLN02870 Probable galacturonosyltransferase
Probab=30.67  E-value=42  Score=26.27  Aligned_cols=25  Identities=24%  Similarity=0.484  Sum_probs=20.7

Q ss_pred             CcccccCcceEEEEEecCCCCCCHHHHHHHH
Q psy15302          1 MAARFGSKLKELRIHLCQKGGSSSGVRDFLA   31 (68)
Q Consensus         1 Ms~r~v~qlk~l~~~yc~~~~sS~G~R~Fl~   31 (68)
                      |-.+-.++++.|+++      +|+|+|+||+
T Consensus         1 ~~~~~~~~~~~~~~~------~~~~~~~~~~   25 (533)
T PLN02870          1 MQLHISPSMRSITIS------SSNGFIDLMK   25 (533)
T ss_pred             CceeecCccceEEEe------cCCcHHHHHH
Confidence            556777889999986      5899999996


No 173
>PF08073 CHDNT:  CHDNT (NUC034) domain;  InterPro: IPR012958 The CHD N-terminal domain is found in PHD/RING fingers and chromo domain-associated helicases [].; GO: 0003677 DNA binding, 0005524 ATP binding, 0008270 zinc ion binding, 0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=30.57  E-value=71  Score=17.64  Aligned_cols=22  Identities=32%  Similarity=0.449  Sum_probs=16.1

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeE
Q psy15302         25 GVRDFLAQHYVPLKQANPKFPI   46 (68)
Q Consensus        25 G~R~Fl~~~l~~~~~~NP~v~i   46 (68)
                      ..+.|-..-=|.++++||.++.
T Consensus        15 ~yK~Fsq~vRP~l~~~NPk~~~   36 (55)
T PF08073_consen   15 NYKAFSQHVRPLLAKANPKAPM   36 (55)
T ss_pred             HHHHHHHHHHHHHHHHCCCCcH
Confidence            3455666667899999998863


No 174
>PF14363 AAA_assoc:  Domain associated at C-terminal with AAA
Probab=30.30  E-value=82  Score=18.56  Aligned_cols=30  Identities=20%  Similarity=0.419  Sum_probs=24.0

Q ss_pred             HHHHHHHHhCHHH-HH-HhCCCCeEEEEecCC
Q psy15302         24 SGVRDFLAQHYVP-LK-QANPKFPILVRECSG   53 (68)
Q Consensus        24 ~G~R~Fl~~~l~~-~~-~~NP~v~i~v~~~~~   53 (68)
                      ..+|+|+.+.+.. |. .-+|.+.|.|.+..|
T Consensus         4 ~~lr~~~~~~~~~~~~~~~s~~~ti~I~E~~g   35 (98)
T PF14363_consen    4 HELRSYLRSLLRRLFSSRFSPYLTIVIPEFDG   35 (98)
T ss_pred             HHHHHHHHHHHHHHHhccCCCcEEEEEEeCCC
Confidence            4689999988865 55 788999999988765


No 175
>cd01388 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins. These proteins contain a single HMG box, and bind the minor groove of DNA in a highly sequence-specific manner. Members include SRY and its homologs in insects and vertebrates, and transcription factor-like proteins, TCF-1, -3, -4, and LEF-1. They appear to bind the minor groove of the A/T C A A A G/C-motif.
Probab=30.15  E-value=38  Score=18.55  Aligned_cols=19  Identities=21%  Similarity=0.064  Sum_probs=14.9

Q ss_pred             HHHHhCHHHHHHhCCCCeE
Q psy15302         28 DFLAQHYVPLKQANPKFPI   46 (68)
Q Consensus        28 ~Fl~~~l~~~~~~NP~v~i   46 (68)
                      -|+...-++++++||++.+
T Consensus        11 ~F~~~~r~~~~~~~p~~~~   29 (72)
T cd01388          11 LFSKRHRRKVLQEYPLKEN   29 (72)
T ss_pred             HHHHHHHHHHHHHCCCCCH
Confidence            3567788999999998753


No 176
>PRK13337 putative lipid kinase; Reviewed
Probab=29.79  E-value=1.3e+02  Score=20.83  Aligned_cols=42  Identities=17%  Similarity=0.094  Sum_probs=28.7

Q ss_pred             eEEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEecC
Q psy15302         10 KELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRECS   52 (68)
Q Consensus        10 k~l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~~~   52 (68)
                      +++.|-|++.+|+.++.+.+ .+-...+.+.+-++.++..+..
T Consensus         2 ~r~~~I~Np~aG~~~~~~~~-~~~~~~l~~~~~~~~~~~t~~~   43 (304)
T PRK13337          2 KRARIIYNPTSGRELFKKNL-PDVLQKLEQAGYETSAHATTGP   43 (304)
T ss_pred             ceEEEEECCcccchhHHHHH-HHHHHHHHHcCCEEEEEEecCC
Confidence            57889999999987776664 3345567777766666555443


No 177
>PRK12684 transcriptional regulator CysB-like protein; Reviewed
Probab=28.85  E-value=95  Score=21.19  Aligned_cols=29  Identities=17%  Similarity=0.190  Sum_probs=23.6

Q ss_pred             CHHHHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         23 SSGVRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        23 S~G~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ......++...+..|.+++|++.+.+...
T Consensus       101 ~~~~~~~l~~~l~~~~~~~p~i~l~~~~~  129 (313)
T PRK12684        101 HTQARYALPAAIKEFKKRYPKVRLSILQG  129 (313)
T ss_pred             hHHHHHHhHHHHHHHHHHCCCceEEEEeC
Confidence            34456778899999999999999999764


No 178
>TIGR02336 1,3-beta-galactosyl-N-acetylhexosamine phosphorylase. Members of this family are found in phylogenetically diverse bacteria, including Clostridium perfringens (in the Firmicutes), Bifidobacterium longum and Propionibacterium acnes (in the Actinobacteria), and Vibrio vulnificus (in the Proteobacteria), most of which occur as mammalian pathogens or commensals. The nominal activity, 1,3-beta-galactosyl-N-acetylhexosamine phosphorylase (EC 2.4.1.211), varies somewhat from instance to instance in relative rates for closely related substrates.
Probab=28.63  E-value=58  Score=26.45  Aligned_cols=27  Identities=7%  Similarity=0.176  Sum_probs=23.3

Q ss_pred             CHHHHHHHHhCHHHHHHhCCCCeEEEE
Q psy15302         23 SSGVRDFLAQHYVPLKQANPKFPILVR   49 (68)
Q Consensus        23 S~G~R~Fl~~~l~~~~~~NP~v~i~v~   49 (68)
                      -.-.|+|+...|.++-+.||++.++-.
T Consensus       184 ~p~t~~~~~~~l~~wl~~~p~~dVvRf  210 (719)
T TIGR02336       184 HPATRKHVFDTFEQWLKDSPQTDVVRF  210 (719)
T ss_pred             ChHHHHHHHHHHHHHHHhCCCCcEEEE
Confidence            456899999999999999999988643


No 179
>PRK15421 DNA-binding transcriptional regulator MetR; Provisional
Probab=28.62  E-value=84  Score=21.64  Aligned_cols=25  Identities=8%  Similarity=0.153  Sum_probs=21.9

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ..++...+.+|++.+|++.+.+...
T Consensus       101 ~~~l~~~l~~~~~~~P~i~l~~~~~  125 (317)
T PRK15421        101 IQWLTPALENFHKNWPQVEMDFKSG  125 (317)
T ss_pred             HHHHHHHHHHHHHHCCCceEEEEeC
Confidence            4688889999999999999999764


No 180
>PF13552 DUF4127:  Protein of unknown function (DUF4127)
Probab=28.49  E-value=53  Score=25.08  Aligned_cols=19  Identities=32%  Similarity=0.511  Sum_probs=16.9

Q ss_pred             hCHHHHHHhCCCCeEEEEe
Q psy15302         32 QHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        32 ~~l~~~~~~NP~v~i~v~~   50 (68)
                      +.+-+|+++||+++|++..
T Consensus        92 ~~l~~lk~~~p~~~iyaf~  110 (497)
T PF13552_consen   92 ERLRELKARNPNLPIYAFS  110 (497)
T ss_pred             HHHHHHHHHCCCCeEEEEE
Confidence            6789999999999999854


No 181
>PRK11013 DNA-binding transcriptional regulator LysR; Provisional
Probab=28.40  E-value=97  Score=21.01  Aligned_cols=26  Identities=12%  Similarity=0.201  Sum_probs=22.4

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEecC
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVRECS   52 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~~   52 (68)
                      ..++...+.+|.+.+|++.|.+....
T Consensus       106 ~~~l~~~l~~~~~~~P~v~i~i~~~~  131 (309)
T PRK11013        106 QSLLPGLCQPFLARYPDVSLNIVPQE  131 (309)
T ss_pred             HhhHHHHHHHHHHHCCCCeEEEEeCC
Confidence            45778999999999999999998654


No 182
>PRK11914 diacylglycerol kinase; Reviewed
Probab=28.18  E-value=1e+02  Score=21.22  Aligned_cols=41  Identities=7%  Similarity=0.090  Sum_probs=28.3

Q ss_pred             cceEEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEE
Q psy15302          8 KLKELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVR   49 (68)
Q Consensus         8 qlk~l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~   49 (68)
                      +-+++.|-|++.+|+.++.+.+ ++-...+++.+.++.+...
T Consensus         7 ~~~~~~iI~NP~sG~g~~~~~~-~~~~~~l~~~g~~~~~~~t   47 (306)
T PRK11914          7 EIGKVTVLTNPLSGHGAAPHAA-ERAIARLHHRGVDVVEIVG   47 (306)
T ss_pred             CCceEEEEECCCCCCCcHHHHH-HHHHHHHHHcCCeEEEEEe
Confidence            3478899999999987766554 3334567777776665444


No 183
>KOG3239|consensus
Probab=28.09  E-value=31  Score=23.56  Aligned_cols=26  Identities=19%  Similarity=0.391  Sum_probs=21.6

Q ss_pred             EEEEecCCCCCCHHHHHHHHhCHHHH
Q psy15302         12 LRIHLCQKGGSSSGVRDFLAQHYVPL   37 (68)
Q Consensus        12 l~~~yc~~~~sS~G~R~Fl~~~l~~~   37 (68)
                      |-..||+.+|.-+--|.||..|.|++
T Consensus        20 lP~EYCEf~~~~~kCk~WL~~n~pdl   45 (193)
T KOG3239|consen   20 LPPEYCEFSGDLKKCKEWLEENHPDL   45 (193)
T ss_pred             CCHHHHHccccHHHHHHHHHhcChhH
Confidence            34568999999999999999887765


No 184
>cd00552 RaiA RaiA ("ribosome-associated inhibitor A", also known as Protein Y (PY), YfiA, and SpotY,  is a stress-response protein that binds the ribosomal subunit interface and arrests translation by interfering with aminoacyl-tRNA binding to the ribosomal A site.  RaiA is also thought to counteract miscoding at the A site thus reducing translation errors. The RaiA fold structurally resembles the double-stranded RNA-binding domain (dsRBD).
Probab=28.08  E-value=78  Score=17.79  Aligned_cols=25  Identities=8%  Similarity=0.222  Sum_probs=20.2

Q ss_pred             CCCCHHHHHHHHhCHHHHHHhCCCC
Q psy15302         20 GGSSSGVRDFLAQHYVPLKQANPKF   44 (68)
Q Consensus        20 ~~sS~G~R~Fl~~~l~~~~~~NP~v   44 (68)
                      =..|..+++|+++.+..+.+-.+++
T Consensus         9 ~~~t~al~~~i~~k~~kl~r~~~~i   33 (93)
T cd00552           9 IEVTDALREYVEEKLEKLEKYFDRI   33 (93)
T ss_pred             ccCCHHHHHHHHHHHHHHHHhcCCC
Confidence            3458999999999888888888644


