Query         psy15303
Match_columns 72
No_of_seqs    101 out of 326
Neff          5.7 
Searched_HMMs 46136
Date          Fri Aug 16 17:37:18 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15303.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15303hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3445|consensus               99.9 2.2E-26 4.8E-31  152.8   7.1   63    3-65     17-79  (145)
  2 KOG3446|consensus               99.9 7.1E-24 1.5E-28  132.2   1.4   64    4-67     10-73  (97)
  3 PF05047 L51_S25_CI-B8:  Mitoch  99.6   5E-15 1.1E-19   82.7   5.5   40   26-65      1-40  (52)
  4 KOG4079|consensus               98.3 2.6E-07 5.6E-12   62.5   0.7   61    4-64     23-83  (169)
  5 PF10780 MRP_L53:  39S ribosoma  96.8  0.0023 5.1E-08   36.0   3.4   48   16-64      1-50  (51)
  6 PF13701 DDE_Tnp_1_4:  Transpos  69.1     7.3 0.00016   29.9   3.6   35   19-53    193-227 (448)
  7 TIGR01159 DRP1 density-regulat  65.6     3.9 8.4E-05   28.2   1.4   25   14-38     14-38  (173)
  8 PF02601 Exonuc_VII_L:  Exonucl  65.4      11 0.00023   27.1   3.7   39    7-52     12-50  (319)
  9 PF13692 Glyco_trans_1_4:  Glyc  65.1     8.8 0.00019   23.0   2.8   39   13-51      4-42  (135)
 10 KOG0183|consensus               63.5     4.1   9E-05   29.6   1.3   19   18-36    161-179 (249)
 11 cd05466 PBP2_LTTR_substrate Th  60.1      17 0.00037   21.4   3.4   27   25-51     10-36  (197)
 12 COG4837 Uncharacterized protei  60.0      13 0.00029   23.7   3.0   32   17-51     19-50  (106)
 13 cd08418 PBP2_TdcA The C-termin  59.2      15 0.00033   22.3   3.2   29   23-51      8-36  (201)
 14 cd08429 PBP2_NhaR The C-termin  58.6      16 0.00035   23.2   3.4   29   24-52      9-37  (204)
 15 cd08470 PBP2_CrgA_like_1 The C  57.8      17 0.00037   22.2   3.2   25   26-50     12-36  (197)
 16 cd08435 PBP2_GbpR The C-termin  56.3      19 0.00041   21.8   3.3   26   26-51     11-36  (201)
 17 cd08481 PBP2_GcdR_like The C-t  54.7      23 0.00051   21.3   3.5   26   27-52     12-37  (194)
 18 TIGR02136 ptsS_2 phosphate bin  54.1      15 0.00032   25.9   2.8   26   26-51     46-71  (287)
 19 cd08487 PBP2_BlaA The C-termin  52.7      24 0.00052   21.4   3.3   26   26-51     11-36  (189)
 20 cd08482 PBP2_TrpI The C-termin  52.6      23 0.00049   21.8   3.2   28   25-52     10-37  (195)
 21 cd08440 PBP2_LTTR_like_4 TThe   52.6      22 0.00048   21.3   3.1   26   26-51     11-36  (197)
 22 cd08456 PBP2_LysR The C-termin  52.0      22 0.00048   21.5   3.0   27   25-51     10-36  (196)
 23 cd08461 PBP2_DntR_like_3 The C  51.9      22 0.00048   21.6   3.1   26   26-51     11-36  (198)
 24 PF05762 VWA_CoxE:  VWA domain   51.6      33 0.00071   23.6   4.1   40   13-52     60-99  (222)
 25 cd08488 PBP2_AmpR The C-termin  51.5      30 0.00065   21.2   3.6   26   27-52     12-37  (191)
 26 cd08473 PBP2_CrgA_like_4 The C  51.4      31 0.00067   20.9   3.6   26   26-51     14-39  (202)
 27 cd08465 PBP2_ToxR The C-termin  51.1      21 0.00046   22.2   2.9   26   26-51     11-36  (200)
 28 cd08452 PBP2_AlsR The C-termin  50.5      21 0.00045   22.0   2.8   27   25-51     10-36  (197)
 29 cd08416 PBP2_MdcR The C-termin  50.4      25 0.00055   21.3   3.1   28   25-52     10-37  (199)
 30 cd08439 PBP2_LrhA_like The C-t  50.3      30 0.00064   21.1   3.4   27   25-51     10-36  (185)
 31 cd08460 PBP2_DntR_like_1 The C  50.1      22 0.00047   22.0   2.8   27   25-51     10-36  (200)
 32 cd08477 PBP2_CrgA_like_8 The C  49.3      31 0.00067   20.9   3.4   26   26-51     12-37  (197)
 33 cd08412 PBP2_PAO1_like The C-t  48.9      23 0.00049   21.5   2.7   26   26-51     11-36  (198)
 34 TIGR00237 xseA exodeoxyribonuc  48.8      28 0.00062   26.6   3.7   30   19-52    136-165 (432)
 35 cd08414 PBP2_LTTR_aromatics_li  48.8      27 0.00058   21.0   3.0   26   26-51     11-36  (197)
 36 cd08436 PBP2_LTTR_like_3 The C  48.8      24 0.00051   21.2   2.8   27   25-51     10-36  (194)
 37 cd08450 PBP2_HcaR The C-termin  48.4      24 0.00051   21.4   2.8   26   26-51     11-36  (196)
 38 cd08486 PBP2_CbnR The C-termin  48.4      32 0.00068   21.4   3.4   25   27-51     13-37  (198)
 39 PF03466 LysR_substrate:  LysR   48.1      21 0.00046   22.0   2.5   27   26-52     17-43  (209)
 40 cd08431 PBP2_HupR The C-termin  48.1      25 0.00055   21.4   2.9   25   27-51     12-36  (195)
 41 cd08464 PBP2_DntR_like_2 The C  47.9      34 0.00074   20.8   3.4   25   27-51     12-36  (200)
 42 cd08444 PBP2_Cbl The C-termina  47.9      29 0.00063   21.5   3.1   26   26-51     11-36  (198)
 43 cd08438 PBP2_CidR The C-termin  47.7      24 0.00052   21.3   2.7   25   27-51     12-36  (197)
 44 cd08466 PBP2_LeuO The C-termin  47.7      30 0.00064   21.1   3.1   26   26-51     11-36  (200)
 45 cd08426 PBP2_LTTR_like_5 The C  47.6      27 0.00059   21.2   3.0   26   26-51     11-36  (199)
 46 PRK00286 xseA exodeoxyribonucl  47.5      29 0.00063   26.2   3.6   30   19-52    142-171 (438)
 47 cd08420 PBP2_CysL_like C-termi  47.5      31 0.00067   20.7   3.2   26   26-51     11-36  (201)
 48 cd02974 AhpF_NTD_N Alkyl hydro  47.4      64  0.0014   19.6   6.3   45   12-61     23-67  (94)
 49 cd08448 PBP2_LTTR_aromatics_li  47.3      29 0.00063   20.9   3.0   26   25-50     10-35  (197)
 50 cd08476 PBP2_CrgA_like_7 The C  47.2      27 0.00058   21.0   2.9   24   27-50     11-34  (197)
 51 cd08434 PBP2_GltC_like The sub  46.7      25 0.00054   21.1   2.6   26   26-51     11-36  (195)
 52 cd08483 PBP2_HvrB The C-termin  46.4      31 0.00066   20.9   3.0   25   26-50     11-35  (190)
 53 COG1182 AcpD Acyl carrier prot  46.1      30 0.00064   24.5   3.2   52   12-64      5-57  (202)
 54 cd08479 PBP2_CrgA_like_9 The C  45.7      37  0.0008   20.6   3.4   27   25-51     11-37  (198)
 55 cd08453 PBP2_IlvR The C-termin  45.7      31 0.00067   21.1   3.0   26   26-51     11-36  (200)
 56 cd08432 PBP2_GcdR_TrpI_HvrB_Am  45.5      39 0.00085   20.3   3.4   28   25-52     10-37  (194)
 57 PRK14003 potassium-transportin  45.4      30 0.00065   24.3   3.1   46   17-62     93-140 (194)
 58 PRK13996 potassium-transportin  45.2      19  0.0004   25.4   2.1   44   17-60     91-141 (197)
 59 cd08425 PBP2_CynR The C-termin  45.0      32 0.00069   20.9   3.0   27   25-51     11-37  (197)
 60 cd08472 PBP2_CrgA_like_3 The C  44.9      43 0.00093   20.3   3.6   25   26-50     12-36  (202)
 61 cd08437 PBP2_MleR The substrat  44.5      31 0.00068   21.0   2.9   25   27-51     12-36  (198)
 62 cd08478 PBP2_CrgA The C-termin  44.3      27 0.00059   21.3   2.6   26   25-50     13-38  (199)
 63 PF04690 YABBY:  YABBY protein;  44.0      15 0.00032   25.3   1.5   19   27-45    130-148 (170)
 64 cd08445 PBP2_BenM_CatM_CatR Th  43.9      35 0.00076   21.1   3.1   26   26-51     12-37  (203)
 65 cd08421 PBP2_LTTR_like_1 The C  43.4      35 0.00076   20.7   3.0   24   28-51     13-36  (198)
 66 cd08474 PBP2_CrgA_like_5 The C  43.1      41 0.00088   20.5   3.3   26   26-51     14-39  (202)
 67 cd08441 PBP2_MetR The C-termin  42.8      46   0.001   20.3   3.5   24   28-51     13-36  (198)
 68 cd08415 PBP2_LysR_opines_like   42.8      17 0.00037   22.0   1.5   26   26-51     11-36  (196)
 69 cd08423 PBP2_LTTR_like_6 The C  42.5      37 0.00081   20.4   3.0   25   27-51     12-36  (200)
 70 cd08422 PBP2_CrgA_like The C-t  42.1      35 0.00075   20.5   2.8   25   27-51     13-37  (197)
 71 PF07315 DUF1462:  Protein of u  42.0      48   0.001   20.9   3.4   33   17-52     12-44  (93)
 72 PRK13997 potassium-transportin  41.9      23 0.00049   24.9   2.1   45   17-61     87-138 (193)
 73 COG1653 UgpB ABC-type sugar tr  41.9      78  0.0017   22.2   4.9   26   27-52     45-70  (433)
 74 cd08419 PBP2_CbbR_RubisCO_like  41.5      39 0.00086   20.3   3.0   25   27-51     11-35  (197)
 75 cd08480 PBP2_CrgA_like_10 The   41.1      42 0.00091   20.7   3.1   25   26-50     12-36  (198)
 76 PLN02870 Probable galacturonos  41.0      23 0.00049   28.5   2.2   26    1-32      1-26  (533)
 77 TIGR02200 GlrX_actino Glutared  40.9      29 0.00064   18.7   2.2   23   11-33      1-23  (77)
 78 TIGR00681 kdpC K+-transporting  40.9      24 0.00052   24.7   2.1   44   17-60     84-133 (187)
 79 cd08449 PBP2_XapR The C-termin  40.6      39 0.00084   20.4   2.9   25   26-50     11-35  (197)
 80 cd08471 PBP2_CrgA_like_2 The C  40.5      51  0.0011   20.0   3.4   25   26-50     12-36  (201)
 81 cd08447 PBP2_LTTR_aromatics_li  40.4      48   0.001   20.0   3.3   26   26-51     11-36  (198)
 82 cd08411 PBP2_OxyR The C-termin  40.1      43 0.00093   20.4   3.0   23   28-50     14-36  (200)
 83 PF06244 DUF1014:  Protein of u  39.0      25 0.00055   22.9   1.9   20   26-45     80-99  (122)
 84 cd08442 PBP2_YofA_SoxR_like Th  38.9      40 0.00087   20.2   2.7   26   27-52     12-37  (193)
 85 cd08459 PBP2_DntR_NahR_LinR_li  38.9      65  0.0014   19.6   3.7   27   26-52     11-37  (201)
 86 cd08458 PBP2_NocR The C-termin  38.7      39 0.00085   20.7   2.7   26   26-51     11-36  (196)
 87 cd08446 PBP2_Chlorocatechol Th  38.6      46   0.001   20.2   3.0   26   26-51     12-37  (198)
 88 TIGR00741 yfiA ribosomal subun  38.5      81  0.0018   18.3   4.0   32   12-44      3-34  (95)
 89 smart00367 LRR_CC Leucine-rich  38.4      13 0.00027   17.2   0.3   23    7-30      2-24  (26)
 90 cd08427 PBP2_LTTR_like_2 The C  38.4      50  0.0011   19.8   3.1   26   26-51     11-36  (195)
 91 cd08469 PBP2_PnbR The C-termin  38.3      57  0.0012   20.4   3.5   27   26-52     11-37  (221)
 92 PRK13999 potassium-transportin  37.7      30 0.00064   24.5   2.2   45   17-61     97-145 (201)
 93 cd08433 PBP2_Nac The C-teminal  37.6      35 0.00076   20.7   2.3   25   27-51     12-36  (198)
 94 cd08467 PBP2_SyrM The C-termin  37.2      46 0.00099   20.6   2.8   26   26-51     11-36  (200)
 95 cd08475 PBP2_CrgA_like_6 The C  37.0      47   0.001   20.0   2.8   25   26-50     12-36  (199)
 96 PRK00315 potassium-transportin  36.8      29 0.00064   24.3   2.0   45   17-61     86-136 (193)
 97 cd08485 PBP2_ClcR The C-termin  36.2      37 0.00081   21.0   2.3   26   26-51     12-37  (198)
 98 PRK14001 potassium-transportin  36.2      32  0.0007   24.1   2.1   44   17-60     85-135 (189)
 99 cd08417 PBP2_Nitroaromatics_li  36.0      54  0.0012   19.9   3.0   26   26-51     11-36  (200)
100 cd08430 PBP2_IlvY The C-termin  36.0      32  0.0007   20.8   2.0   25   27-51     12-36  (199)
101 smart00329 BPI2 BPI/LBP/CETP C  35.8      91   0.002   21.0   4.3   33   29-61     48-80  (202)
102 COG1570 XseA Exonuclease VII,   35.6      57  0.0012   25.7   3.6   30   19-52    142-171 (440)
103 PRK10470 ribosome hibernation   35.3      89  0.0019   18.5   3.8   27   18-44      8-34  (95)
104 KOG1909|consensus               34.8      35 0.00075   26.4   2.3   36    7-48    241-276 (382)
105 PTZ00062 glutaredoxin; Provisi  34.7 1.1E+02  0.0023   21.3   4.6   37   12-52     21-57  (204)
106 cd08462 PBP2_NodD The C-termin  34.6      62  0.0013   19.9   3.1   26   26-51     11-36  (200)
107 cd08484 PBP2_LTTR_beta_lactama  34.1      71  0.0015   19.3   3.3   27   26-52     11-37  (189)
108 cd08468 PBP2_Pa0477 The C-term  33.3      72  0.0016   19.6   3.3   25   27-51     12-36  (202)
109 cd02989 Phd_like_TxnDC9 Phosdu  33.2      97  0.0021   18.9   3.8   34   11-48     25-58  (113)
110 cd08451 PBP2_BudR The C-termin  33.2      43 0.00093   20.2   2.2   23   29-51     15-37  (199)
111 PLN02757 sirohydrochlorine fer  33.0      30 0.00065   22.9   1.5   30   29-58     91-120 (154)
112 PRK14002 potassium-transportin  32.4      36 0.00078   23.8   1.9   45   17-61     81-132 (186)
113 TIGR02036 dsdC D-serine deamin  32.1      74  0.0016   22.1   3.5   28   26-53    107-134 (302)
114 cd08413 PBP2_CysB_like The C-t  31.9      47   0.001   20.5   2.3   26   26-51     11-36  (198)
115 PLN02958 diacylglycerol kinase  31.6      91   0.002   24.2   4.2   44   10-53    112-155 (481)
116 PF02482 Ribosomal_S30AE:  Sigm  31.5      97  0.0021   17.9   3.5   32   12-44      2-33  (97)
117 cd00026 BPI2 BPI/LBP/CETP C-te  31.2 1.3E+02  0.0028   20.3   4.5   32   30-61     44-75  (200)
118 PF09457 RBD-FIP:  FIP domain ;  31.1      18 0.00039   20.0   0.2   20   25-44     25-44  (48)
119 cd08463 PBP2_DntR_like_4 The C  30.6      74  0.0016   19.9   3.1   25   26-50     11-35  (203)
120 KOG0863|consensus               30.4      24 0.00052   25.9   0.8   25   19-43    161-185 (264)
121 cd03026 AhpF_NTD_C TRX-GRX-lik  30.3 1.2E+02  0.0026   17.9   5.8   37   11-51     15-51  (89)
122 PRK13994 potassium-transportin  30.2      40 0.00086   24.3   1.9   45   17-61    111-166 (222)
123 KOG1777|consensus               30.2      39 0.00085   27.3   2.0   24   48-71    421-444 (625)
124 cd03051 GST_N_GTT2_like GST_N   30.0      93   0.002   16.4   4.1   19   13-31      2-20  (74)
125 PF02638 DUF187:  Glycosyl hydr  29.8      77  0.0017   23.1   3.3   29   24-52    203-231 (311)
126 TIGR02196 GlrX_YruB Glutaredox  29.8      61  0.0013   16.9   2.2   21   12-32      2-22  (74)
127 PF13504 LRR_7:  Leucine rich r  29.7      23 0.00049   15.1   0.4   11    8-18      2-12  (17)
128 COG0607 PspE Rhodanese-related  29.0      75  0.0016   18.3   2.7   24   10-33     61-84  (110)
129 PF07205 DUF1413:  Domain of un  28.4      93   0.002   17.7   3.0   33   18-50     27-59  (70)
130 PF08073 CHDNT:  CHDNT (NUC034)  28.2      83  0.0018   17.9   2.6   22   25-46     15-36  (55)
131 cd08457 PBP2_OccR The C-termin  27.9      45 0.00097   20.3   1.6   26   26-51     11-36  (196)
132 cd07945 DRE_TIM_CMS Leptospira  27.8 1.1E+02  0.0024   21.9   3.9   35   13-49    163-197 (280)
133 KOG3239|consensus               27.3      32 0.00069   24.2   0.9   26   12-37     20-45  (193)
134 COG4097 Predicted ferric reduc  27.1      64  0.0014   25.4   2.6   44   10-59    344-388 (438)
135 PF11247 DUF2675:  Protein of u  26.9      47   0.001   21.1   1.6   15   24-38     68-82  (98)
136 PRK09375 quinolinate synthetas  26.9      93   0.002   23.3   3.4   33   16-48    223-268 (319)
137 PLN02659 Probable galacturonos  26.9      52  0.0011   26.5   2.2   25    1-31      1-25  (534)
138 cd02066 GRX_family Glutaredoxi  26.5      67  0.0015   16.5   2.0   21   12-32      2-22  (72)
139 PF10262 Rdx:  Rdx family;  Int  26.5      69  0.0015   18.4   2.2   36   11-50      2-39  (76)
140 PF12876 Cellulase-like:  Sugar  26.5      60  0.0013   19.0   1.9   27   23-49     37-63  (88)
141 PRK10696 tRNA 2-thiocytidine b  26.2      64  0.0014   22.6   2.3   25   22-46    206-230 (258)
142 PF10607 CLTH:  CTLH/CRA C-term  26.0      48   0.001   20.7   1.5   29   21-49     15-43  (145)
143 PF09822 ABC_transp_aux:  ABC-t  25.8 1.9E+02  0.0041   20.0   4.7   39   12-50     29-69  (271)
144 cd06544 GH18_narbonin Narbonin  25.5      57  0.0012   23.2   2.0   20   32-51     59-78  (253)
145 PRK13995 potassium-transportin  25.1 1.1E+02  0.0023   21.8   3.2   44   17-60     95-145 (203)
146 PF07735 FBA_2:  F-box associat  25.0 1.2E+02  0.0026   16.6   2.9   36    7-47     32-67  (70)
147 cd02976 NrdH NrdH-redoxin (Nrd  24.8      82  0.0018   16.4   2.2   21   12-32      2-22  (73)
148 PRK11139 DNA-binding transcrip  24.8      86  0.0019   21.5   2.7   25   27-51    106-130 (297)
149 COG1393 ArsC Arsenate reductas  24.4      71  0.0015   20.3   2.1   23   11-33      2-24  (117)
150 PF01547 SBP_bac_1:  Bacterial   24.1      67  0.0015   21.3   2.1   23   29-51      9-32  (315)
151 PF13516 LRR_6:  Leucine Rich r  24.0      19 0.00041   16.1  -0.5   20    7-28      2-21  (24)
152 TIGR00269 conserved hypothetic  23.9      55  0.0012   20.1   1.5   24   22-45     34-57  (104)
153 cd01388 SOX-TCF_HMG-box SOX-TC  23.7      54  0.0012   18.4   1.3   18   28-45     11-28  (72)
154 PRK10837 putative DNA-binding   23.7 1.1E+02  0.0024   20.6   3.1   26   26-51    100-125 (290)
155 PRK09791 putative DNA-binding   23.7 1.1E+02  0.0024   21.0   3.1   37   10-51     95-131 (302)
156 PRK11151 DNA-binding transcrip  23.3 1.5E+02  0.0032   20.4   3.7   26   26-51    102-127 (305)
157 PRK10324 translation inhibitor  22.7   2E+02  0.0044   17.9   4.1   32   12-44      3-34  (113)
158 cd03027 GRX_DEP Glutaredoxin (  22.7 1.2E+02  0.0026   16.6   2.7   22   11-32      2-23  (73)
159 PF01624 MutS_I:  MutS domain I  22.6      69  0.0015   19.6   1.8   21   31-51      4-24  (113)
160 TIGR02174 CXXU_selWTH selT/sel  22.5 1.6E+02  0.0036   16.7   5.6   38   12-53      1-38  (72)
161 cd00552 RaiA RaiA ("ribosome-a  22.5   1E+02  0.0023   17.7   2.5   27   18-44      7-33  (93)
162 PF13552 DUF4127:  Protein of u  22.5      74  0.0016   24.9   2.3   19   32-50     92-110 (497)
163 PRK11716 DNA-binding transcrip  22.4 1.3E+02  0.0029   19.8   3.3   25   27-51     79-103 (269)
164 PRK10974 glycerol-3-phosphate   22.4 1.2E+02  0.0026   22.2   3.3   25   26-50     38-62  (438)
165 PRK09508 leuO leucine transcri  22.3 1.4E+02   0.003   20.8   3.5   26   26-51    123-148 (314)
166 PRK09801 transcriptional activ  22.2 1.5E+02  0.0032   20.8   3.6   28   24-51    105-132 (310)
167 TIGR01616 nitro_assoc nitrogen  22.2   2E+02  0.0043   18.3   3.9   23   11-33      2-24  (126)
168 PF09217 EcoRII-N:  Restriction  22.1      50  0.0011   22.6   1.1   40   24-63     33-74  (156)
169 cd03052 GST_N_GDAP1 GST_N fami  22.0      94   0.002   17.3   2.1   20   12-31      1-20  (73)
170 PRK13337 putative lipid kinase  22.0 2.1E+02  0.0045   20.3   4.3   42   10-52      2-43  (304)
171 PRK10341 DNA-binding transcrip  22.0 1.4E+02  0.0031   20.7   3.4   37   10-51     97-133 (312)
172 PF14459 Prok-E2_C:  Prokaryoti  21.8 1.3E+02  0.0028   19.8   2.9   22   26-47     38-60  (131)
173 COG2871 NqrF Na+-transporting   21.8 1.7E+02  0.0037   22.6   4.0   37   10-51    305-342 (410)
174 PF02960 K1:  K1 glycoprotein;   21.8      35 0.00076   22.5   0.3   43   22-64     30-72  (130)
175 PRK14997 LysR family transcrip  21.8 1.7E+02  0.0037   20.0   3.8   27   26-52    103-129 (301)
176 KOG1454|consensus               21.7      88  0.0019   22.9   2.4   26   33-58    282-307 (326)
177 PRK10026 arsenate reductase; P  21.7   2E+02  0.0044   18.9   3.9   23   11-33      3-25  (141)
178 PRK12681 cysB transcriptional   21.6 1.3E+02  0.0028   21.4   3.2   36   11-51     94-129 (324)
179 cd03045 GST_N_Delta_Epsilon GS  21.6 1.2E+02  0.0025   16.3   2.4   20   12-31      1-20  (74)
180 PF00505 HMG_box:  HMG (high mo  21.5      66  0.0014   17.3   1.4   18   28-45     10-27  (69)
181 PRK11914 diacylglycerol kinase  21.4 1.6E+02  0.0034   20.9   3.6   41    8-49      7-47  (306)
182 PRK11074 putative DNA-binding   21.3 1.1E+02  0.0023   21.2   2.7   37   10-51     92-128 (300)
183 COG5575 ORC2 Origin recognitio  21.3      73  0.0016   25.4   2.0   27   25-51    493-519 (535)
184 PF10691 DUF2497:  Protein of u  21.0      87  0.0019   18.6   1.9   14   26-39     47-60  (73)
185 PRK03601 transcriptional regul  21.0 1.7E+02  0.0037   20.0   3.6   26   26-51    100-125 (275)
186 cd02987 Phd_like_Phd Phosducin  20.8 1.7E+02  0.0037   19.4   3.5   36   11-50     86-121 (175)
187 PLN02495 oxidoreductase, actin  20.7 1.1E+02  0.0025   23.3   2.9   28   22-50     93-120 (385)
188 TIGR03418 chol_sulf_TF putativ  20.5 1.3E+02  0.0028   20.4   2.9   27   26-52    100-126 (291)
189 PF02886 LBP_BPI_CETP_C:  LBP /  20.5      77  0.0017   21.5   1.8   33   29-61     80-112 (238)
190 cd02973 TRX_GRX_like Thioredox  20.2 1.6E+02  0.0034   15.6   5.2   36   11-50      2-37  (67)
191 cd03005 PDI_a_ERp46 PDIa famil  20.1 1.2E+02  0.0027   17.0   2.4   41   11-51     19-59  (102)
192 PRK15421 DNA-binding transcrip  20.1 1.4E+02  0.0031   21.0   3.2   25   27-51    101-125 (317)
193 PRK10086 DNA-binding transcrip  20.1 1.7E+02  0.0036   20.4   3.5   28   25-52    112-139 (311)
194 cd03034 ArsC_ArsC Arsenate Red  20.1 1.8E+02  0.0039   17.8   3.3   22   12-33      1-22  (112)