No 185
>PF00505 HMG_box:  HMG (high mobility group) box;  InterPro: IPR000910 High mobility group (HMG or HMGB) proteins are a family of relatively low molecular weight non-histone components in chromatin. HMG1 (also called HMG-T in fish) and HMG2 are two highly related proteins that bind single-stranded DNA preferentially and unwind double-stranded DNA. Although they have no sequence specificity, they have a high affinity for bent or distorted DNA, and bend linear DNA. HMG1 and HMG2 contain two DNA-binding HMG-box domains (A and B) that show structural and functional differences, and have a long acidic C-terminal domain rich in aspartic and glutamic acid residues. The acidic tail modulates the affinity of the tandem HMG boxes in HMG1 and 2 for a variety of DNA targets. HMG1 and 2 appear to play important architectural roles in the assembly of nucleoprotein complexes in a variety of biological processes, for example V(D)J recombination, the initiation of transcription, and DNA repair []. The profile in this entry describing the HMG-domains is much more general than the signature. In addition to the HMG1 and HMG2 proteins, HMG-domains occur in single or multiple copies in the following protein classes; the SOX family of transcription factors; SRY sex determining region Y protein and related proteins []; LEF1 lymphoid enhancer binding factor 1 []; SSRP recombination signal recognition protein; MTF1 mitochondrial transcription factor 1; UBF1/2 nucleolar transcription factors; Abf2 yeast ARS-binding factor []; and Saccharomyces cerevisiae transcription factors Ixr1, Rox1, Nhp6a, Nhp6b and Spp41.; GO: 0003677 DNA binding; PDB: 1I11_A 1J3C_A 1J3D_A 1WZ6_A 1WGF_A 2D7L_A 1GT0_D 3U2B_C 2CRJ_A 2CS1_A ....
Probab=27.69  E-value=52  Score=17.30  Aligned_cols=18  Identities=28%  Similarity=0.451  Sum_probs=15.0

Q ss_pred             HHHHhCHHHHHHhCCCCe
Q psy15302         28 DFLAQHYVPLKQANPKFP   45 (68)
Q Consensus        28 ~Fl~~~l~~~~~~NP~v~   45 (68)
                      -|..+....+++.||+..
T Consensus        10 lf~~~~~~~~k~~~p~~~   27 (69)
T PF00505_consen   10 LFCKEKRAKLKEENPDLS   27 (69)
T ss_dssp             HHHHHHHHHHHHHSTTST
T ss_pred             HHHHHHHHHHHHHhcccc
Confidence            466788999999999875


No 186
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains. Yeast complementation studies show that ERp46 can substitute for protein disulfide isomerase (PDI) function in vivo. It has been detected in many tissues, however, transcript and protein levels do not correlate in all tissues, suggesting regulation at a posttranscriptional level. An identical protein, named endoPDI, has been identified as an endothelial PDI that is highly expressed in the endothelium of tumors and hypoxic lesions. It has a protective effect on cells exposed to hypoxia.
Probab=27.65  E-value=79  Score=17.43  Aligned_cols=40  Identities=13%  Similarity=0.092  Sum_probs=27.8

Q ss_pred             EEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         11 ELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        11 ~l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      -|...|-+|.+.++.+..-+.+...+++..+|.+.+..-.
T Consensus        19 ~lv~f~a~wC~~C~~~~p~~~~~~~~~~~~~~~~~~~~vd   58 (102)
T cd03005          19 HFVKFFAPWCGHCKRLAPTWEQLAKKFNNENPSVKIAKVD   58 (102)
T ss_pred             EEEEEECCCCHHHHHhCHHHHHHHHHHhccCCcEEEEEEE
Confidence            5777888888888888776666556665555667666543


No 187
>TIGR02424 TF_pcaQ pca operon transcription factor PcaQ. Members of this family are LysR-family transcription factors associated with operons for catabolism of protocatechuate. Members occur only in Proteobacteria.
Probab=27.40  E-value=1.1e+02  Score=20.49  Aligned_cols=28  Identities=4%  Similarity=0.108  Sum_probs=23.5

Q ss_pred             HHHHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         24 SGVRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        24 ~G~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      .-...++...+..|.+++|++.|.+...
T Consensus       102 ~~~~~~~~~~l~~~~~~~P~~~i~~~~~  129 (300)
T TIGR02424       102 TVAARLMPEVVKRFLARAPRLRVRIMTG  129 (300)
T ss_pred             HHHHhhhHHHHHHHHHhCCCcEEEEEeC
Confidence            3456778899999999999999999863


No 188
>TIGR03418 chol_sulf_TF putative choline sulfate-utilization transcription factor. Members of this protein family are transcription factors of the LysR family. Their genes typically are divergently transcribed from choline-sulfatase genes. That enzyme makes choline, a precursor to the osmoprotectant glycine-betaine, available by hydrolysis of choline sulfate.
Probab=27.38  E-value=86  Score=20.81  Aligned_cols=26  Identities=15%  Similarity=0.217  Sum_probs=22.2

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEecC
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVRECS   52 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~~   52 (68)
                      ..++...+.+|.+++|++.|.+....
T Consensus       101 ~~~l~~~l~~~~~~~p~i~i~~~~~~  126 (291)
T TIGR03418       101 TYWLMPRLHRFKRAMPDVDVSLVTSQ  126 (291)
T ss_pred             HHHHhhhhHHHHHhCCCceEEEEecC
Confidence            47788889999999999999997643


No 189
>PF02886 LBP_BPI_CETP_C:  LBP / BPI / CETP family, C-terminal domain;  InterPro: IPR001124 This entry represents the C-terminal domain found in several lipid-binding serum glycoproteins. The N- and C-terminal domains share a similar two-layer alpha/beta structure, but they show little sequence identity. Proteins containing this C-terminal domain include:   Bactericidal permeability-increasing protein (BPI) Lipopolysaccharide-binding protein (LBP) Cholesteryl ester transfer protein (CETP) Phospholipid transfer protein (PLTP) Palate, lung and nasal epithelium carcinoma-associated protein (PLUNC)    Bactericidal permeability-increasing protein (BPI) is a potent antimicrobial protein of 456 residues that binds to and neutralises lipopolysaccharides from the outer membrane of Gram-negative bacteria []. BPI contains two domains that adopt the same structural fold, even though they have little sequence similarity [].   Lipopolysaccharide-binding protein (LBP) is an endotoxin-binding protein that is closely related to, and functions in a co-ordinated manner with BPI to facilitate an integrated host response to invading Gram-negative bacteria []. Cholesteryl ester transfer protein (CETP) is a glycoprotein that facilitates the transfer of lipids (cholesteryl esters and triglycerides) between the different lipoproteins that transport them through plasma, including HDL, LDL, VLDL and chylomicrons. These lipoproteins shield the lipids from water by encapsulating them within a coating of polar lipids and proteins [].  Phospholipid transfer protein (PLTP) exchanges phospholipids between lipoproteins and remodels high-density lipoproteins (HDLs) []. Palate, lung and nasal epithelium carcinoma-associated protein (PLUNC) is a potential host defensive protein that is secreted from the submucosal gland to the saliva and nasal lavage fluid. PLUNC aapears to be a secreted product of neutrophil granules that participates in an aspect of the inflammatory response that contributes to host defence []. Short palate, lung and nasal epithelium clone 1 (SPLUNC1) may bind the lipopolysaccharide of Gram-negative nanobacteria, thereby playing an important role in the host defence of nasopharyngeal epithelium [].; GO: 0008289 lipid binding; PDB: 2OBD_A 1EWF_A 1BP1_A.
Probab=27.25  E-value=48  Score=22.02  Aligned_cols=33  Identities=24%  Similarity=0.271  Sum_probs=24.1

Q ss_pred             HHHhCHHHHHHhCCCCeEEEEecCCCCCEEEEE
Q psy15302         29 FLAQHYVPLKQANPKFPILVRECSGVTPVVWAS   61 (68)
Q Consensus        29 Fl~~~l~~~~~~NP~v~i~v~~~~~~~P~v~a~   61 (68)
                      .+..-+|+++++.|+-++.++-.....|.+...
T Consensus        80 ~~g~~iP~l~~~yPn~~~~l~i~~~~~P~v~~~  112 (238)
T PF02886_consen   80 CIGDLIPELAKKYPNSPVELKIRSTKPPVVTIS  112 (238)
T ss_dssp             CCCTCCCCHHHCSCC-CEEEEEEESS--EEEEE
T ss_pred             cHHhhhhhHHhcCCCCeEEEEEEeCCCCEEEEE
Confidence            345688999999999888888877789988753


No 190
>TIGR03851 chitin_NgcE carbohydrate ABC transporter, N-acetylglucosamine/diacetylchitobiose-binding protein. Members of this protein family are the substrate-binding protein, a lipid-anchored protein of Gram-positive bacteria in all examples found so far, that include NgcE of the chitin-degrader, Streptomyces olivaceoviridis, and close homologs from other species likely to share the same function. NgcE binds both N-acetylglucosamine and the chitin dimer, N,N'-diacetylchitobiose.
Probab=27.23  E-value=81  Score=22.64  Aligned_cols=24  Identities=17%  Similarity=0.170  Sum_probs=20.2

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      -++++....+|.++||+|.|.+..
T Consensus        53 ~~~~~~~~~~F~~~~p~i~V~~~~   76 (450)
T TIGR03851        53 DDYAKDAEPLYKKKYPGATVKVSP   76 (450)
T ss_pred             HHHHHHHHHHHHHHCCCcEEEEee
Confidence            357788889999999999998864


No 191
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1. This protein is homologous to a family of proteins that includes thioredoxins, glutaredoxins, protein-disulfide isomerases, and others, some of which have several such domains. The sequence of this protein at the redox-active disufide site, CPYC, matches glutaredoxins rather than thioredoxins, although its overall sequence seems closer to thioredoxins. It is suggested to be a ribonucleotide-reducing system component distinct from thioredoxin or glutaredoxin.
Probab=27.20  E-value=1.1e+02  Score=16.21  Aligned_cols=27  Identities=0%  Similarity=0.049  Sum_probs=21.8

Q ss_pred             EEEEEecCCCCCCHHHHHHHHhCHHHH
Q psy15302         11 ELRIHLCQKGGSSSGVRDFLAQHYVPL   37 (68)
Q Consensus        11 ~l~~~yc~~~~sS~G~R~Fl~~~l~~~   37 (68)
                      .|.+.+.+|.+.++-+...+++...++
T Consensus         2 ~v~~f~~~~C~~C~~~~~~l~~l~~~~   28 (82)
T TIGR00411         2 KIELFTSPTCPYCPAAKRVVEEVAKEM   28 (82)
T ss_pred             EEEEEECCCCcchHHHHHHHHHHHHHh
Confidence            578889999999999999887655444


No 192
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins such as ribonucleotide reductase. It contains a redox active CXXC motif in a TRX fold and uses a similar dithiol mechanism employed by TRXs for intramolecular disulfide bond reduction of protein substrates. Unlike TRX, GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. The flow of reducing equivalents in the GRX system goes from NADPH - GSH reductase - GSH - GRX - protein substrates. By altering the redox state of target proteins, GRX is involved in many cellular functions including DNA synthesis, signal transduction and the defense against oxidative stress. Different classes are known including human GRX1 and GRX2, as well as E. coli GRX1 and GRX3, which 
Probab=27.12  E-value=68  Score=16.11  Aligned_cols=21  Identities=5%  Similarity=0.012  Sum_probs=15.6

Q ss_pred             EEEEecCCCCCCHHHHHHHHh
Q psy15302         12 LRIHLCQKGGSSSGVRDFLAQ   32 (68)
Q Consensus        12 l~~~yc~~~~sS~G~R~Fl~~   32 (68)
                      |++..-++.+.++.++.+|.+
T Consensus         2 v~ly~~~~Cp~C~~~~~~L~~   22 (72)
T cd02066           2 VVVFSKSTCPYCKRAKRLLES   22 (72)
T ss_pred             EEEEECCCCHHHHHHHHHHHH
Confidence            456666778888888888864


No 193
>TIGR03850 bind_CPR_0540 carbohydrate ABC transporter substrate-binding protein, CPR_0540 family. Members of this protein are the substrate-binding protein of a predicted carbohydrate transporter operon, together with permease subunits of ABC transporter homology families. This substrate-binding protein frequently co-occurs in genomes with a family of disaccharide phosphorylases, TIGR02336, suggesting that the molecule transported will include beta-D-galactopyranosyl-(1-3)-N-acetyl-D-glucosamine and related carbohydrates. Members of this family are sporadically strain by strain, often in species with a human host association, including Propionibacterium acnes and Clostridium perfringens, and Bacillus cereus.
Probab=26.89  E-value=1.2e+02  Score=21.42  Aligned_cols=25  Identities=0%  Similarity=0.045  Sum_probs=20.6

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      .+.++..+.+|.++||+|.|.+...
T Consensus        47 ~~~~~~~~~~F~~~~~~i~V~~~~~   71 (437)
T TIGR03850        47 TKMWEEVVEAFEKSHEGVKVELTVS   71 (437)
T ss_pred             HHHHHHHHHHHHHHCCCceEEEEeC
Confidence            3567788889999999999998653