No 1  
>KOG3445|consensus
Probab=99.93  E-value=2.2e-26  Score=152.83  Aligned_cols=63  Identities=30%  Similarity=0.518  Sum_probs=61.3

Q ss_pred             cccccCceEEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEEcCCCCCEEEEEecCC
Q psy15303          3 TRFGSKLKELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRECSGVTPVVWARIPTI   65 (72)
Q Consensus         3 ~~f~~qLk~L~~~yC~~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v~~~~g~~P~l~a~Y~n~   65 (72)
                      -+|++||++|+|+||+|||||+|||+||++.|++|+++||+|+|++..++|+||.|+|+|.|+
T Consensus        17 gryv~ql~rit~sfCnwggSSrGmR~Fle~~L~~~a~enP~v~i~v~~rrg~hP~lraeY~NG   79 (145)
T KOG3445|consen   17 GRYVWQLRRITVSFCNWGGSSRGMREFLESELPDLARENPGVVIYVEPRRGQHPLLRAEYLNG   79 (145)
T ss_pred             hhhhheeeEEEEEEecCCCccHHHHHHHHHHHHHHHhhCCCeEEEEeccCCCCceEEEEecCC
Confidence            379999999999999999999999999999999999999999999999999999999999994


No 2  
>KOG3446|consensus
Probab=99.88  E-value=7.1e-24  Score=132.18  Aligned_cols=64  Identities=59%  Similarity=0.992  Sum_probs=60.2

Q ss_pred             ccccCceEEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEEcCCCCCEEEEEecCCcc
Q psy15303          4 RFGSKLKELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRECSGVTPVVWARIPTIGC   67 (72)
Q Consensus         4 ~f~~qLk~L~~~yC~~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v~~~~g~~P~l~a~Y~n~~~   67 (72)
                      .|...||||||+.|+.|+.|+|+|+||+++|+++|+.||++||+||+|.|..|+++|+|+++-+
T Consensus        10 s~~~~lkElRI~lcqkspaSagvR~fvEk~Y~~lKkaNP~lPILIREcSgVqPrl~ARY~~G~E   73 (97)
T KOG3446|consen   10 SFTLKLKELRIHLCQKSPASAGVREFVEKFYVNLKKANPDLPILIRECSGVQPRLWARYGNGVE   73 (97)
T ss_pred             ccchhhhhheeeecCCCCcchhHHHHHHHhhhhhhhcCCCCcEeehhhcCCchHHHHHhcCCce
Confidence            4566799999999999999999999999999999999999999999999999999999999433