No 194
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile. In vitro, it displays protein disulfide reductase activity that is dependent on TRX reductase, not glutathione (GSH). It is part of the NrdHIEF operon, where NrdEF codes for class Ib ribonucleotide reductase (RNR-Ib), an efficient enzyme at low oxygen levels. Under these conditions when GSH is mostly conjugated to spermidine, NrdH can still function and act as a hydrogen donor for RNR-Ib. It has been suggested that the NrdHEF system may be the oldest RNR reducing system, capable of functioning in a microaerophilic environment, where GSH was not yet available. NrdH from Corynebacterium ammoniagenes can form domain-swapped dimers, although it is unknown if this happens in vivo. Domain-swapped dimerization, which results in the blocking of the TRX reductase binding site, cou
Probab=26.87  E-value=75  Score=16.10  Aligned_cols=21  Identities=10%  Similarity=0.140  Sum_probs=16.1

Q ss_pred             EEEEecCCCCCCHHHHHHHHh
Q psy15302         12 LRIHLCQKGGSSSGVRDFLAQ   32 (68)
Q Consensus        12 l~~~yc~~~~sS~G~R~Fl~~   32 (68)
                      +++.+..+++.+.-++.++.+
T Consensus         2 v~l~~~~~c~~c~~~~~~l~~   22 (73)
T cd02976           2 VTVYTKPDCPYCKATKRFLDE   22 (73)
T ss_pred             EEEEeCCCChhHHHHHHHHHH
Confidence            567777788888888888854


No 195
>PRK11233 nitrogen assimilation transcriptional regulator; Provisional
Probab=26.58  E-value=1.3e+02  Score=20.32  Aligned_cols=26  Identities=8%  Similarity=0.143  Sum_probs=22.0

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      .+.++...+.+|.+.+|++.+.+...
T Consensus       103 ~~~~~~~~l~~~~~~~p~i~l~~~~~  128 (305)
T PRK11233        103 ASSLTMPLLQAVRAEFPGIVLYLHEN  128 (305)
T ss_pred             hHHHHHHHHHHHHHHCCCcEEEEEEC
Confidence            46777888999999999999988754


No 196
>PLN02495 oxidoreductase, acting on the CH-CH group of donors
Probab=26.51  E-value=80  Score=23.47  Aligned_cols=28  Identities=21%  Similarity=0.322  Sum_probs=23.3

Q ss_pred             CCHHHHHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         22 SSSGVRDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        22 sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      |..|+..|++. ++.++++.|++++.+.-
T Consensus        93 s~~g~~~~l~~-i~~~k~~~~~~pvIaSi  120 (385)
T PLN02495         93 SDRPFETMLAE-FKQLKEEYPDRILIASI  120 (385)
T ss_pred             cccCHHHHHHH-HHHHHhhCCCCcEEEEc
Confidence            45689999987 78899899998888765


No 197
>PF09508 Lact_bio_phlase:  Lacto-N-biose phosphorylase;  InterPro: IPR012711  The gene which codes for this protein in gut-bacteria is located in a novel putative operon for galactose metabolism. The protein appears to be a carbohydrate-processing phosphorolytic enzyme (2.4.1.211 from EC), unlike either glycoside hydrolases or glycoside lyase. Intestinal colonisation by Bifidobacteria is important for human health, especially in paediatrics, because colonisation seems to prevent infection by some pathogenic bacteria that cause diarrhoea or other illnesses. The operon seems to be involved in intestinal colonisation by Bifidobacteria mediated by metabolism of mucin sugars. In addition, it may also resolve the question of the nature of the bifidus factor in human milk as the lacto-N-biose structure found in milk oligosaccharides. ; GO: 0016758 transferase activity, transferring hexosyl groups; PDB: 2ZUW_A 2ZUU_C 2ZUT_D 2ZUV_A 2ZUS_B.
Probab=26.49  E-value=59  Score=26.39  Aligned_cols=28  Identities=7%  Similarity=0.189  Sum_probs=21.0

Q ss_pred             CCHHHHHHHHhCHHHHHHhCCCCeEEEE
Q psy15302         22 SSSGVRDFLAQHYVPLKQANPKFPILVR   49 (68)
Q Consensus        22 sS~G~R~Fl~~~l~~~~~~NP~v~i~v~   49 (68)
                      --.-.|+|+.+.|.++-+.||++.++-.
T Consensus       180 r~p~t~~~~~~~L~~wl~~hP~~dVVRF  207 (716)
T PF09508_consen  180 RQPKTREYVLEWLRKWLEEHPDTDVVRF  207 (716)
T ss_dssp             TSHHHHHHHHHHHHHHHHT-TT--EEEE
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCCcEEEe
Confidence            3457899999999999999999988643


No 198
>PF00781 DAGK_cat:  Diacylglycerol kinase catalytic domain;  InterPro: IPR001206  The DAG-kinase catalytic domain or DAGKc domain is present in mammalian lipid kinases, such as diacylglycerol (DAG), ceramide and sphingosine kinases, as well as in related bacterial proteins [, ]. Eukaryotic DAG-kinase (2.7.1.107 from EC) catalyses the phosphorylation of DAG to phosphatidic acid, thus modulating the balance between the two signaling lipids. At least ten different isoforms have been identified in mammals, which form 5 groups characterised by different functional domains, such as the calcium-binding EF hand (see PDOC00018 from PROSITEDOC), PH (see PDOC50003 from PROSITEDOC), SAM (see PDOC50105 from PROSITEDOC) , DAG/PE-binding C1 domain (see PDOC00379 from PROSITEDOC) and ankyrin repeats (see PDOC50088 from PROSITEDOC) [].   In bacteria, an integral membrane DAG kinase forms a homotrimeric protein that lacks the DAGKc domain (see PDOC00820 from PROSITEDOC). In contrast, the bacterial yegS protein is a soluble cytosolic protein that contains the DAGKc domain in the N-terminal part. YegS is a lipid kinase with two structural domains, wherein the active site is located in the interdomain cleft, C-terminal to the DAGKc domain which forms an alpha/beta fold []. The tertiary structure resembles that of NAD kinases and contains a metal-binding site in the C-terminal region [, ].   This domain is usually associated with an accessory domain (see IPR000756 from INTERPRO).; GO: 0004143 diacylglycerol kinase activity, 0007205 activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway; PDB: 2JGR_A 2BON_A 3T5P_D 3S40_A 2P1R_A 2QV7_A 2QVL_A.
Probab=26.32  E-value=1.4e+02  Score=17.85  Aligned_cols=38  Identities=13%  Similarity=0.264  Sum_probs=27.3

Q ss_pred             EEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         11 ELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        11 ~l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ++-|.+.+.+|+.++.  | ++-.+.++.....+.+...+.
T Consensus         1 k~~vi~Np~sG~~~~~--~-~~v~~~l~~~~~~~~~~~t~~   38 (130)
T PF00781_consen    1 KVLVIINPKSGGGRAK--W-KKVEPALRAAGIDYEVIETES   38 (130)
T ss_dssp             SEEEEEETTSTTSHHH--H-HHHHHHHHHTTCEEEEEEESS
T ss_pred             CEEEEECCCCCCCchh--H-HHHHHHHHHcCCceEEEEEec
Confidence            4678899999988888  4 666677777776666655443


No 199
>PRK10216 DNA-binding transcriptional regulator YidZ; Provisional
Probab=26.27  E-value=1.1e+02  Score=20.90  Aligned_cols=26  Identities=19%  Similarity=0.148  Sum_probs=22.9

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      .-.++..-+..|++.+|++.|.+...
T Consensus       108 ~~~~~~~~l~~f~~~~P~v~v~i~~~  133 (319)
T PRK10216        108 MMIMLNALSKRIYQRYPQATIKLRNW  133 (319)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEeC
Confidence            45788999999999999999999863


No 200
>PRK15092 DNA-binding transcriptional repressor LrhA; Provisional
Probab=25.90  E-value=1.3e+02  Score=20.76  Aligned_cols=27  Identities=19%  Similarity=0.156  Sum_probs=22.9

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         25 GVRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        25 G~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      -...++...+.+|.+++|++.|.+...
T Consensus       109 ~~~~~l~~~l~~f~~~~P~i~i~l~~~  135 (310)
T PRK15092        109 TADTILPFLLNRVSSVYPKLALDVRVK  135 (310)
T ss_pred             HHHHHHHHHHHHHHHHCCCcEEEEEEC
Confidence            356788899999999999999988753


No 201
>PF01624 MutS_I:  MutS domain I C-terminus.;  InterPro: IPR007695 Mismatch repair contributes to the overall fidelity of DNA replication and is essential for combating the adverse effects of damage to the genome. It involves the correction of mismatched base pairs that have been missed by the proofreading element of the DNA polymerase complex. The post-replicative Mismatch Repair System (MMRS) of Escherichia coli involves MutS (Mutator S), MutL and MutH proteins, and acts to correct point mutations or small insertion/deletion loops produced during DNA replication []. MutS and MutL are involved in preventing recombination between partially homologous DNA sequences. The assembly of MMRS is initiated by MutS, which recognises and binds to mispaired nucleotides and allows further action of MutL and MutH to eliminate a portion of newly synthesized DNA strand containing the mispaired base []. MutS can also collaborate with methyltransferases in the repair of O(6)-methylguanine damage, which would otherwise pair with thymine during replication to create an O(6)mG:T mismatch []. MutS exists as a dimer, where the two monomers have different conformations and form a heterodimer at the structural level []. Only one monomer recognises the mismatch specifically and has ADP bound. Non-specific major groove DNA-binding domains from both monomers embrace the DNA in a clamp-like structure. Mismatch binding induces ATP uptake and a conformational change in the MutS protein, resulting in a clamp that translocates on DNA.  MutS is a modular protein with a complex structure [], and is composed of:   N-terminal mismatch-recognition domain, which is similar in structure to tRNA endonuclease. Connector domain, which is similar in structure to Holliday junction resolvase ruvC. Core domain, which is composed of two separate subdomains that join together to form a helical bundle; from within the core domain, two helices act as levers that extend towards (but do not touch) the DNA. Clamp domain, which is inserted between the two subdomains of the core domain at the top of the lever helices; the clamp domain has a beta-sheet structure. ATPase domain (connected to the core domain), which has a classical Walker A motif. HTH (helix-turn-helix) domain, which is involved in dimer contacts.   The MutS family of proteins is named after the Salmonella typhimurium MutS protein involved in mismatch repair. Homologues of MutS have been found in many species including eukaryotes (MSH 1, 2, 3, 4, 5, and 6 proteins), archaea and bacteria, and together these proteins have been grouped into the MutS family. Although many of these proteins have similar activities to the E. coli MutS, there is significant diversity of function among the MutS family members. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein [].This diversity is even seen within species, where many species encode multiple MutS homologues with distinct functions []. Inter-species homologues may have arisen through frequent ancient horizontal gene transfer of MutS (and MutL) from bacteria to archaea and eukaryotes via endosymbiotic ancestors of mitochondria and chloroplasts [].  This entry represents the N-terminal domain of proteins in the MutS family of DNA mismatch repair proteins, as well as closely related proteins. The N-terminal domain of MutS is responsible for mismatch recognition and forms a 6-stranded mixed beta-sheet surrounded by three alpha-helices, which is similar to the structure of tRNA endonuclease. Yeast MSH3 [], bacterial proteins involved in DNA mismatch repair, and the predicted protein product of the Rep-3 gene of mouse share extensive sequence similarity. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein.; GO: 0005524 ATP binding, 0030983 mismatched DNA binding, 0006298 mismatch repair; PDB: 1FW6_A 1EWQ_A 1EWR_B 1NNE_B 3THY_B 3THZ_B 3THW_B 3THX_B 2WTU_A 1OH7_A ....
Probab=25.88  E-value=62  Score=19.27  Aligned_cols=21  Identities=29%  Similarity=0.379  Sum_probs=17.3

Q ss_pred             HhCHHHHHHhCCCCeEEEEec
Q psy15302         31 AQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        31 ~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      .+.|.++|+++|+.-+.++..
T Consensus         4 ~~~y~~lk~k~~d~i~lf~~G   24 (113)
T PF01624_consen    4 EQQYWELKEKYPDTIVLFQVG   24 (113)
T ss_dssp             HHHHHHHHCTSTTSEEEEEET
T ss_pred             HHHHHHHHhhCCCeEEEEEcC
Confidence            457889999999998888754


No 202
>PRK10324 translation inhibitor protein RaiA; Provisional
Probab=25.76  E-value=1.6e+02  Score=17.82  Aligned_cols=32  Identities=13%  Similarity=0.255  Sum_probs=24.4