No 3  
>PF05047 L51_S25_CI-B8:  Mitochondrial ribosomal protein L51 / S25 / CI-B8 domain ;  InterPro: IPR007741 Proteins containing this domain are located in the mitochondrion and include ribosomal protein L51, and S25. This domain is also found in mitochondrial NADH-ubiquinone oxidoreductase B8 subunit (CI-B8) 1.6.5.3 from EC. It is not known whether all members of this family form part of the NADH-ubiquinone oxidoreductase and whether they are also all ribosomal proteins.; PDB: 1S3A_A.
Probab=99.58  E-value=5e-15  Score=82.70  Aligned_cols=40  Identities=33%  Similarity=0.403  Sum_probs=32.5

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEcCCCCCEEEEEecCC
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVRECSGVTPVVWARIPTI   65 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~~g~~P~l~a~Y~n~   65 (72)
                      ||+|++++||+||++||+|+|+|+++++.||.++|+|.|+
T Consensus         1 ~R~F~~~~lp~l~~~NP~v~~~v~~~~~~~P~~~~~y~~G   40 (52)
T PF05047_consen    1 ARDFLKNNLPTLKYHNPQVQFEVRRRRGRHPFLTAEYLNG   40 (52)
T ss_dssp             HHHHHHHTHHHHHHHSTT--EEEE---SSS-EEEEEESS-
T ss_pred             CHhHHHHhHHHHHHHCCCcEEEEEECCCCCCEEEEEEcCC
Confidence            7999999999999999999999999999999999999994


No 4  
>KOG4079|consensus
Probab=98.25  E-value=2.6e-07  Score=62.49  Aligned_cols=61  Identities=18%  Similarity=0.317  Sum_probs=57.8

Q ss_pred             ccccCceEEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEEcCCCCCEEEEEecC
Q psy15303          4 RFGSKLKELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRECSGVTPVVWARIPT   64 (72)
Q Consensus         4 ~f~~qLk~L~~~yC~~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v~~~~g~~P~l~a~Y~n   64 (72)
                      .|...++-.++.|..+++...|+|+|+--|+|+++.+||.|+++........|++++..+.
T Consensus        23 vlkD~V~vfsvnynt~g~~~~GARdFVfwNipQiQykNP~VQ~~~~knmtpsPF~R~Yldd   83 (169)
T KOG4079|consen   23 VLKDNVNVFSVNYNTNGPEQSGARDFVFWNIPQIQYKNPKVQLVKHKNMTPSPFARAYLDD   83 (169)
T ss_pred             EEeccceEEEEeccCCCccccCccceEEecchhhcccCCceEEEeeccCCCChHHHheecC
Confidence            5778899999999999999999999999999999999999999999999999999998877


No 5  
>PF10780 MRP_L53:  39S ribosomal protein L53/MRP-L53;  InterPro: IPR019716 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ].  Mitochondrial ribosomal protein L53 (also known as L44) is part of the 39S ribosome []. 
Probab=96.76  E-value=0.0023  Score=36.01  Aligned_cols=48  Identities=17%  Similarity=0.137  Sum_probs=40.9

Q ss_pred             ecCCCCCCHHHHHHHHhC--HHHHHHhCCCCeEEEEEcCCCCCEEEEEecC
Q psy15303         16 LCQKGGSSSGVRDFLAQH--YVPLKQANPKFPILVRECSGVTPVVWARIPT   64 (72)
Q Consensus        16 yC~~~~sS~GvR~Fl~~~--l~~~k~~NP~v~i~v~~~~g~~P~l~a~Y~n   64 (72)
                      ||..++.++.+|+||..-  -.....-||+.++..+.. ...|.|...|.+
T Consensus         1 FnPF~~~aksaR~FL~~ip~s~k~~~tni~~~vl~~~~-~~~P~v~V~fkd   50 (51)
T PF10780_consen    1 FNPFSPNAKSARLFLSLIPPSAKARGTNINCEVLPRVS-RSEPSVTVTFKD   50 (51)
T ss_pred             CCCCCcccHHHHHHHHhcCCccccccCCCceEEecCCC-CCCCeEEEEecc
Confidence            688999999999999864  445566899999999888 679999999988


No 6  
>PF13701 DDE_Tnp_1_4:  Transposase DDE domain group 1
Probab=69.09  E-value=7.3  Score=29.93  Aligned_cols=35  Identities=37%  Similarity=0.445  Sum_probs=31.4

Q ss_pred             CCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEEcCC
Q psy15303         19 KGGSSSGVRDFLAQHYVPLKQANPKFPILVRECSG   53 (72)
Q Consensus        19 ~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v~~~~g   53 (72)
                      +..||+|+.+||+.-+..+.+.-|+++|++|-..|
T Consensus       193 n~~sa~g~~~fL~~~l~~lr~~~~~~~ILvR~DSg  227 (448)
T PF13701_consen  193 NVHSAKGAAEFLKRVLRRLRQRWPDTRILVRGDSG  227 (448)
T ss_pred             CCChHHHHHHHHHHHHHHHhhhCccceEEEEecCc
Confidence            35689999999999999999999999999998764


No 7  
>TIGR01159 DRP1 density-regulated protein DRP1. This protein family shows weak but suggestive similarity to translation initiation factor SUI1 and its prokaryotic homologs.
Probab=65.57  E-value=3.9  Score=28.18  Aligned_cols=25  Identities=16%  Similarity=0.279  Sum_probs=22.1

Q ss_pred             EEecCCCCCCHHHHHHHHhCHHHHH
Q psy15303         14 IHLCQKGGSSSGVRDFLAQHYVPLK   38 (72)
Q Consensus        14 ~~yC~~~~sS~GvR~Fl~~~l~~~k   38 (72)
                      .-||+.|++-+-=++||++|.|++-
T Consensus        14 ~EyCEf~~~~~kCk~WL~~n~p~l~   38 (173)
T TIGR01159        14 PEYCEFSGDLKRCKVWLSENAPDLY   38 (173)
T ss_pred             hHHhcCCCCHHHHHHHHHHhChHHH
Confidence            4699999999999999999888654


No 8  
>PF02601 Exonuc_VII_L:  Exonuclease VII, large subunit;  InterPro: IPR020579 Exonuclease VII 3.1.11.6 from EC is composed of two nonidentical subunits; one large subunit and 4 small ones []. Exonuclease VII catalyses exonucleolytic cleavage in either 5'-3' or 3'-5' direction to yield 5'-phosphomononucleotides. The large subunit also contains the OB-fold domains (IPR004365 from INTERPRO) that bind to nucleic acids at the N terminus.  This entry represents Exonuclease VII, large subunit, C-terminal. ; GO: 0008855 exodeoxyribonuclease VII activity
Probab=65.42  E-value=11  Score=27.09  Aligned_cols=39  Identities=26%  Similarity=0.422  Sum_probs=28.8

Q ss_pred             cCceEEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEEcC
Q psy15303          7 SKLKELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRECS   52 (72)
Q Consensus         7 ~qLk~L~~~yC~~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v~~~~   52 (72)
                      .-.++|=+-   +|++++|++||+..    +++.+|.++|.+.+..
T Consensus        12 ~~p~~I~vI---Ts~~gAa~~D~~~~----~~~r~~~~~~~~~p~~   50 (319)
T PF02601_consen   12 KFPKRIAVI---TSPTGAAIQDFLRT----LKRRNPIVEIILYPAS   50 (319)
T ss_pred             CCCCEEEEE---eCCchHHHHHHHHH----HHHhCCCcEEEEEecc
Confidence            334444444   46779999999864    5669999999998764


No 9  
>PF13692 Glyco_trans_1_4:  Glycosyl transferases group 1; PDB: 3OY2_A 3OY7_B 2Q6V_A 2HY7_A 3CV3_A 3CUY_A.
Probab=65.09  E-value=8.8  Score=23.01  Aligned_cols=39  Identities=13%  Similarity=0.267  Sum_probs=27.7

Q ss_pred             EEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         13 RIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        13 ~~~yC~~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      .+-|-......+|+..+++.-+..++++.|++.+.+.-.
T Consensus         4 ~i~~~g~~~~~k~~~~li~~~~~~l~~~~p~~~l~i~G~   42 (135)
T PF13692_consen    4 YIGYLGRIRPDKGLEELIEAALERLKEKHPDIELIIIGN   42 (135)
T ss_dssp             EEE--S-SSGGGTHHHHHH-HHHHHHHHSTTEEEEEECE
T ss_pred             cccccccccccccccchhhhHHHHHHHHCcCEEEEEEeC
Confidence            344444444558999999999999999999999888544


No 10 
>KOG0183|consensus
Probab=63.51  E-value=4.1  Score=29.55  Aligned_cols=19  Identities=42%  Similarity=0.646  Sum_probs=15.9

Q ss_pred             CCCCCCHHHHHHHHhCHHH
Q psy15303         18 QKGGSSSGVRDFLAQHYVP   36 (72)
Q Consensus        18 ~~~~sS~GvR~Fl~~~l~~   36 (72)
                      -+|-+|+.+|+|++++|.+
T Consensus       161 aiGr~sk~VrEflEK~y~e  179 (249)
T KOG0183|consen  161 AIGRSSKTVREFLEKNYKE  179 (249)
T ss_pred             ccccccHHHHHHHHHhccc
Confidence            4677999999999997754


No 11 
>cd05466 PBP2_LTTR_substrate The substrate binding domain of LysR-type transcriptional regulators (LTTRs), a member of the type 2 periplasmic binding fold protein superfamily. This model and hierarchy represent the the substrate-binding domain of the LysR-type transcriptional regulators that form the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA bin
Probab=60.11  E-value=17  Score=21.41  Aligned_cols=27  Identities=15%  Similarity=0.130  Sum_probs=22.2