Q ss_pred             EEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCC
Q psy15302         12 LRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKF   44 (68)
Q Consensus        12 l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v   44 (68)
                      |.|.+ .+-.-+..+|+++++.+..+.+-.|++
T Consensus         3 I~Itg-r~v~~tdalr~~ie~Kl~kL~k~~~~i   34 (113)
T PRK10324          3 MNITS-KQMEITPAIRQHVADRLAKLEKWQTHL   34 (113)
T ss_pred             EEEEE-EcCcCCHHHHHHHHHHHHHHHHhcCCC
Confidence            44444 444568999999999999998888754


No 203
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding. PfPDO contains two redox active CXXC motifs in two contiguous TRX-fold subdomains. The active site in the N-terminal TRX-fold subdomain is required for isomerase but not for reductase activity of PfPDO. The exclusive presence of PfPDO-like proteins in extremophiles may suggest that they have a special role in adaptation to extreme conditions.
Probab=25.73  E-value=1.5e+02  Score=17.46  Aligned_cols=36  Identities=11%  Similarity=0.189  Sum_probs=25.5

Q ss_pred             EEEEE-ecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         11 ELRIH-LCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        11 ~l~~~-yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      .+.+. +-+|.+.++-++.++++    +++.++.+++....
T Consensus        24 ~vvv~f~a~wC~~C~~~~~~l~~----la~~~~~i~~~~vd   60 (113)
T cd02975          24 DLVVFSSKEGCQYCEVTKQLLEE----LSELSDKLKLEIYD   60 (113)
T ss_pred             EEEEEeCCCCCCChHHHHHHHHH----HHHhcCceEEEEEe
Confidence            35555 45788999999988865    45556888777653


No 204
>TIGR01256 modA molybdenum ABC transporter, periplasmic molybdate-binding protein. The model describes the molybdate ABC transporter periplasmic binding protein in bacteria and archae. Several of the periplasmic receptors constitute a diverse class of binding proteins that differ widely in size, sequence and ligand specificity. It has been shown experimentally by radioactive labeling that ModA represent hydrophylioc periplasmic-binding protein in gram-negative organisms and its counterpart in gram-positive organisms is a lipoprotein. The other components of the system include the ModB, an integral membrane protein and ModC the ATP-binding subunit. Invariably almost all of them display a common beta/alpha folding motif and have similar tertiary structures consisting of two globular domains.
Probab=25.19  E-value=93  Score=19.86  Aligned_cols=25  Identities=8%  Similarity=0.050  Sum_probs=21.0

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         25 GVRDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        25 G~R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      |++.-+..-.+.|.+++| +.|.+..
T Consensus         3 ~l~~~~~~~~~~f~~~~g-i~V~~~~   27 (216)
T TIGR01256         3 SLTDALKEIAKQFEKRTG-NKVVFSF   27 (216)
T ss_pred             chHHHHHHHHHHHHHhhC-CeEEEEe
Confidence            678888899999999998 8887753


No 205
>PF13905 Thioredoxin_8:  Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A ....
Probab=25.12  E-value=62  Score=17.84  Aligned_cols=38  Identities=8%  Similarity=-0.044  Sum_probs=21.7

Q ss_pred             EEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         13 RIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        13 ~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ...+..|.+.|+....-|.+.+.++++ +.+++|+....
T Consensus         6 l~fwa~~c~~c~~~~~~l~~l~~~~~~-~~~v~~v~Vs~   43 (95)
T PF13905_consen    6 LYFWASWCPPCKKELPKLKELYKKYKK-KDDVEFVFVSL   43 (95)
T ss_dssp             EEEE-TTSHHHHHHHHHHHHHHHHHTT-TTTEEEEEEE-
T ss_pred             EEEECCCCHHHHHHHHHHHHHHHHhCC-CCCEEEEEEEe
Confidence            344555666566655555565555555 56888776543


No 206
>TIGR03339 phn_lysR aminoethylphosphonate catabolism associated LysR family transcriptional regulator. This group of sequences represents a number of related clades with numerous examples of members adjacent to operons for the degradation of 2-aminoethylphosphonate (AEP) in Pseudomonas, Ralstonia, Bordetella and Burkholderia species. These are transcriptional regulators of the LysR family which contain a helix-turn-helix (HTH) domain (pfam00126) and a periplasmic substrate-binding protein-like domain (pfam03466).
Probab=24.95  E-value=1.1e+02  Score=19.97  Aligned_cols=24  Identities=17%  Similarity=0.235  Sum_probs=20.5

Q ss_pred             HHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         28 DFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        28 ~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      .++...+.+|.+.+|++.+.+...
T Consensus        97 ~~~~~~l~~~~~~~p~v~l~i~~~  120 (279)
T TIGR03339        97 YYVLDLVARFRQRYPGIEVSVRIG  120 (279)
T ss_pred             HHHHHHHHHHHHHCCCcEEEEEEC
Confidence            367788899999999999999764


No 207
>COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism]
Probab=24.71  E-value=74  Score=19.62  Aligned_cols=23  Identities=13%  Similarity=0.124  Sum_probs=17.0

Q ss_pred             EEEEEecCCCCCCHHHHHHHHhC
Q psy15302         11 ELRIHLCQKGGSSSGVRDFLAQH   33 (68)
Q Consensus        11 ~l~~~yc~~~~sS~G~R~Fl~~~   33 (68)
                      .|+|...+..++|+-+++|++++
T Consensus         2 ~itiy~~p~C~t~rka~~~L~~~   24 (117)
T COG1393           2 MITIYGNPNCSTCRKALAWLEEH   24 (117)
T ss_pred             eEEEEeCCCChHHHHHHHHHHHc
Confidence            36677777777888888888654


No 208
>PF02669 KdpC:  K+-transporting ATPase, c chain;  InterPro: IPR003820 Kdp, the high affinity ATP-driven K+-transport system of Escherichia coli, is a complex of the membrane-bound subunits KdpA, KdpB, KdpC and the small peptide KdpF. KdpC forms strong interactions with the KdpA subunit, serving to assemble and stabilise the Kdp complex []. It has been suggested that KdpC could be one of the connecting links between the energy providing subunit KdpB and the K+- transporting subunit KdpA []. The K+ transport system actively transports K+ ions via ATP hydrolysis.; GO: 0008556 potassium-transporting ATPase activity, 0006813 potassium ion transport, 0016020 membrane
Probab=24.44  E-value=63  Score=21.94  Aligned_cols=44  Identities=23%  Similarity=0.431  Sum_probs=31.5

Q ss_pred             cCCCCCCHHHHHHHHhCHHHHHHhCCC----CeE--EEEecCCCCCEEEE
Q psy15302         17 CQKGGSSSGVRDFLAQHYVPLKQANPK----FPI--LVRECSGVTPVVWA   60 (68)
Q Consensus        17 c~~~~sS~G~R~Fl~~~l~~~~~~NP~----v~i--~v~~~~~~~P~v~a   60 (68)
                      ++-|+++.-+++=+++....+++.||.    ||.  ++...+|-+|.|.-
T Consensus        85 SNl~psn~~l~~~v~~~~~~~~~~~~~~~~~vP~dlvtaSgSGLDP~IS~  134 (188)
T PF02669_consen   85 SNLGPSNPELRERVEERIAALRKENPVAPSPVPADLVTASGSGLDPHISP  134 (188)
T ss_pred             ccCCCCChHHHHHHHHHHHHHHhhcccCCCCCCHHHHhcccccCCCCcCH
Confidence            356777888999999999999999843    222  33445677887754


No 209
>PRK11242 DNA-binding transcriptional regulator CynR; Provisional
Probab=24.40  E-value=1.1e+02  Score=20.24  Aligned_cols=26  Identities=12%  Similarity=0.213  Sum_probs=21.7

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ...++...+..|++++|++.|.+...
T Consensus       102 ~~~~l~~~l~~~~~~~p~~~i~~~~~  127 (296)
T PRK11242        102 TAYLIGPLIDAFHARYPGITLTIREM  127 (296)
T ss_pred             hhhhhHHHHHHHHHHCCCCEEEEEeC
Confidence            35677889999999999999999753


No 210
>TIGR00550 nadA quinolinate synthetase complex, A subunit. This protein, termed NadA, plays a role in the synthesis of pyridine, a precursor to NAD. The quinolinate synthetase complex consists of A protein (this protein) and B protein. B protein converts L-aspartate to iminoaspartate, an unstable reaction product which in the absence of A protein is spontaneously hydrolyzed to form oxaloacetate. The A protein, NadA, converts iminoaspartate to quinolate.
Probab=24.29  E-value=1.3e+02  Score=21.70  Aligned_cols=35  Identities=17%  Similarity=0.206  Sum_probs=28.0

Q ss_pred             EecCCCCCCHHHHHHHHhC-------------HHHHHHhCCCCeEEEE
Q psy15302         15 HLCQKGGSSSGVRDFLAQH-------------YVPLKQANPKFPILVR   49 (68)
Q Consensus        15 ~yc~~~~sS~G~R~Fl~~~-------------l~~~~~~NP~v~i~v~   49 (68)
                      ..+|.-|||.++-+|+++.             +-.+++++|+-.+..-
T Consensus       210 ~~aD~vgSTs~~i~~v~~~~~~~~ii~TE~~l~~~l~~~~p~k~~i~~  257 (310)
T TIGR00550       210 DLADFIGSTSQIIRFVLKSPAQKFIIGTEVGLVNRMEAESPDKNTIPL  257 (310)
T ss_pred             HhcCEEecHHHHHHHHHhCCCCeEEEEccHHHHHHHHHHCCCCeEEeC
Confidence            4678899999999999765             5578889999866554


No 211
>PF11943 DUF3460:  Protein of unknown function (DUF3460);  InterPro: IPR021853  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are about 70 amino acids in length. This protein has a conserved WDK sequence motif. 
Probab=24.20  E-value=49  Score=18.61  Aligned_cols=14  Identities=29%  Similarity=0.437  Sum_probs=10.8

Q ss_pred             hCHHHHHHhCCCCe
Q psy15302         32 QHYVPLKQANPKFP   45 (68)
Q Consensus        32 ~~l~~~~~~NP~v~   45 (68)
                      .-+.+++++||+++
T Consensus         9 qFl~~lk~~~Pele   22 (60)
T PF11943_consen    9 QFLNQLKAKHPELE   22 (60)
T ss_pred             HHHHHHHHhCCchH
Confidence            34668899999875


No 212
>PRK13055 putative lipid kinase; Reviewed
Probab=24.06  E-value=2.4e+02  Score=19.96  Aligned_cols=40  Identities=18%  Similarity=0.126  Sum_probs=27.9

Q ss_pred             eEEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         10 KELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        10 k~l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      +++.|-+++.+|+.++.+. +.+-...+++.+-++.+....
T Consensus         3 ~r~~iI~NP~sG~~~~~~~-~~~i~~~l~~~g~~~~i~~t~   42 (334)
T PRK13055          3 KRARLIYNPTSGQEIMKKN-VADILDILEQAGYETSAFQTT   42 (334)
T ss_pred             ceEEEEECCCCCchhHHHH-HHHHHHHHHHcCCeEEEEEee
Confidence            5788999999998776554 455556677777666665544


No 213
>PF08885 GSCFA:  GSCFA family;  InterPro: IPR014982 This group of proteins are functionally uncharacterised. They have been named GSCFA after a highly conserved N-terminal motif in the alignment, they are functionally uncharacterised. 
Probab=23.99  E-value=1.3e+02  Score=21.00  Aligned_cols=31  Identities=16%  Similarity=0.166  Sum_probs=23.8

Q ss_pred             CHHHHHHHHhCHHHHHHhCCCCeEEEEecCC
Q psy15302         23 SSGVRDFLAQHYVPLKQANPKFPILVRECSG   53 (68)
Q Consensus        23 S~G~R~Fl~~~l~~~~~~NP~v~i~v~~~~~   53 (68)
                      -.-+.+-++.-+..+++-||+++|++.-.+=
T Consensus       147 ~~ei~~~l~~~~~~l~~~nP~~kiilTVSPV  177 (251)
T PF08885_consen  147 VEEILEDLEAIIDLLRSINPDIKIILTVSPV  177 (251)
T ss_pred             HHHHHHHHHHHHHHHHhhCCCceEEEEeccc
Confidence            3445566677788899999999999877663


No 214
>PF09345 DUF1987:  Domain of unknown function (DUF1987);  InterPro: IPR018530  This family of proteins are functionally uncharacterised. 
Probab=23.71  E-value=1.4e+02  Score=18.04  Aligned_cols=36  Identities=14%  Similarity=0.159  Sum_probs=24.4