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         25 GVRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        25 GvR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ....++...+.+|.+++|++.|.+...
T Consensus        10 ~~~~~l~~~i~~~~~~~p~i~i~~~~~   36 (197)
T cd05466          10 IAAYLLPPLLAAFRQRYPGVELSLVEG   36 (197)
T ss_pred             hHHHHhHHHHHHHHHHCCCCEEEEEEC
Confidence            456678888889999999999998764


No 12 
>COG4837 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=59.99  E-value=13  Score=23.75  Aligned_cols=32  Identities=22%  Similarity=0.383  Sum_probs=27.5

Q ss_pred             cCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         17 CQKGGSSSGVRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        17 C~~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      |=+.|||+-.-+||+   +.+|++.|+.+|..+-.
T Consensus        19 CV~aPtsKdt~eWLe---aalkRKyp~~~F~~~Yi   50 (106)
T COG4837          19 CVNAPTSKDTYEWLE---AALKRKYPNQPFKYTYI   50 (106)
T ss_pred             hcCCCcchhHHHHHH---HHHhccCCCCCcEEEEE
Confidence            778999999999998   46899999999987654


No 13 
>cd08418 PBP2_TdcA The C-terminal substrate binding domain of LysR-type transcriptional regulator TdcA, which is involved in the degradation of L-serine and L-threonine, contains the type 2 periplasmic binding fold. TdcA, a member of the LysR family, activates the expression of the anaerobically-regulated tdcABCDEFG operon which is involved in the degradation of L-serine and L-threonine to acetate and propionate, respectively. The tdc operon is comprised of one regulatory gene tdcA and six structural genes, tdcB to tdcG. The expression of the tdc operon is affected by several transcription factors including the cAMP receptor protein (CRP), integration host factor (IHF), histone-like protein (HU), and the operon specific regulators TdcA and TcdR. TcdR is divergently transcribed from the operon and encodes a small protein that is required for efficient expression of the Escherichia coli tdc operon.  This substrate-binding domain shows significant homology to the type 2 periplasmic binding
Probab=59.15  E-value=15  Score=22.30  Aligned_cols=29  Identities=17%  Similarity=0.138  Sum_probs=23.9

Q ss_pred             CHHHHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         23 SSGVRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        23 S~GvR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ......++..-+.+|++++|++.+.+...
T Consensus         8 ~~~~~~~l~~~l~~~~~~~P~i~l~i~~~   36 (201)
T cd08418           8 SLIAHTLMPAVINRFKEQFPDVQISIYEG   36 (201)
T ss_pred             hHHHHhhhHHHHHHHHHHCCCceEEEEeC
Confidence            34567788889999999999999998753


No 14 
>cd08429 PBP2_NhaR The C-terminal substrate binding domain of LysR-type transcriptional activator of the nhaA gene, encoding Na+/H+ antiporter, contains the type 2 periplasmic binding fold. NhaR is a positive regulator of the LysR family and is known to be an activator of the nhaA gene encoding a Na(+)/H(+) antiporter. In Escherichia coli, NhaA is the vital antiporter that protects against high sodium stress, and it is essential for growth in high sodium levels, while NhaB becomes essential only if NhaA is not available. The nhaA gene of nhaAR operon is induced by monovalent cations. The nhaR of the operon activates nhaAR, as well as the osmC transcription which is induced at elevated osmolarity. OsmC is transcribed from the two overlapping promoters (osmCp1 and osmP2) and that NhaR is shown to activate only the expression of osmCp1. NhaR also activates the transcription of the pgaABCD operon which is required for production of the biofilm adhesion, poly-beta-1,6-N-acetyl-d-glucosamine 
Probab=58.60  E-value=16  Score=23.22  Aligned_cols=29  Identities=10%  Similarity=0.122  Sum_probs=24.3

Q ss_pred             HHHHHHHHhCHHHHHHhCCCCeEEEEEcC
Q psy15303         24 SGVRDFLAQHYVPLKQANPKFPILVRECS   52 (72)
Q Consensus        24 ~GvR~Fl~~~l~~~k~~NP~v~i~v~~~~   52 (72)
                      .-...|+...+.+|.+.+|++++.+....
T Consensus         9 ~~~~~~l~~~l~~f~~~~P~v~l~i~~~~   37 (204)
T cd08429           9 AVPKSIAYRLLEPAMDLHEPIRLVCREGK   37 (204)
T ss_pred             hhhHHHHHHHHHHHHHhCCCcEEEEEeCC
Confidence            34578899999999999999999998743


No 15 
>cd08470 PBP2_CrgA_like_1 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding domain. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 1. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene
Probab=57.76  E-value=17  Score=22.18  Aligned_cols=25  Identities=20%  Similarity=0.219  Sum_probs=21.8

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEE
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVRE   50 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~   50 (72)
                      ...++...+.+|++++|++.+.+..
T Consensus        12 ~~~~l~~~l~~f~~~~P~v~l~i~~   36 (197)
T cd08470          12 GERFIAPLVNDFMQRYPKLEVDIEL   36 (197)
T ss_pred             HHHHHHHHHHHHHHHCCCeEEEEEe
Confidence            4567889999999999999999975


No 16 
>cd08435 PBP2_GbpR The C-terminal substrate binding domain of galactose-binding protein regulator contains the type 2 periplasmic binding fold. Galactose-binding protein regulator (GbpR), a member of the LysR family of bacterial transcriptional regulators, regulates the expression of chromosomal virulence gene chvE.   The chvE gene is involved in the uptake of specific sugars, in chemotaxis to these sugars, and in the VirA-VirG two-component signal transduction system. In the presence of an inducing sugar such as L-arabinose, D-fucose, or D-galactose, GbpR activates chvE expression, while in the absence of an inducing sugar, GbpR represses expression. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a ma
Probab=56.34  E-value=19  Score=21.79  Aligned_cols=26  Identities=19%  Similarity=0.241  Sum_probs=22.4

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++...+.+|++.+|++.+.+...
T Consensus        11 ~~~~l~~~l~~~~~~~P~v~i~i~~~   36 (201)
T cd08435          11 APVLLPPAIARLLARHPRLTVRVVEG   36 (201)
T ss_pred             HHHHHHHHHHHHHHHCCCeEEEEEeC
Confidence            45778899999999999999999754


No 17 
>cd08481 PBP2_GcdR_like The C-terminal substrate binding domain of LysR-type transcriptional regulators GcdR-like, contains the type 2 periplasmic binding fold. GcdR is involved in the glutaconate/glutarate-specific activation of the Pg promoter driving expression of a glutaryl-CoA dehydrogenase-encoding gene (gcdH). The GcdH protein is essential for the anaerobic catabolism of many aromatic compounds and some alicyclic and dicarboxylic acids.  The structural topology of this substrate-binding domain is most similar to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplas
Probab=54.74  E-value=23  Score=21.33  Aligned_cols=26  Identities=8%  Similarity=0.153  Sum_probs=21.8

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEEcC
Q psy15303         27 RDFLAQHYVPLKQANPKFPILVRECS   52 (72)
Q Consensus        27 R~Fl~~~l~~~k~~NP~v~i~v~~~~   52 (72)
                      ..++...+.+|.+++|++.|.+....
T Consensus        12 ~~~l~~~l~~f~~~~P~i~i~i~~~~   37 (194)
T cd08481          12 TRWLIPRLPDFLARHPDITVNLVTRD   37 (194)
T ss_pred             HHHHHhhhhHHHHHCCCceEEEEecc
Confidence            45778889999999999999998643


No 18 
>TIGR02136 ptsS_2 phosphate binding protein. Members of this family are phosphate-binding proteins. Most are found in phosphate ABC-transporter operons, but some are found in phosphate regulatory operons. This model separates members of the current family from the phosphate ABC transporter phosphate binding protein described by TIGRFAMs model TIGR00975.
Probab=54.14  E-value=15  Score=25.92  Aligned_cols=26  Identities=12%  Similarity=0.208  Sum_probs=22.6

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      +-.++..-+.+|++++|++.+.+.+.
T Consensus        46 ~~~~lp~~l~~f~~~~P~i~v~i~~~   71 (287)
T TIGR02136        46 VAPLAEAAAEEFQKIHPGVSVTVQGA   71 (287)
T ss_pred             HHHHHHHHHHHHHhhCCCceEEEccC
Confidence            44688999999999999999999774


No 19 
>cd08487 PBP2_BlaA The C-terminal substrate-binding domain of LysR-type trnascriptional regulator BlaA which involved in control of the beta-lactamase gene expression; contains the type 2 periplasmic binding fold. This CD represents the C-terminal substrate binding domain of LysR-type transcriptional regulator, BlaA, that involved in control of the expression of beta-lactamase genes, blaA and blaB.  Beta-lactamases are responsible for bacterial resistance to beta-lactam antibiotics such as penicillins.  The blaA gene is located just upstream of blaB in the opposite direction and regulates the expression of the blaB. BlaA also negatively auto-regulates the expression of its own gene, blaA. BlaA (a constitutive class A penicllinase) belongs to the LysR family of transcriptional regulators, whereas BlaB (an inducible class C cephalosporinase or AmpC) can be referred to as a penicillin binding protein but it does not act as a beta-lactamase. The topology of this substrate-binding domain is 
Probab=52.70  E-value=24  Score=21.39  Aligned_cols=26  Identities=15%  Similarity=0.284  Sum_probs=21.6

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++...+.+|++++|++.+.+...
T Consensus        11 ~~~~l~~~l~~f~~~~P~i~l~i~~~   36 (189)
T cd08487          11 AVGWLLPRLAEFRQLHPFIELRLRTN   36 (189)
T ss_pred             HHHHHhHHHHHHHHHCCCceEEeeec
Confidence            45677778999999999999998764


No 20 
>cd08482 PBP2_TrpI The C-terminal substrate binding domain of LysR-type transcriptional regulator TrpI, which is involved in control of tryptophan synthesis, contains type 2 periplasmic binding fold. TrpI and indoleglycerol phosphate (InGP), are required to activate transcription of the trpBA, the genes for tryptophan synthase. The trpBA is induced by the InGp substrate, rather than by tryptophan, but the exact mechanism of the activation event is not known. This substrate-binding domain of TrpI shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cy
Probab=52.63  E-value=23  Score=21.75  Aligned_cols=28  Identities=11%  Similarity=0.188  Sum_probs=22.9

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEEcC
Q psy15303         25 GVRDFLAQHYVPLKQANPKFPILVRECS   52 (72)
Q Consensus        25 GvR~Fl~~~l~~~k~~NP~v~i~v~~~~   52 (72)
                      ....++...+.+|.+++|++.+.+....
T Consensus        10 ~~~~~l~~~i~~f~~~~P~v~i~~~~~~   37 (195)
T cd08482          10 LLMRWLIPRLPAFQAALPDIDLQLSASD   37 (195)
T ss_pred             HHHHHHHhhHHHHHHHCCCceEEEEecC
Confidence            3457888889999999999999987543


No 21 
>cd08440 PBP2_LTTR_like_4 TThe C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor.  The genes controlled by the LTTRs have diverse funct
Probab=52.57  E-value=22  Score=21.27  Aligned_cols=26  Identities=12%  Similarity=0.354  Sum_probs=21.8

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++...+..|.+++|++.|.+.+.
T Consensus        11 ~~~~l~~~l~~~~~~~p~v~i~i~~~   36 (197)
T cd08440          11 AATLLPPVLAAFRRRHPGIRVRLRDV   36 (197)
T ss_pred             hhhHHHHHHHHHHHhCCCcEEEEEeC
Confidence            34677888999999999999999764


No 22 
>cd08456 PBP2_LysR The C-terminal substrate binding domain of LysR, transcriptional regulator for lysine biosynthesis, contains the type 2 periplasmic binding fold. LysR, the transcriptional activator of lysA encoding diaminopimelate decarboxylase, catalyses the decarboxylation of diaminopimelate to produce lysine. The LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational
Probab=51.98  E-value=22  Score=21.54  Aligned_cols=27  Identities=19%  Similarity=0.265  Sum_probs=22.4

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         25 GVRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        25 GvR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      -...++...+.+|.+++|++.+.+...
T Consensus        10 ~~~~~l~~~l~~~~~~~P~i~~~i~~~   36 (196)
T cd08456          10 LSQSFLPRAIKAFLQRHPDVTISIHTR   36 (196)
T ss_pred             HHHhhHHHHHHHHHHHCCCcEEEEEeC
Confidence            345678899999999999999999764


No 23 
>cd08461 PBP2_DntR_like_3 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold. This CD includes an uncharacterized LysR-type transcriptional regulator similar to DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded.  This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytra
Probab=51.87  E-value=22  Score=21.65  Aligned_cols=26  Identities=19%  Similarity=0.388  Sum_probs=22.4

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++...+.+|++++|++.+.+...
T Consensus        11 ~~~~l~~~l~~f~~~~P~v~i~i~~~   36 (198)
T cd08461          11 QKAILPPLLAALRQEAPGVRVAIRDL   36 (198)
T ss_pred             HHHHhHHHHHHHHHHCCCcEEEEeeC
Confidence            45678899999999999999999764


No 24 
>PF05762 VWA_CoxE:  VWA domain containing CoxE-like protein;  InterPro: IPR008912 This group of proteins contains a VWA type domain and the function of this family is unknown. It is found as part of a CO oxidising (Cox) system operon in several bacteria [].
Probab=51.58  E-value=33  Score=23.58  Aligned_cols=40  Identities=20%  Similarity=0.397  Sum_probs=33.8

Q ss_pred             EEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEEcC
Q psy15303         13 RIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRECS   52 (72)
Q Consensus        13 ~~~yC~~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v~~~~   52 (72)
                      .+..||.|||=.+.-.|+-.-+-.+....+.+.+.+....
T Consensus        60 lvvl~DvSGSM~~~s~~~l~~~~~l~~~~~~~~~f~F~~~   99 (222)
T PF05762_consen   60 LVVLCDVSGSMAGYSEFMLAFLYALQRQFRRVRVFVFSTR   99 (222)
T ss_pred             EEEEEeCCCChHHHHHHHHHHHHHHHHhCCCEEEEEEeee
Confidence            4567999999999888988888899999999988876543


No 25 
>cd08488 PBP2_AmpR The C-terminal substrate domain of LysR-type transcriptional regulator AmpR that involved in control of the expression of beta-lactamase gene ampC, contains the type 2 periplasmic binding fold. AmpR acts as a transcriptional activator by binding to a DNA region immediately upstream of the ampC promoter. In the absence of a beta-lactam inducer, AmpR represses the synthesis of beta-lactamase, whereas expression is induced in the presence of a beta-lactam inducer. The AmpD, AmpG, and AmpR proteins are involved in the induction of AmpC-type beta-lactamase (class C) which produced by enterobacterial strains and many other gram-negative bacilli. The activation of ampC by AmpR requires ampG for induction or high-level expression of AmpC. It is probable that the AmpD and AmpG work together to modulate the ability of AmpR to activate ampC expression. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsibl
Probab=51.51  E-value=30  Score=21.20  Aligned_cols=26  Identities=8%  Similarity=0.193  Sum_probs=21.8

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEEcC
Q psy15303         27 RDFLAQHYVPLKQANPKFPILVRECS   52 (72)
Q Consensus        27 R~Fl~~~l~~~k~~NP~v~i~v~~~~   52 (72)
                      ..++...+.+|.+++|++.+.+....
T Consensus        12 ~~~l~~~l~~f~~~~P~v~i~~~~~~   37 (191)
T cd08488          12 VGWLLPRLADFQNRHPFIDLRLSTNN   37 (191)
T ss_pred             HHHHHhHHHHHHHHCCCcEEEEEecC
Confidence            35777789999999999999998654


No 26 
>cd08473 PBP2_CrgA_like_4 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 4. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene a
Probab=51.41  E-value=31  Score=20.94  Aligned_cols=26  Identities=15%  Similarity=0.264  Sum_probs=21.7

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++...+.+|++++|++.+.+...
T Consensus        14 ~~~~l~~~l~~~~~~~P~i~i~~~~~   39 (202)
T cd08473          14 AQELLAPLLPRFMAAYPQVRLQLEAT   39 (202)
T ss_pred             HHHHHHHHHHHHHHHCCCeEEEEEEc
Confidence            34677888999999999999999764


No 27 
>cd08465 PBP2_ToxR The C-terminal substrate binding domain of LysR-type transcriptional regulator ToxR regulates the expression of the toxoflavin biosynthesis genes; contains the type 2 periplasmic bindinig fold. In soil bacterium Burkholderia glumae, ToxR regulates the toxABCDE and toxFGHI operons in the presence of toxoflavin as a coinducer. Additionally, the expression of both operons requires a transcriptional activator, ToxJ, whose expression is regulated by the TofI or TofR quorum-sensing system. The biosynthesis of toxoflavin is suggested to be synthesized in a pathway common to the synthesis of riboflavin. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After
Probab=51.07  E-value=21  Score=22.20  Aligned_cols=26  Identities=19%  Similarity=0.267  Sum_probs=22.0

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++..-+..|++++|++++.+...
T Consensus        11 ~~~~l~~~l~~f~~~~P~i~l~i~~~   36 (200)
T cd08465          11 ARLVLPALMRQLRAEAPGIDLAVSQA   36 (200)
T ss_pred             HHHhhhHHHHHHHHHCCCcEEEEecC
Confidence            35778899999999999999988753


No 28 
>cd08452 PBP2_AlsR The C-terminal substrate binding domain of LysR-type trnascriptional regulator AlsR, which regulates acetoin formation under stationary phase growth conditions; contains the type 2 periplasmic binding fold. AlsR is responsible for activating the expression of the acetoin operon (alsSD) in response to inducing signals such as glucose and acetate.  Like many other LysR family proteins, AlsR is transcribed divergently from the alsSD operon. The alsS gene encodes acetolactate synthase, an enzyme involved in the production of acetoin in cells of stationary-phase. AlsS catalyzes the conversion of two pyruvate molecules to acetolactate and carbon dioxide. Acetolactate is then converted to acetoin at low pH by acetolactate decarboxylase which encoded by the alsD gene. Acetoin is an important physiological metabolite excreted by many microorganisms grown on glucose or other fermentable carbon sources. This substrate-binding domain shows significant homology to the type 2 perip
Probab=50.49  E-value=21  Score=22.04  Aligned_cols=27  Identities=19%  Similarity=0.330  Sum_probs=21.9

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         25 GVRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        25 GvR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      -...++...+.+|++++|++.+.+...
T Consensus        10 ~~~~~l~~~l~~~~~~~P~v~i~i~~~   36 (197)
T cd08452          10 AIYEFLPPIVREYRKKFPSVKVELREL   36 (197)
T ss_pred             HHHhHHHHHHHHHHHHCCCcEEEEEec
Confidence            345677889999999999999988653