Q ss_pred             EEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEE
Q psy15302         11 ELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILV   48 (68)
Q Consensus        11 ~l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v   48 (68)
                      .+.|.|=++| ||+.+-+.++ .|.+.+++...|.|.=
T Consensus        48 ~~~L~YfNTS-Ssk~l~~i~~-~Le~~~~~g~~V~v~W   83 (99)
T PF09345_consen   48 NFKLSYFNTS-SSKALMDIFD-LLEDAAQKGGKVTVNW   83 (99)
T ss_pred             EEEEEEEecH-hHHHHHHHHH-HHHHHHhcCCcEEEEE
Confidence            3567776665 6777777664 5666677777777654


No 215
>PRK12682 transcriptional regulator CysB-like protein; Reviewed
Probab=23.71  E-value=1.3e+02  Score=20.34  Aligned_cols=26  Identities=15%  Similarity=0.286  Sum_probs=21.8

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ...++...+..|.+++|++.|.+...
T Consensus       104 ~~~~l~~~l~~~~~~~P~i~i~i~~~  129 (309)
T PRK12682        104 ARYVLPRVVAAFRKRYPKVNLSLHQG  129 (309)
T ss_pred             HHHHHHHHHHHHHHhCCCeEEEEecC
Confidence            35677888999999999999998754


No 216
>COG5575 ORC2 Origin recognition complex, subunit 2 [DNA replication, recombination, and repair]
Probab=23.70  E-value=62  Score=24.99  Aligned_cols=35  Identities=11%  Similarity=0.201  Sum_probs=26.6

Q ss_pred             cCCCCCCHH-HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         17 CQKGGSSSG-VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        17 c~~~~sS~G-~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      |.+-.+=+. +++||.+++.++++++..++|.-.+.
T Consensus       484 ~Sne~~~rSmL~EFidH~l~~i~rn~S~~eI~wvpy  519 (535)
T COG5575         484 LSNETSVRSMLNEFIDHGLLKIKRNGSEIEICWVPY  519 (535)
T ss_pred             hcCcHHHHHHHHHHHhcchhheeccCCccEEEEeec
Confidence            333333333 59999999999999999999887654


No 217
>cd08443 PBP2_CysB The C-terminal substrate domain of LysR-type transcriptional regulator CysB contains type 2 periplasmic binding fold. CysB is a transcriptional activator of genes involved in sulfate and thiosulfate transport, sulfate reduction, and cysteine synthesis. In Escherichia coli, the regulation of transcription in response to sulfur source is attributed to two transcriptional regulators, CysB and Cbl. CysB, in association with Cbl, downregulates the expression of ssuEADCB operon which is required for the utilization of sulfur from aliphatic sulfonates, in the presence of cysteine. Also, Cbl and CysB together directly function as transcriptional activators of tauABCD genes, which are required for utilization of taurine as sulfur source for growth. Like many other members of the LTTR family, CysB is composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding speci
Probab=23.56  E-value=54  Score=19.81  Aligned_cols=25  Identities=12%  Similarity=0.183  Sum_probs=19.7

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ..++...+..|.+.+|++.+.+...
T Consensus        12 ~~~l~~~l~~f~~~~P~~~i~i~~~   36 (198)
T cd08443          12 RYVLPPVIKGFIERYPRVSLQMHQG   36 (198)
T ss_pred             eeECcHHHHHHHHHCCCeEEEEEeC
Confidence            3456778889999999999988753


No 218
>PRK10680 molybdopterin biosynthesis protein MoeA; Provisional
Probab=23.56  E-value=64  Score=23.98  Aligned_cols=39  Identities=21%  Similarity=0.319  Sum_probs=27.8

Q ss_pred             CCCCCHHHHHHHHhCHHHHHHhCCCCeEE-EEecCCCCCEEEEEe
Q psy15302         19 KGGSSSGVRDFLAQHYVPLKQANPKFPIL-VRECSGVTPVVWASG   62 (68)
Q Consensus        19 ~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~-v~~~~~~~P~v~a~Y   62 (68)
                      +||+|.|-+||+.+-+.++-    .+.|. +..++| .|...|.+
T Consensus       250 tGG~S~G~~D~~~~al~~lG----~~~f~~v~~kPG-kp~~~g~~  289 (411)
T PRK10680        250 SGGVSVGEADYTKTILEELG----EIAFWKLAIKPG-KPFAFGKL  289 (411)
T ss_pred             cCCCCCCCcchHHHHHHhcC----cEEEEEEEEecC-cceEEEEE
Confidence            69999999999988776653    34332 355677 77777766


No 219
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention. It contains an N-terminal TRX domain, similar to that of PDIa, with a CXFS motif followed by two redox inactive TRX-like domains, homologous to the b and b' domains of PDI. The CXFS motif in the N-terminal domain allows ERp44 to form stable reversible mixed disulfides with its substrates. Through this activity, ERp44 mediates the ER localization of Ero1alpha, a protein that oxidizes protein disulfide isomerases into their active form. ERp44 also prevents the secretion of unassembled cargo protein with unpaired cysteines. It also modulates the activity of inositol 1,4,5-triphosphate type I receptor (IP3R1), an intracellular channel protein that mediates calcium release from the ER to the cytosol.
Probab=23.37  E-value=1.6e+02  Score=16.76  Aligned_cols=33  Identities=12%  Similarity=0.041  Sum_probs=25.4

Q ss_pred             EEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCC
Q psy15302         11 ELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPK   43 (68)
Q Consensus        11 ~l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~   43 (68)
                      -|...|.+|.+.++-+...+++....++...|+
T Consensus        21 vlv~F~a~wC~~C~~~~p~~~~~a~~~~~~~~~   53 (108)
T cd02996          21 VLVNFYADWCRFSQMLHPIFEEAAAKIKEEFPD   53 (108)
T ss_pred             EEEEEECCCCHHHHhhHHHHHHHHHHHhhccCC
Confidence            367778889998998888887777777766665


No 220
>cd02873 GH18_IDGF The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster. The IDGF's have an eight-stranded alpha/beta barrel fold and are related to the glycosyl hydrolase family 18 (GH18) chitinases, but they have an amino acid substitution known to abolish chitinase catalytic activity. IDGFs may have evolved from chitinases to gain new functions as growth factors, interacting with cell surface glycoproteins involved in growth-promoting processes.
Probab=23.32  E-value=72  Score=23.48  Aligned_cols=21  Identities=19%  Similarity=0.352  Sum_probs=17.4

Q ss_pred             hCHHHHHHhCCCCeEEEEecC
Q psy15302         32 QHYVPLKQANPKFPILVRECS   52 (68)
Q Consensus        32 ~~l~~~~~~NP~v~i~v~~~~   52 (68)
                      +.+..+|++||++.+++.-.-
T Consensus        63 ~~~~~lk~~~p~lKvllSiGG   83 (413)
T cd02873          63 RAITSLKRKYPHLKVLLSVGG   83 (413)
T ss_pred             HHHHHHHhhCCCCeEEEeecC
Confidence            356789999999999998754


No 221
>KOG1454|consensus
Probab=23.12  E-value=82  Score=22.45  Aligned_cols=26  Identities=19%  Similarity=0.181  Sum_probs=22.4

Q ss_pred             CHHHHHHhCCCCeEEEEecCCCCCEE
Q psy15302         33 HYVPLKQANPKFPILVRECSGVTPVV   58 (68)
Q Consensus        33 ~l~~~~~~NP~v~i~v~~~~~~~P~v   58 (68)
                      .-..+++++|++++++-+.-|.+|.+
T Consensus       282 ~~~~~~~~~pn~~~~~I~~~gH~~h~  307 (326)
T KOG1454|consen  282 LAEELKKKLPNAELVEIPGAGHLPHL  307 (326)
T ss_pred             HHHHHHhhCCCceEEEeCCCCccccc
Confidence            45678899999999999988888876


No 222
>PRK12680 transcriptional regulator CysB-like protein; Reviewed
Probab=23.11  E-value=1.2e+02  Score=21.02  Aligned_cols=37  Identities=19%  Similarity=0.307  Sum_probs=27.4

Q ss_pred             eEEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         10 KELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        10 k~l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ..|+|-..+.     -...++...+..|.+.+|++.|.+...
T Consensus        93 g~lrIg~~~~-----~~~~~l~~~l~~f~~~~P~v~i~l~~~  129 (327)
T PRK12680         93 GQLTLTTTHT-----QARFVLPPAVAQIKQAYPQVSVHLQQA  129 (327)
T ss_pred             eEEEEEecch-----hHHHhhHHHHHHHHHHCCCcEEEEEeC
Confidence            3566665443     235677889999999999999998764


No 223
>PF14606 Lipase_GDSL_3:  GDSL-like Lipase/Acylhydrolase family; PDB: 3SKV_B.
Probab=23.11  E-value=1e+02  Score=20.56  Aligned_cols=31  Identities=26%  Similarity=0.344  Sum_probs=21.8

Q ss_pred             CCCHHHHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         21 GSSSGVRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        21 ~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      .+.+-+++=+..-+..+.+++|++||++.+.
T Consensus        71 ~~~~~~~~~~~~fv~~iR~~hP~tPIllv~~  101 (178)
T PF14606_consen   71 MSPEEFRERLDGFVKTIREAHPDTPILLVSP  101 (178)
T ss_dssp             CCTTTHHHHHHHHHHHHHTT-SSS-EEEEE-
T ss_pred             CCHHHHHHHHHHHHHHHHHhCCCCCEEEEec
Confidence            4555566666677889999999999999774


No 224
>KOG0907|consensus
Probab=23.11  E-value=1.8e+02  Score=17.43  Aligned_cols=30  Identities=17%  Similarity=0.272  Sum_probs=23.3

Q ss_pred             EecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEE
Q psy15302         15 HLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILV   48 (68)
Q Consensus        15 ~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v   48 (68)
                      .|..|.|..+-|    .-.+.+|+.++|++.|+-
T Consensus        28 F~a~wCgPCk~i----~P~~~~La~~y~~v~Flk   57 (106)
T KOG0907|consen   28 FYATWCGPCKAI----APKFEKLAEKYPDVVFLK   57 (106)
T ss_pred             EECCCCcchhhh----hhHHHHHHHHCCCCEEEE
Confidence            477788888755    456778999999988874


No 225
>CHL00180 rbcR LysR transcriptional regulator; Provisional
Probab=23.09  E-value=1.3e+02  Score=20.37  Aligned_cols=25  Identities=8%  Similarity=0.157  Sum_probs=21.4

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ..|+...+.+|.+.+|++.|.+...
T Consensus       107 ~~~~~~~l~~~~~~~P~v~i~~~~~  131 (305)
T CHL00180        107 TYLMPRLIGLFRQRYPQINVQLQVH  131 (305)
T ss_pred             HhHHHHHHHHHHHHCCCceEEEEeC
Confidence            5778889999999999999998653


No 226
>TIGR03521 GldG gliding-associated putative ABC transporter substrate-binding component GldG. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldG is a protein linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockouts of GldG abolish the gliding phenotype. GldG, along with GldA and GldF are believed to compose an ABC transporter and are observed as an operon. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility.
Probab=22.91  E-value=2.1e+02  Score=21.94  Aligned_cols=39  Identities=13%  Similarity=0.063  Sum_probs=27.8

Q ss_pred             EEEEEecCCCCCC-HHHHHHHHhCHHHHHHhCCCCeEEEE
Q psy15302         11 ELRIHLCQKGGSS-SGVRDFLAQHYVPLKQANPKFPILVR   49 (68)
Q Consensus        11 ~l~~~yc~~~~sS-~G~R~Fl~~~l~~~~~~NP~v~i~v~   49 (68)
                      +|.+.+.+..+.. +-.+.-+++.|.++++.+|++.+...
T Consensus        51 ~I~~~~s~~~~~~~~~~~~~v~~lL~eY~~~s~~i~~~~i   90 (552)
T TIGR03521        51 SIDIFLDGELPADFRRLQKETRQLLEEFAAYNPNIKFRFV   90 (552)
T ss_pred             EEEEEEcCCCchHHHHHHHHHHHHHHHHHHhCCCeEEEEe
Confidence            3666676553322 34567788999999999999887774


No 227
>PF10307 DUF2410:  Hypothetical protein (DUF2410);  InterPro: IPR018812  This entry represents a family of proteins conserved in fungi whose function is not known. There are two characteristic sequence motifs, GGWW and TGR. 
Probab=22.82  E-value=1.1e+02  Score=20.76  Aligned_cols=27  Identities=26%  Similarity=0.417  Sum_probs=22.4