No 29 
>cd08416 PBP2_MdcR The C-terminal substrate-binding domian of LysR-type transcriptional regulator MdcR, which involved in the malonate catabolism contains the type 2 periplasmic binding fold. This family includes the C-terminal substrate binding domain of LysR-type transcriptional regulator (LTTR) MdcR that controls the expression of the malonate decarboxylase (mdc) genes. Like other members of the LTTRs, MdcR is a positive regulatory protein for its target promoter and composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins (PBP2). The PBP2 are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these dom
Probab=50.44  E-value=25  Score=21.33  Aligned_cols=28  Identities=18%  Similarity=0.120  Sum_probs=23.1

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEEcC
Q psy15303         25 GVRDFLAQHYVPLKQANPKFPILVRECS   52 (72)
Q Consensus        25 GvR~Fl~~~l~~~k~~NP~v~i~v~~~~   52 (72)
                      -...++...+.+|++++|++.+.+....
T Consensus        10 ~~~~~l~~~l~~~~~~~P~i~l~i~~~~   37 (199)
T cd08416          10 LTVNTVPRIIMGLKLRRPELDIELTLGS   37 (199)
T ss_pred             HHHhhhHHHHHHHHHhCCCeEEEEEEcC
Confidence            3466788999999999999999997643


No 30 
>cd08439 PBP2_LrhA_like The C-terminal substrate domain of LysR-like regulator LrhA (LysR homologue A) and that of closely related homologs, contains the type 2 periplasmic binding fold. This CD represents the LrhA subfamily of LysR-like bacterial transcriptional regulators, including LrhA, HexA, PecT, and DgdR.  LrhA is involved in control of the transcription of flagellar, motility, and chemotaxis genes by regulating the synthesis and concentration of FlhD(2)C(2), the master regulator for the expression of flagellar and chemotaxis genes. The LrhA protein has strong homology to HexA and PecT from plant pathogenic bacteria, in which HexA and PecT act as repressors of motility and of virulence factors, such as exoenzymes required for lytic reactions. DgdR also shares similar characteristics to those of LrhA, HexA and PecT. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a vari
Probab=50.27  E-value=30  Score=21.09  Aligned_cols=27  Identities=15%  Similarity=0.044  Sum_probs=22.2

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         25 GVRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        25 GvR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      -...++...+.+|++++|++.+.+...
T Consensus        10 ~~~~~l~~~l~~~~~~~P~v~i~~~~~   36 (185)
T cd08439          10 YADTILPFLLNRFASVYPRLAIEVVCK   36 (185)
T ss_pred             HhHHHHHHHHHHHHHHCCCeEEEEEEC
Confidence            345677888999999999999998764


No 31 
>cd08460 PBP2_DntR_like_1 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold. This CD includes an uncharacterized LysR-type transcriptional regulator similar to DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded.  This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytra
Probab=50.13  E-value=22  Score=21.96  Aligned_cols=27  Identities=11%  Similarity=0.006  Sum_probs=23.1

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         25 GVRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        25 GvR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      -...|+...+..|++++|++.+.+...
T Consensus        10 ~~~~~l~~~l~~~~~~~P~v~v~l~~~   36 (200)
T cd08460          10 FVAAFGPALLAAVAAEAPGVRLRFVPE   36 (200)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEecC
Confidence            456888999999999999999998653


No 32 
>cd08477 PBP2_CrgA_like_8 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 8. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene a
Probab=49.35  E-value=31  Score=20.89  Aligned_cols=26  Identities=8%  Similarity=-0.005  Sum_probs=21.7

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++...+.+|++++|++.+.+...
T Consensus        12 ~~~~l~~~l~~~~~~~P~i~l~i~~~   37 (197)
T cd08477          12 GSHVLTPALAEYLARYPDVRVDLVLS   37 (197)
T ss_pred             HHHHHHHHHHHHHHHCCCcEEEEEec
Confidence            45677888999999999999999753


No 33 
>cd08412 PBP2_PAO1_like The C-terminal substrate-binding domain of putative LysR-type transcriptional regulator PAO1-like, a member of the type 2 periplasmic binding fold protein superfamily. This family includes the C-terminal substrate domain of a putative LysR-type transcriptional regulator from the plant pathogen Pseudomonas aeruginosa PAO1and its closely related homologs. The LysR-type transcriptional regulators (LTTRs) are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor.  The genes controll
Probab=48.92  E-value=23  Score=21.48  Aligned_cols=26  Identities=19%  Similarity=0.225  Sum_probs=21.7

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++...+.+|++++|++.+.+...
T Consensus        11 ~~~~l~~~l~~~~~~~P~i~l~i~~~   36 (198)
T cd08412          11 APYYLPGLLRRFREAYPGVEVRVVEG   36 (198)
T ss_pred             chhhhHHHHHHHHHHCCCcEEEEEEC
Confidence            34677889999999999999998754


No 34 
>TIGR00237 xseA exodeoxyribonuclease VII, large subunit. This family consist of exodeoxyribonuclease VII, large subunit XseA which catalyses exonucleolytic cleavage in either the 5'-3' or 3'-5' direction to yield 5'-phosphomononucleotides. Exonuclease VII consists of one large subunit and four small subunits.
Probab=48.78  E-value=28  Score=26.58  Aligned_cols=30  Identities=17%  Similarity=0.368  Sum_probs=24.8

Q ss_pred             CCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEEcC
Q psy15303         19 KGGSSSGVRDFLAQHYVPLKQANPKFPILVRECS   52 (72)
Q Consensus        19 ~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v~~~~   52 (72)
                      +|+++++++||+.    .+++++|.++|.+.+..
T Consensus       136 ts~~~aa~~D~~~----~~~~r~p~~~~~~~~~~  165 (432)
T TIGR00237       136 TSQTGAALADILH----ILKRRDPSLKVVIYPTL  165 (432)
T ss_pred             eCCccHHHHHHHH----HHHhhCCCceEEEeccc
Confidence            6788999999975    47778899999987754


No 35 
>cd08414 PBP2_LTTR_aromatics_like The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of aromatic compounds and that of other related regulators, contains type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LTTRs involved in degradation of aromatic compounds, such as CbnR, BenM, CatM, ClcR and TfdR, as well as that of other transcriptional regulators clustered together in phylogenetic trees, including XapR, HcaR, MprR, IlvR, BudR, AlsR, LysR, and OccR. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they ca
Probab=48.78  E-value=27  Score=21.04  Aligned_cols=26  Identities=15%  Similarity=0.290  Sum_probs=22.1

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++...+.+|++++|++.|.+...
T Consensus        11 ~~~~l~~~l~~~~~~~p~i~i~i~~~   36 (197)
T cd08414          11 LYGLLPRLLRRFRARYPDVELELREM   36 (197)
T ss_pred             HHHHHHHHHHHHHHHCCCcEEEEecC
Confidence            45678899999999999999998753


No 36 
>cd08436 PBP2_LTTR_like_3 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor.  The genes controlled by the LTTRs have diverse functi
Probab=48.76  E-value=24  Score=21.24  Aligned_cols=27  Identities=15%  Similarity=0.151  Sum_probs=22.3

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         25 GVRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        25 GvR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      -...++...+.+|.+++|++.+.+...
T Consensus        10 ~~~~~l~~~l~~~~~~~P~v~i~i~~~   36 (194)
T cd08436          10 LAAVDLPELLARFHRRHPGVDIRLRQA   36 (194)
T ss_pred             HHHHHHHHHHHHHHHHCCCcEEEEecC
Confidence            345677888999999999999998764


No 37 
>cd08450 PBP2_HcaR The C-terminal substrate binding domain of LysR-type transcriptional regulator HcaR in involved in 3-phenylpropionic acid catabolism, contains the type2 periplasmic binding fold. HcaR, a member of the LysR family of transcriptional regulators, controls the expression of the hcA1, A2, B, C, and D operon, encoding for the 3-phenylpropionate dioxygenase complex and 3-phenylpropionate-2',3'-dihydrodiol dehydrogenase, that oxidizes 3-phenylpropionate to 3-(2,3-dihydroxyphenyl) propionate.  Dioxygenases play an important role in protecting the cell against the toxic effects of dioxygen. The expression of hcaR is negatively auto-regulated, as for other members of the LysR family, and is strongly repressed in the presence of glucose. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, an
Probab=48.41  E-value=24  Score=21.41  Aligned_cols=26  Identities=12%  Similarity=0.256  Sum_probs=22.0

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++...+.+|++++|++.+.+.+.
T Consensus        11 ~~~~l~~~l~~~~~~~P~i~l~i~~~   36 (196)
T cd08450          11 EVQWLPEVLPILREEHPDLDVELSSL   36 (196)
T ss_pred             hhhhHHHHHHHHHhhCCCcEEEEEec
Confidence            45777889999999999999998764


No 38 
>cd08486 PBP2_CbnR The C-terminal substrate binding domain of LysR-type transcriptional regulator, CbnR, involved in the chlorocatechol catabolism, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of LysR-type regulator CbnR which is involved in the regulation of chlorocatechol breakdown. The chlorocatechol-degradative pathway is often found in bacteria that can use chlorinated aromatic compounds as carbon and energy sources. CbnR is found in the 3-chlorobenzoate degradative bacterium Ralstonia eutropha NH9 and forms a tetramer. CbnR activates the expression of the cbnABCD genes, which are responsible for the degradation of chlorocatechol converted from 3-chlorobenzoate and are transcribed divergently from cbnR. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccha
Probab=48.36  E-value=32  Score=21.43  Aligned_cols=25  Identities=8%  Similarity=0.046  Sum_probs=21.0

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         27 RDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        27 R~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ..++...+.+|++++|++++.+.+.
T Consensus        13 ~~~l~~~l~~f~~~~P~v~i~i~~~   37 (198)
T cd08486          13 YRSLPLLLRAFLTSTPTATVSLTHM   37 (198)
T ss_pred             HHHHHHHHHHHHHhCCCeEEEEEEC
Confidence            5667788899999999999998764