Q ss_pred             cCcceEEEEEecCCCCCCHHHHHHHHhC
Q psy15302          6 GSKLKELRIHLCQKGGSSSGVRDFLAQH   33 (68)
Q Consensus         6 v~qlk~l~~~yc~~~~sS~G~R~Fl~~~   33 (68)
                      ..++++|++ |+|-...-+|.|+|+.+.
T Consensus       130 Y~~~~eI~I-YeDR~~hvk~Fr~Ff~~~  156 (197)
T PF10307_consen  130 YKNAEEIRI-YEDRPKHVKGFRDFFEEL  156 (197)
T ss_pred             cCCCCEEEE-EcCCHHHHHHHHHHHHHh
Confidence            457899987 788888899999999753


No 228
>PHA00684 hypothetical protein
Probab=22.78  E-value=95  Score=20.00  Aligned_cols=28  Identities=11%  Similarity=0.317  Sum_probs=20.9

Q ss_pred             HHHHHHHHhCHHHHHHhCCCCeEEEEecC
Q psy15302         24 SGVRDFLAQHYVPLKQANPKFPILVRECS   52 (68)
Q Consensus        24 ~G~R~Fl~~~l~~~~~~NP~v~i~v~~~~   52 (68)
                      .-+|.+|. .+.+++++||+..|.|.+--
T Consensus        56 ~~I~~~V~-~Fi~ya~~hp~~~F~VT~IG   83 (128)
T PHA00684         56 PDIGAAVN-RFIAYATAHPHLNFQVTRVG   83 (128)
T ss_pred             HHHHHHHH-HHHHHHHhCCCcEEEeeeec
Confidence            34566664 46689999999999997643


No 229
>cd03409 Chelatase_Class_II Class II Chelatase: a family of ATP-independent monomeric or homodimeric enzymes that catalyze the insertion of metal into protoporphyrin rings. This family includes protoporphyrin IX ferrochelatase (HemH), sirohydrochlorin ferrochelatase (SirB) and the cobaltochelatases, CbiK and CbiX. HemH and SirB are involved in heme and siroheme biosynthesis, respectively, while the cobaltochelatases are associated with cobalamin biosynthesis. Excluded from this family are the ATP-dependent heterotrimeric chelatases (class I) and the multifunctional homodimeric enzymes with dehydrogenase and chelatase activities (class III).
Probab=22.68  E-value=1.6e+02  Score=16.49  Aligned_cols=33  Identities=24%  Similarity=0.308  Sum_probs=22.6

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEecCCCCCE
Q psy15302         25 GVRDFLAQHYVPLKQANPKFPILVRECSGVTPV   57 (68)
Q Consensus        25 G~R~Fl~~~l~~~~~~NP~v~i~v~~~~~~~P~   57 (68)
                      ...+.+......++++.|..++.+--.....|.
T Consensus        14 ~~~~~~~~~~~~l~~~~~~~~v~~a~~~~~~P~   46 (101)
T cd03409          14 PYKKDIEAQAHNLAESLPDFPYYVGFQSGLGPD   46 (101)
T ss_pred             cHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCC
Confidence            667778888888888888777666444433453


No 230
>PF05159 Capsule_synth:  Capsule polysaccharide biosynthesis protein;  InterPro: IPR007833 This family includes export proteins involved in capsule polysaccharide biosynthesis, such as KpsS P42218 from SWISSPROT and LipB P57038 from SWISSPROT. Capsule polysaccharide modification protein lipB/A is involved in the phospholipid modification of the capsular polysaccharide and is a strong requirement for its translocation to the cell surface. The capsule of Neisseria meningitidis serogroup B and of other meningococcal serogroups and other Gram-negative bacterial pathogens, are anchored in the outer membrane through a 1,2-diacylglycerol moiety. The lipA and lipB genes are located on the 3' end of the ctr operon. lipA and lipB do not encode proteins responsible for diacylglycerophosphatidic acid substitution of the meningococcal capsule polymer, but they are required for proper translocation and surface expression of the lipidated polymer []. KpsS is an unusual sulphate-modified form of the capsular polysaccharide in Rhizobium loti (Mesorhizobium loti). Many plants, including R. loti, enter into symbiotic relationships with bacteria that allow survival in nutrient-limiting environments. KpsS functions as a fucosyl sulphotransferase in vitro. The kpsS gene product shares no significant amino acid similarity with previously identified sulphotransferases []. Sulphated cell surface polysaccharides are required for optimum nodule formation but limit growth rate and nodule colonisation in M. loti [].; GO: 0000271 polysaccharide biosynthetic process, 0015774 polysaccharide transport
Probab=22.54  E-value=1.3e+02  Score=20.31  Aligned_cols=27  Identities=11%  Similarity=0.199  Sum_probs=22.0

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEecC
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVRECS   52 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~~   52 (68)
                      ..+++.+-+.++++.||+..++|++-+
T Consensus       138 ~~~~~~~~l~~~~~~~p~~~lvvK~HP  164 (269)
T PF05159_consen  138 SQADFLDMLESFAKENPDAKLVVKPHP  164 (269)
T ss_pred             cHhHHHHHHHHHHHHCCCCEEEEEECc
Confidence            455667788899999999999998844


No 231
>PF14421 LmjF365940-deam:  A distinct subfamily of CDD/CDA-like deaminases
Probab=22.33  E-value=1e+02  Score=21.11  Aligned_cols=25  Identities=16%  Similarity=0.317  Sum_probs=20.6

Q ss_pred             HhCHHHHHHhCCCCeEEEEecCCCC
Q psy15302         31 AQHYVPLKQANPKFPILVRECSGVT   55 (68)
Q Consensus        31 ~~~l~~~~~~NP~v~i~v~~~~~~~   55 (68)
                      ++.|.++++.||++.++......++
T Consensus       161 ~ewL~KIAe~np~f~v~mFd~t~c~  185 (193)
T PF14421_consen  161 KEWLRKIAEANPDFRVYMFDDTRCR  185 (193)
T ss_pred             HHHHHHHHHhCCCeEEEEecCCCcc
Confidence            4678889999999999998877543


No 232
>TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated. Members of this family include a match to the pfam00534 Glycosyl transferases group 1 domain. Nearly all are found in species that encode the PEP-CTERM/exosortase system predicted to act in protein sorting in a number of Gram-negative bacteria. In particular, these transferases are found proximal to a particular variant of exosortase, EpsH1, which appears to travel with a conserved group of genes summarized by Genome Property GenProp0652. The nature of the sugar transferase reaction catalyzed by members of this clade is unknown and may conceivably be variable with respect to substrate by species, but we hypothesize a conserved substrate.
Probab=22.14  E-value=1.5e+02  Score=20.88  Aligned_cols=26  Identities=12%  Similarity=0.198  Sum_probs=20.7

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         25 GVRDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        25 G~R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      ++..|+..-++.+++.+|++.+.|.-
T Consensus       241 ~l~~~~~~~~~~l~~~~p~~~l~ivG  266 (397)
T TIGR03087       241 AVVWFAERVFPAVRARRPAAEFYIVG  266 (397)
T ss_pred             HHHHHHHHHHHHHHHHCCCcEEEEEC
Confidence            44556668889999999999999864


No 233
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions.  GRX is a glutathione (GSH) dependent reductase containing a redox active CXXC motif in a TRX fold. It has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. By altering the redox state of target proteins, GRX is involved in many cellular functions.
Probab=21.95  E-value=1.4e+02  Score=15.91  Aligned_cols=22  Identities=23%  Similarity=0.196  Sum_probs=17.4

Q ss_pred             EEEEEecCCCCCCHHHHHHHHh
Q psy15302         11 ELRIHLCQKGGSSSGVRDFLAQ   32 (68)
Q Consensus        11 ~l~~~yc~~~~sS~G~R~Fl~~   32 (68)
                      +|+|..-++.+.++-++.+|++
T Consensus         2 ~v~ly~~~~C~~C~ka~~~L~~   23 (73)
T cd03027           2 RVTIYSRLGCEDCTAVRLFLRE   23 (73)
T ss_pred             EEEEEecCCChhHHHHHHHHHH
Confidence            5666666788889999999964


No 234
>PF06891 P2_Phage_GpR:  P2 phage tail completion protein R (GpR);  InterPro: IPR009678 This family consists of P2 phage tail completion protein R (GpR) and similar sequences from related phage. GpR is thought to be a tail completion protein which is essential for stable head joining []. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=21.87  E-value=78  Score=19.86  Aligned_cols=27  Identities=15%  Similarity=0.193  Sum_probs=22.7

Q ss_pred             HHHHHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         24 SGVRDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        24 ~G~R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      .-+|+||.+.+|.++.+.-++.+.+..
T Consensus         5 ~sLr~~L~~~lP~~~~~pd~l~~~v~~   31 (135)
T PF06891_consen    5 QSLRAALTAALPELAANPDRLDSFVDN   31 (135)
T ss_pred             HHHHHHHHHhChhhhcChhheEEEEeC
Confidence            468999999999999887788877754


No 235
>PRK10632 transcriptional regulator; Provisional
Probab=21.84  E-value=1.5e+02  Score=20.18  Aligned_cols=26  Identities=12%  Similarity=0.162  Sum_probs=22.3

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ...++...+.+|.+++|++.|.+...
T Consensus       103 ~~~~l~~~l~~~~~~~P~i~i~l~~~  128 (309)
T PRK10632        103 AQNVLAGLTAKMLKEYPGLSVNLVTG  128 (309)
T ss_pred             HHHHHHHHHHHHHHHCCCeEEEEEec
Confidence            34677899999999999999999764


No 236
>PRK09986 DNA-binding transcriptional activator XapR; Provisional
Probab=21.83  E-value=1.3e+02  Score=19.88  Aligned_cols=25  Identities=24%  Similarity=0.247  Sum_probs=20.8

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ..++...+.+|.+.+|++.+.+...
T Consensus       109 ~~~l~~~l~~f~~~~p~i~l~i~~~  133 (294)
T PRK09986        109 WGRLRPAMRHFLKENPNVEWLLREL  133 (294)
T ss_pred             HHHHHHHHHHHHHhCCCeEEEEEeC
Confidence            4667788999999999999988644


No 237
>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis. It was identified as an IAP binding protein through a screen of a human B-cell library using a prototype IAP. VIAF lacks a consensus IAP binding motif and while it does not function as an IAP antagonist, it still plays a regulatory role in the complete activation of caspases. VIAF itself is a substrate for IAP-mediated ubiquitination, suggesting that it may be a target of IAPs in the prevention of cell death. The similarity of VIAF to Phd points to a potential role distinct from apoptosis regulation. Phd functions as a cytosolic regulator of G protein by specifically binding to G protein betagamma (Gbg)-subunits. The C-terminal domain of Phd adopts a thioredoxin fold, but it does not contain a CXXC motif. Phd interacts with G protein beta mostly through the N-terminal helical domain.
Probab=21.74  E-value=2e+02  Score=19.01  Aligned_cols=35  Identities=14%  Similarity=-0.056  Sum_probs=24.4

Q ss_pred             EEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         12 LRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        12 l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      |.-.|-+|.+.++=    |...|.++|+++|++.|.--.
T Consensus       106 VV~Fya~wc~~C~~----m~~~l~~LA~k~~~vkFvkI~  140 (192)
T cd02988         106 VVHLYKDGIPLCRL----LNQHLSELARKFPDTKFVKII  140 (192)
T ss_pred             EEEEECCCCchHHH----HHHHHHHHHHHCCCCEEEEEE
Confidence            44455567776664    456777889999999887643


No 238
>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. The class Delta and Epsilon subfamily is made up primarily of insect GSTs, which play major roles in insecticide resistance by facilitating reductive dehydrochlorination of insecticides or conjugating them with GSH to produce water-soluble metabolites that are easily excreted. They are also implicated in protection against cellular damage by oxidative stress.
Probab=21.74  E-value=1.2e+02  Score=15.76  Aligned_cols=20  Identities=5%  Similarity=-0.109  Sum_probs=16.5

Q ss_pred             EEEEecCCCCCCHHHHHHHH
Q psy15302         12 LRIHLCQKGGSSSGVRDFLA   31 (68)
Q Consensus        12 l~~~yc~~~~sS~G~R~Fl~   31 (68)
                      ++|.+...++.|+-+|-+++
T Consensus         1 ~~Ly~~~~~~~~~~v~~~l~   20 (74)
T cd03045           1 IDLYYLPGSPPCRAVLLTAK   20 (74)
T ss_pred             CEEEeCCCCCcHHHHHHHHH
Confidence            46778888888999998885


No 239
>PF02944 BESS:  BESS motif;  InterPro: IPR004210 The BESS domain has been named after the three proteins that originally defined the domain: BEAF (Boundary element associated factor 32) [], Suvar(3)7 [] and Stonewall []). The BESS domain is 40 amino acid residues long and is predicted to be composed of three alpha helices, as such it might be related to the myb/SANT HTH domain. The BESS domain directs a variety of protein-protein interactions, including interactions with itself, with Dorsal, and with a TBP-associated factor. It is found in a single copy in Drosophila proteins and is often associated with the MADF domain [, , ]. Proteins known to contain a BESS domain include:    Drosophila Boundary element associated factor 32 (BEAF-32).   Drosophila Suppressor of variegation protein 3-7 (Su(var)3-7), which could play a role in chromosome condensation.  Drosophila Ravus, which is homologous to the C-terminal part of Su(var)3-7 [].   Drosophila Stonewall (Stwl), a putative transcription factor required for maintenance of female germline stem cells as well as oocyte differentiation.  Drosophila Adf-1, a transcription factor first identified on the basis of its interaction with the alcohol dehydrogenase promoter but that binds the promoters of a diverse group of genes [].  Drosophila Dorsal-interacting protein 3 (Dip3). It functions both as an activator to bind DNA in a sequence specific manner and a coactivator to stimulate synergistic activation by Dorsal and Twist [].  ; GO: 0003677 DNA binding
Probab=21.67  E-value=67  Score=15.68  Aligned_cols=18  Identities=28%  Similarity=0.277  Sum_probs=15.3

Q ss_pred             HHHHHHhCHHHHHHhCCC
Q psy15302         26 VRDFLAQHYVPLKQANPK   43 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~   43 (68)
                      ...|+.+-+|.+++-+|.
T Consensus         4 d~~Fl~Sl~p~~k~L~~~   21 (37)
T PF02944_consen    4 DELFLLSLLPHMKRLPPK   21 (37)
T ss_pred             HHHHHHHhHHHHHhCCHH
Confidence            467999999999998875


No 240
>PF00309 Sigma54_AID:  Sigma-54 factor, Activator interacting domain (AID) ;  InterPro: IPR000394 Sigma factors [] are bacterial transcription initiation factors that promote the attachment of the core RNA polymerase to specific initiation sites and are then released. They alter the specificity of promoter recognition. Most bacteria express a multiplicity of sigma factors. Two of these factors, sigma-70 (gene rpoD), generally known as the major or primary sigma factor, and sigma-54 (gene rpoN or ntrA) direct the transcription of a wide variety of genes. The other sigma factors, known as alternative sigma factors, are required for the transcription of specific subsets of genes. With regard to sequence similarity, sigma factors can be grouped into two classes: the sigma-54 and sigma-70 families. The sigma-70 family has many different sigma factors (see the relevant entry IPR000943 from INTERPRO). The sigma-54 family consists exclusively of sigma-54 factor [, ] required for the transcription of promoters that have a characteristic -24 and -12 consensus recognition element but which are devoid of the typical -10, -35 sequences recognised by the major sigma factors. The sigma-54 factor is also characterised by its interaction with ATP-dependent positive regulatory proteins that bind to upstream activating sequences. Structurally sigma-54 factors consist of three distinct regions:   A relatively well conserved N-terminal glutamine-rich region of about 50 residues that contains a potential leucine zipper motif. A region of variable length which is not well conserved. A well conserved C-terminal region of about 350 residues that contains a second potential leucine zipper, a potential DNA-binding 'helix-turn-helix' motif and a perfectly conserved octapeptide whose function is not known.  ; GO: 0003677 DNA binding, 0003700 sequence-specific DNA binding transcription factor activity, 0003899 DNA-directed RNA polymerase activity, 0016987 sigma factor activity, 0006352 transcription initiation, DNA-dependent, 0006355 regulation of transcription, DNA-dependent
Probab=21.55  E-value=70  Score=16.70  Aligned_cols=16  Identities=13%  Similarity=0.160  Sum_probs=11.3

Q ss_pred             HhCHHHHHHhCCCCeE
Q psy15302         31 AQHYVPLKQANPKFPI   46 (68)
Q Consensus        31 ~~~l~~~~~~NP~v~i   46 (68)
                      .+.+.+.+..||-+++
T Consensus        32 ~~~i~~~~~eNP~Le~   47 (49)
T PF00309_consen   32 EEYIEEEAEENPFLEV   47 (49)
T ss_pred             HHHHHHHHHhCcCccc
Confidence            3455667889998775


No 241
>PF06121 DUF959:  Domain of Unknown Function (DUF959) ;  InterPro: IPR010363 The function of this collagen XVIII N-terminal domain has not been characterised. It is not expressed in the 'short' isoform of collagen XVIII [].; GO: 0031012 extracellular matrix
Probab=21.46  E-value=58  Score=22.44  Aligned_cols=10  Identities=30%  Similarity=0.710  Sum_probs=8.1

Q ss_pred             HHHHHHHHhC
Q psy15302         24 SGVRDFLAQH   33 (68)
Q Consensus        24 ~G~R~Fl~~~   33 (68)
                      +|||+||+-.
T Consensus       129 qGIRsFVqlW  138 (202)
T PF06121_consen  129 QGIRSFVQLW  138 (202)
T ss_pred             HHHHHHHHHh
Confidence            7999999743


No 242
>PHA00440 host protein H-NS-interacting protein
Probab=21.40  E-value=73  Score=19.64  Aligned_cols=15  Identities=13%  Similarity=0.233  Sum_probs=12.2

Q ss_pred             HHHHHHHHhCHHHHH
Q psy15302         24 SGVRDFLAQHYVPLK   38 (68)
Q Consensus        24 ~G~R~Fl~~~l~~~~   38 (68)
                      +|+|++|++.+++..
T Consensus        68 ~giRe~IKe~~~E~~   82 (98)
T PHA00440         68 QGIREAIKDMHEEST   82 (98)
T ss_pred             HHHHHHHHHHhHhhc
Confidence            689999988888754


No 243
>PF10607 CLTH:  CTLH/CRA C-terminal to LisH motif domain;  InterPro: IPR019589 This entry represents the CRA (or CT11-RanBPM) domain, which is a protein-protein interaction domain present in crown eukaryotes (plants, animals, fungi) and which is found in Ran-binding proteins such as Ran-binding protein 9 (RanBP9 or RanBPM) and RanBP10. RanBPM is a scaffolding protein important in regulating cellular function in both the immune system and the nervous system, and may act as an adapter protein to couple membrane receptors to intracellular signaling pathways. This domain is at the C terminus of the proteins and is the binding domain for the CRA motif, which is comprised of approximately 100 amino acids at the C-terminal of RanBPM. It was found to be important for the interaction of RanBPM with fragile X mental retardation protein (FMRP), but its functional significance has yet to be determined []. 
Probab=21.28  E-value=70  Score=19.41  Aligned_cols=29  Identities=17%  Similarity=0.356  Sum_probs=23.6

Q ss_pred             CCCHHHHHHHHhCHHHHHHhCCCCeEEEE
Q psy15302         21 GSSSGVRDFLAQHYVPLKQANPKFPILVR   49 (68)
Q Consensus        21 ~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~   49 (68)
                      |.-..+-+++.++.|.+.+.|+++.|.++
T Consensus        15 g~i~~Ai~w~~~~~~~l~~~~~~L~f~L~   43 (145)
T PF10607_consen   15 GDIDPAIEWLNENFPELLKRNSSLEFELR   43 (145)
T ss_pred             CCHHHHHHHHHHcCHHHHhcCCchhHHHH
Confidence            34566788999999999999999987653


No 244
>PF02960 K1:  K1 glycoprotein;  InterPro: IPR004121 Current genotyping systems for Human herpesvirus 8 (HHV-8) are based on the highly variable gene encoding the K1 glycoprotein []. This entry represents the C-terminal region of the K1 glycoprotein.
Probab=21.26  E-value=34  Score=21.86  Aligned_cols=42  Identities=21%  Similarity=0.311  Sum_probs=36.0

Q ss_pred             CCHHHHHHHHhCHHHHHHhCCCCeEEEEecCCCCCEEEEEec
Q psy15302         22 SSSGVRDFLAQHYVPLKQANPKFPILVRECSGVTPVVWASGK   63 (68)
Q Consensus        22 sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~~~~~~P~v~a~Y~   63 (68)
                      |--|.|.|=.+.+.++--+..+..+.+.|....+|.+...++
T Consensus        30 STTGFrTfsTn~lvnIi~aTth~vvvvkEakstn~hi~v~fL   71 (130)
T PF02960_consen   30 STTGFRTFSTNSLVNIIHATTHDVVVVKEAKSTNPHIQVHFL   71 (130)
T ss_pred             cccceEEEecccccceecccccceEEEEEeecCCceEEeeee
Confidence            446888888888888888999999999999999999988764


No 245
>PF06183 DinI:  DinI-like family;  InterPro: IPR010391 This family of short proteins includes DNA-damage-inducible protein I (DinI) and related proteins. The SOS response, a set of cellular phenomena exhibited by eubacteria, is initiated by various causes that include DNA damage-induced replication arrest, and is positively regulated by the co- protease activity of RecA. Escherichia coli DinI, a LexA-regulated SOS gene product, shuts off the initiation of the SOS response when overexpressed in vivo. Biochemical and genetic studies indicated that DinI physically interacts with RecA to inhibit its co-protease activity []. The structure of DinI is known [].; PDB: 1GHH_A.
Probab=21.18  E-value=1.7e+02  Score=16.33  Aligned_cols=30  Identities=23%  Similarity=0.272  Sum_probs=21.6

Q ss_pred             HHHHHHHH-hCHHHHHHhCCCCeEEEEecCC
Q psy15302         24 SGVRDFLA-QHYVPLKQANPKFPILVRECSG   53 (68)
Q Consensus        24 ~G~R~Fl~-~~l~~~~~~NP~v~i~v~~~~~   53 (68)
                      .|+.+=|+ +....+...+|+..+.|+....
T Consensus         3 ~ga~~AL~~EL~kRl~~~yPd~~v~Vr~~s~   33 (65)
T PF06183_consen    3 AGALEALESELTKRLHRQYPDAEVRVRPGSA   33 (65)
T ss_dssp             TTHHHHHHHHHHHHHHHH-SS-EEEEEEESS
T ss_pred             ccHHHHHHHHHHHHHHHHCCCceEeeeeccc
Confidence            46667674 5667899999999999987654


No 246
>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain. Desulfobacterium autotrophicum LeuA3 is sequence-similar to alpha-isopropylmalate synthase (LeuA) but its exact function is unknown.  Members of this family have an N-terminal TIM barrel domain that belongs to the DRE-TIM metallolyase superfamily.  DRE-TIM metallolyases include 2-isopropylmalate synthase (IPMS), alpha-isopropylmalate synthase (LeuA), 3-hydroxy-3-methylglutaryl-CoA lyase, homocitrate synthase, citramalate synthase, 4-hydroxy-2-oxovalerate aldolase, re-citrate synthase, transcarboxylase 5S, pyruvate carboxylase, AksA, and FrbC.  These members all share a conserved  triose-phosphate isomerase (TIM) barrel domain consisting of a core beta(8)-alpha(8) motif with the eight parallel beta strands forming an enclosed barrel surrounded by eight alpha helices.  The domain has a catalytic center containing a divalent cation-binding site formed by a cluster of in
Probab=21.15  E-value=2e+02  Score=19.87  Aligned_cols=34  Identities=18%  Similarity=0.384  Sum_probs=24.4

Q ss_pred             EEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEE
Q psy15302         13 RIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILV   48 (68)
Q Consensus        13 ~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v   48 (68)
                      +|.+||+.|....-+  +.+.+..+++..|+++|.+
T Consensus       167 ~i~l~DT~G~~~P~~--v~~lv~~l~~~~~~~~l~~  200 (273)
T cd07941         167 WLVLCDTNGGTLPHE--IAEIVKEVRERLPGVPLGI  200 (273)
T ss_pred             EEEEecCCCCCCHHH--HHHHHHHHHHhCCCCeeEE
Confidence            577899888655443  5666677888888877766


No 247
>PRK11062 nhaR transcriptional activator NhaR; Provisional
Probab=21.03  E-value=1.3e+02  Score=20.27  Aligned_cols=25  Identities=4%  Similarity=0.100  Sum_probs=21.4

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         26 VRDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      ...|+...+.+|.+.+|++.+.+..
T Consensus       104 ~~~~l~~~l~~f~~~~P~i~l~~~~  128 (296)
T PRK11062        104 SKRLVSRVLLTAVPEDESIHLRCFE  128 (296)
T ss_pred             hHhhHHHHHHHHHhcCCceEEEEEe
Confidence            3567888999999999999999864


No 248
>cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells. More recently, mutations in GDAP1 have been reported to cause both axonal and demyelinating autosomal-recessive Charcot-Marie-Tooth (CMT) type 4A neuropathy. CMT is characterized by slow and progressive weakness and atrophy of muscles. Sequence analysis of GDAP1 shows similarities and differences with GSTs; it appears to contain both N-terminal TRX-fold and C-terminal alpha helical domains of GSTs, however, it also contains additional C-terminal transmembrane domains unlike GSTs. GDAP1 is mainly expressed in neuronal cells and is localized in the mitochondria through its transmembrane domains. It does not exhibit GST activity using standard substrates.
Probab=20.95  E-value=1.1e+02  Score=16.60  Aligned_cols=20  Identities=30%  Similarity=0.157  Sum_probs=15.9

Q ss_pred             EEEEecCCCCCCHHHHHHHH
Q psy15302         12 LRIHLCQKGGSSSGVRDFLA   31 (68)
Q Consensus        12 l~~~yc~~~~sS~G~R~Fl~   31 (68)
                      ++|.++..+++|.-+|-.+.
T Consensus         1 ~~ly~~~~s~~s~rv~~~L~   20 (73)
T cd03052           1 LVLYHWTQSFSSQKVRLVIA   20 (73)
T ss_pred             CEEecCCCCccHHHHHHHHH
Confidence            36778888888989987774


No 249
>cd04502 SGNH_hydrolase_like_7 Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
Probab=20.76  E-value=1.9e+02  Score=17.64  Aligned_cols=28  Identities=14%  Similarity=0.148  Sum_probs=20.9

Q ss_pred             CHHHHHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         23 SSGVRDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        23 S~G~R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      ..-.++-+++-+..+++.+|+++|++-.
T Consensus        69 ~~~~~~~~~~lv~~i~~~~~~~~iil~~   96 (171)
T cd04502          69 PEEVLRDFRELVNRIRAKLPDTPIAIIS   96 (171)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCcEEEEE
Confidence            3445555677888899999999888754


No 250
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins such as ribonucleotide reductase. It contains a redox active CXXC motif in a TRX fold and uses a similar dithiol mechanism employed by TRXs for intramolecular disulfide bond reduction of protein substrates. Unlike TRX, GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. The flow of reducing equivalents in the GRX system goes from NADPH - GSH reductase - GSH - GRX - protein substrates. By altering the redox state of target proteins, GRX is involved in many cellular functions including DNA synthesis, signal transduction and the defense against oxidative stress. Different classes
Probab=20.74  E-value=97  Score=16.49  Aligned_cols=22  Identities=5%  Similarity=-0.022  Sum_probs=17.4

Q ss_pred             EEEEecCCCCCCHHHHHHHHhC
Q psy15302         12 LRIHLCQKGGSSSGVRDFLAQH   33 (68)
Q Consensus        12 l~~~yc~~~~sS~G~R~Fl~~~   33 (68)
                      |++..-++.+.++.+++++.+.
T Consensus         2 v~~y~~~~Cp~C~~~~~~l~~~   23 (82)
T cd03419           2 VVVFSKSYCPYCKRAKSLLKEL   23 (82)
T ss_pred             EEEEEcCCCHHHHHHHHHHHHc
Confidence            5666667888899999999754


No 251
>PRK05972 ligD ATP-dependent DNA ligase; Reviewed
Probab=20.71  E-value=1.2e+02  Score=25.19  Aligned_cols=41  Identities=7%  Similarity=-0.041  Sum_probs=35.0

Q ss_pred             CHHHHHHHHhCHHHHHHhCCCCeEEEEecCCCCCEEEEEec
Q psy15302         23 SSGVRDFLAQHYVPLKQANPKFPILVRECSGVTPVVWASGK   63 (68)
Q Consensus        23 S~G~R~Fl~~~l~~~~~~NP~v~i~v~~~~~~~P~v~a~Y~   63 (68)
                      ..-+|.|.+.--..+++++|+.-...+....+.-+|...|.
T Consensus       742 ~~~~~~fa~~ia~~l~~~~P~~~t~~~~k~~R~grifiDyl  782 (860)
T PRK05972        742 WDEVKAFAQAVCQHMARDLPERFLAKMGKKNRVGKIFLDYL  782 (860)
T ss_pred             HHHHHHHHHHHHHHHHHHCchhehhhhhHhhCCCcEEEEcc
Confidence            46689999999999999999988877777777788999987


No 252
>PRK10094 DNA-binding transcriptional activator AllS; Provisional
Probab=20.68  E-value=1.3e+02  Score=20.49  Aligned_cols=38  Identities=13%  Similarity=0.017  Sum_probs=27.0

Q ss_pred             eEEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         10 KELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        10 k~l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ..|+|-.+....    ...++.+.+.+|.+++|++.|.+...
T Consensus        92 g~l~Ig~~~~~~----~~~~l~~~l~~~~~~~P~i~l~l~~~  129 (308)
T PRK10094         92 RQVNIVINNLLY----NPQAVAQLLAWLNERYPFTQFHISRQ  129 (308)
T ss_pred             ccEEEEeccccc----CHHHHHHHHHHHHHhCCCcEEEEEee
Confidence            457777654311    13456788999999999999998653


No 253
>cd02413 40S_S3_KH K homology RNA-binding (KH) domain of the eukaryotic 40S small ribosomal subunit protein S3. S3  is part of the head region of the 40S ribosomal subunit and is believed to interact with mRNA as it threads its way from the latch into the channel.  The KH motif is a beta-alpha-alpha-beta-beta unit that folds into an alpha-beta structure with a three stranded beta-sheet interupted by two contiguous helices.  In general, KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA.
Probab=20.50  E-value=1.4e+02  Score=17.21  Aligned_cols=31  Identities=3%  Similarity=0.097  Sum_probs=20.3

Q ss_pred             CCHHHHHHHHhCHHHHHHhCCCCeEEEEecC
Q psy15302         22 SSSGVRDFLAQHYVPLKQANPKFPILVRECS   52 (68)
Q Consensus        22 sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~~~   52 (68)
                      ..+++++.-...-..|.-.||++++++.+-.
T Consensus        48 ~G~~i~~L~~~L~k~~~~~~~~i~v~~~~v~   78 (81)
T cd02413          48 KGRRIRELTSLVQKRFNFPEGSVELYAEKVA   78 (81)
T ss_pred             CchhHHHHHHHHHHHhCCCCCeEEEEEEEcc
Confidence            4566666555544455679999999776543


No 254
>PF01507 PAPS_reduct:  Phosphoadenosine phosphosulfate reductase family;  InterPro: IPR002500 This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase. PAPS reductase is part of the adenine nucleotide alpha hydrolases superfamily also including N type ATP PPases and ATP sulphurylases []. The enzyme uses thioredoxin as an electron donor for the reduction of PAPS to phospho-adenosine-phosphate (PAP) [, ]. It is also found in NodP nodulation protein P from Rhizobium meliloti (Sinorhizobium meliloti) which has ATP sulphurylase activity (sulphate adenylate transferase) [].; GO: 0003824 catalytic activity, 0008152 metabolic process; PDB: 2GOY_C 3G5A_C 3G6K_D 3G59_A 3FWK_A 2WSI_A 2OQ2_B 1SUR_A 2O8V_A 1ZUN_A.
Probab=20.47  E-value=40  Score=20.66  Aligned_cols=34  Identities=15%  Similarity=0.239  Sum_probs=24.1

Q ss_pred             EEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         12 LRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        12 l~~~yc~~~~sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      +.+.|++++-....+.+|++.....+     +++|.+..
T Consensus        26 ~~vv~~dtg~e~p~t~~~~~~~~~~~-----~~~i~~~~   59 (174)
T PF01507_consen   26 VPVVFIDTGYEFPETYEFVDELAKRY-----GIPIIVYR   59 (174)
T ss_dssp             CEEEEEE-STB-HHHHHHHHHHHHHT-----TCEEEEEE
T ss_pred             CcEEEEecCccCHHHHHHHHHHHhhh-----hhhhhhcc
Confidence            46889999999999999998755544     67765543


No 255
>cd01836 FeeA_FeeB_like SGNH_hydrolase subfamily, FeeA, FeeB and similar esterases/lipases. FeeA and FeeB are part of a biosynthetic gene cluster and may participate in the biosynthesis of long-chain N-acyltyrosines by providing saturated and unsaturated fatty acids, which it turn are loaded onto the acyl carrier protein FeeL. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=20.45  E-value=2e+02  Score=17.81  Aligned_cols=29  Identities=24%  Similarity=0.202  Sum_probs=21.5

Q ss_pred             CCHHHHHHHHhCHHHHHHhCCCCeEEEEe
Q psy15302         22 SSSGVRDFLAQHYVPLKQANPKFPILVRE   50 (68)
Q Consensus        22 sS~G~R~Fl~~~l~~~~~~NP~v~i~v~~   50 (68)
                      +..-.++=+.+-+..+++++|+.+|++..
T Consensus        85 ~~~~~~~~l~~li~~i~~~~~~~~iiv~~  113 (191)
T cd01836          85 SIARWRKQLAELVDALRAKFPGARVVVTA  113 (191)
T ss_pred             CHHHHHHHHHHHHHHHHhhCCCCEEEEEC
Confidence            34455566667788888889999998864


No 256
>PRK12683 transcriptional regulator CysB-like protein; Reviewed
Probab=20.33  E-value=1.5e+02  Score=20.20  Aligned_cols=25  Identities=24%  Similarity=0.290  Sum_probs=21.3

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEec
Q psy15302         27 RDFLAQHYVPLKQANPKFPILVREC   51 (68)
Q Consensus        27 R~Fl~~~l~~~~~~NP~v~i~v~~~   51 (68)
                      ..++...+..|.+.+|++.|.+...
T Consensus       105 ~~~l~~~i~~f~~~~P~i~l~~~~~  129 (309)
T PRK12683        105 RYALPKVVRQFKEVFPKVHLALRQG  129 (309)
T ss_pred             HHHHHHHHHHHHHHCCCceEEEEeC
Confidence            4677888899999999999999764


No 257
>cd02872 GH18_chitolectin_chitotriosidase This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases.  The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases.  The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel.  The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding.  Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense.  Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the la
Probab=20.30  E-value=84  Score=22.18  Aligned_cols=19  Identities=26%  Similarity=0.454  Sum_probs=15.4

Q ss_pred             CHHHHHHhCCCCeEEEEec
Q psy15302         33 HYVPLKQANPKFPILVREC   51 (68)
Q Consensus        33 ~l~~~~~~NP~v~i~v~~~   51 (68)
                      .+.++|++||++.+++.-.
T Consensus        60 ~~~~lk~~~p~lkvlisiG   78 (362)
T cd02872          60 RFNALKEKNPNLKTLLAIG   78 (362)
T ss_pred             HHHHHHhhCCCceEEEEEc
Confidence            4567899999999998654


No 258
>cd06548 GH18_chitinase The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites.  The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
Probab=20.21  E-value=90  Score=21.86  Aligned_cols=20  Identities=35%  Similarity=0.448  Sum_probs=16.4

Q ss_pred             CHHHHHHhCCCCeEEEEecC
Q psy15302         33 HYVPLKQANPKFPILVRECS   52 (68)
Q Consensus        33 ~l~~~~~~NP~v~i~v~~~~   52 (68)
                      .+..+|++||++++++.-.-
T Consensus        74 ~~~~lk~~~p~lkvl~siGG   93 (322)
T cd06548          74 QLRKLKQKNPHLKILLSIGG   93 (322)
T ss_pred             HHHHHHHhCCCCEEEEEEeC
Confidence            46789999999999987643


No 259
>PF10691 DUF2497:  Protein of unknown function (DUF2497) ;  InterPro: IPR019632  Members of this family belong to the Alphaproteobacteria. The function of the family is not known. 
Probab=20.16  E-value=99  Score=17.82  Aligned_cols=14  Identities=14%  Similarity=0.430  Sum_probs=9.2

Q ss_pred             HHHHHHhCHHHHHH
Q psy15302         26 VRDFLAQHYVPLKQ   39 (68)
Q Consensus        26 ~R~Fl~~~l~~~~~   39 (68)
                      +++||.+|||.+-+
T Consensus        47 LkeWLD~nLP~lVE   60 (73)
T PF10691_consen   47 LKEWLDENLPGLVE   60 (73)
T ss_pred             HHHHHHhccHHHHH
Confidence            46777777776643


Done!