No 39 
>PF03466 LysR_substrate:  LysR substrate binding domain;  InterPro: IPR005119 The structure of this domain is known and is similar to the periplasmic binding proteins []. This domain is found in members of the LysR family of prokaryotic transcriptional regulatory proteins IPR000847 from INTERPRO which share sequence similarities over approximately 280 residues including a putative helix-turn-helix DNA-binding motif at their N terminus.; PDB: 3ONM_B 3FZJ_J 3FXR_B 3N6T_A 3FXQ_A 3FXU_A 3N6U_A 2QSX_B 3HO7_B 1IZ1_B ....
Probab=48.15  E-value=21  Score=21.96  Aligned_cols=27  Identities=19%  Similarity=0.381  Sum_probs=22.9

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEcC
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVRECS   52 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~~   52 (72)
                      ...++...+.+|.+++|++.|.+.+..
T Consensus        17 ~~~~l~~~l~~~~~~~P~i~i~~~~~~   43 (209)
T PF03466_consen   17 ASSLLPPLLAEFRERHPNIRIEIREGD   43 (209)
T ss_dssp             HHHTHHHHHHHHHHHSTTEEEEEEEES
T ss_pred             HHHHHHHHHHHHHHHCCCcEEEEEecc
Confidence            366778899999999999999998754


No 40 
>cd08431 PBP2_HupR The C-terminal substrate binding domain of LysR-type transcriptional regulator, HupR, which regulates expression of the heme uptake receptor HupA; contains the type 2 periplasmic binding fold. HupR, a member of the LysR family, activates hupA transcription under low-iron conditions in the presence of hemin. The expression of many iron-uptake genes, such as hupA,  is regulated at the transcriptional level by iron and an iron-binding repressor protein called Fur (ferric uptake regulation). Under iron-abundant conditions with heme, the active Fur repressor protein represses transcription of the iron-uptake gene hupA, and prevents transcriptional activation via HupR. Under low-iron conditions with heme, the Fur repressor is inactive and transcription of the hupA is allowed. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, p
Probab=48.13  E-value=25  Score=21.40  Aligned_cols=25  Identities=20%  Similarity=-0.016  Sum_probs=21.1

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         27 RDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        27 R~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ..++...+..|.+.+|++.|.+.+.
T Consensus        12 ~~~l~~~l~~~~~~~P~v~i~i~~~   36 (195)
T cd08431          12 LQPLYPLIAEFYQLNKATRIRLSEE   36 (195)
T ss_pred             hHHHHHHHHHHHHHCCCCceEEEEe
Confidence            3567888999999999999999764


No 41 
>cd08464 PBP2_DntR_like_2 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold. This CD includes an uncharacterized LysR-type transcriptional regulator similar to DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded.  This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytra
Probab=47.92  E-value=34  Score=20.77  Aligned_cols=25  Identities=12%  Similarity=0.229  Sum_probs=21.2

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         27 RDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        27 R~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ..++..-+.+|++++|++.+.+...
T Consensus        12 ~~~l~~~l~~~~~~~P~v~l~i~~~   36 (200)
T cd08464          12 SWLAPPLLAALRAEAPGVRLVFRQV   36 (200)
T ss_pred             HHHHHHHHHHHHHHCCCcEEEEecC
Confidence            3567788999999999999999764


No 42 
>cd08444 PBP2_Cbl The C-terminal substrate binding domain of LysR-type transcriptional regulator Cbl, which is required for expression of sulfate starvation-inducible (ssi) genes, contains the type 2 periplasmic binding fold. Cbl is a member of the LysR transcriptional regulators that comprise the largest family of prokaryotic transcription factor. Cbl shows high sequence similarity to CysB, the LysR-type transcriptional activator of genes involved in sulfate and thiosulfate transport, sulfate reduction, and cysteine synthesis. In Escherichia coli, the function of Cbl is required for expression of sulfate starvation-inducible (ssi) genes, coupled with the biosynthesis of cysteine from the organic sulfur sources (sulfonates). The ssi genes include the ssuEADCB and tauABCD operons encoding uptake systems for organosulfur compounds, aliphatic sulfonates, and taurine. The genes in these operons encode an ABC-type transport system required for uptake of aliphatic sulfonates and a desulfonati
Probab=47.86  E-value=29  Score=21.48  Aligned_cols=26  Identities=15%  Similarity=0.190  Sum_probs=20.8

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++...+.+|++++|++.+.+...
T Consensus        11 ~~~~l~~~l~~~~~~~P~v~l~i~~~   36 (198)
T cd08444          11 ARYALPWVVQAFKEQFPNVHLVLHQG   36 (198)
T ss_pred             hhhhhhHHHHHHHHHCCCeEEEEEeC
Confidence            45677888889999999988888754


No 43 
>cd08438 PBP2_CidR The C-terminal substrate binding domain of LysR-like transcriptional regulator CidR, contains the type 2 periplasmic binding fold. This CD includes the substrate binding domain of CidR which positively up-regulates the expression of cidABC operon in the presence of acetic acid produced by the metabolism of excess glucose. The CidR affects the control of murein hydrolase activity by enhancing cidABC expression in the presence of acetic acid. Thus, up-regulation of cidABC expression results in increased murein hydrolase activity. This substrate binding domain has significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate 
Probab=47.74  E-value=24  Score=21.25  Aligned_cols=25  Identities=16%  Similarity=0.238  Sum_probs=21.5

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         27 RDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        27 R~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ..++...+.+|++++|++.|.+...
T Consensus        12 ~~~l~~~l~~~~~~~p~v~i~i~~~   36 (197)
T cd08438          12 SLLFAPLLAAFRQRYPNIELELVEY   36 (197)
T ss_pred             hhhcHHHHHHHHHHCcCeEEEEEEc
Confidence            4677888999999999999999764


No 44 
>cd08466 PBP2_LeuO The C-terminal substrate binding domain of LysR-type transcriptional regulator LeuO, an activator of  leucine synthesis operon, contains the type 2 periplasmic binding fold. LeuO, a LysR-type transcriptional regulator, was originally identified as an activator of the leucine synthesis operon (leuABCD). Subsequently, LeuO was found to be not a specific regulator of the leu gene but a global regulator of unrelated various genes. LeuO activates bglGFB (utilization of beta-D-glucoside) and represses cadCBA (lysine decarboxylation) and dsrA (encoding a regulatory small RNA for translational control of rpoS and hns). LeuO also regulates the yjjQ-bglJ operon which coding for a LuxR-type transcription factor. In Salmonella enterica serovar Typhi, LeuO is a positive regulator of ompS1 (encoding an outer membrane), ompS2 (encoding a pathogenicity determinant), and assT, while LeuO represses the expression of OmpX and Tpx. Both osmS1 and osmS2 influence virulence in the mouse mo
Probab=47.73  E-value=30  Score=21.12  Aligned_cols=26  Identities=19%  Similarity=0.160  Sum_probs=22.1

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++..-+.+|.+++|++.+.+...
T Consensus        11 ~~~~l~~~l~~f~~~~P~v~l~~~~~   36 (200)
T cd08466          11 DLLLLPRLLARLKQLAPNISLRESPS   36 (200)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEecC
Confidence            34677889999999999999999764


No 45 
>cd08426 PBP2_LTTR_like_5 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor.  The genes controlled by the LTTRs have diverse functi
Probab=47.65  E-value=27  Score=21.20  Aligned_cols=26  Identities=15%  Similarity=0.193  Sum_probs=21.8

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++...+..|++++|++.+.+...
T Consensus        11 ~~~~l~~~l~~~~~~~P~i~l~i~~~   36 (199)
T cd08426          11 AAELLPSLIARFRQRYPGVFFTVDVA   36 (199)
T ss_pred             HHHHHHHHHHHHHHhCCCeEEEEEeC
Confidence            45677888999999999999999764


No 46 
>PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed
Probab=47.55  E-value=29  Score=26.15  Aligned_cols=30  Identities=17%  Similarity=0.365  Sum_probs=24.4

Q ss_pred             CCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEEcC
Q psy15303         19 KGGSSSGVRDFLAQHYVPLKQANPKFPILVRECS   52 (72)
Q Consensus        19 ~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v~~~~   52 (72)
                      +|+++++++||+..    +++++|.+.|.+.+..
T Consensus       142 Ts~~gAa~~D~~~~----~~~r~p~~~~~~~~~~  171 (438)
T PRK00286        142 TSPTGAAIRDILTV----LRRRFPLVEVIIYPTL  171 (438)
T ss_pred             eCCccHHHHHHHHH----HHhcCCCCeEEEecCc
Confidence            57779999999864    5678899999987764


No 47 
>cd08420 PBP2_CysL_like C-terminal substrate binding domain of LysR-type transcriptional regulator CysL, which activates the transcription of the cysJI operon encoding sulfite reductase, contains the type 2 periplasmic binding fold. CysL, also known as YwfK, is a regular of sulfur metabolism in Bacillus subtilis. Sulfur is required for the synthesis of proteins and essential cofactors in all living organism. Sulfur can be assimilated either from inorganic sources (sulfate and thiosulfate), or from organic sources (sulfate esters, sulfamates, and sulfonates). CysL activates the transcription of the cysJI operon encoding sulfite reductase, which reduces sulfite to sulfide. Both cysL mutant and cysJI mutant are unable to grow using sulfate or sulfite as the sulfur source. Like other LysR-type regulators, CysL also negatively regulates its own transcription. In Escherichia coli, three LysR-type activators are involved in the regulation of sulfur metabolism: CysB, Cbl and MetR.  The topology
Probab=47.50  E-value=31  Score=20.70  Aligned_cols=26  Identities=8%  Similarity=0.124  Sum_probs=22.0

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++..-+.+|++.+|++.+.+.+.
T Consensus        11 ~~~~l~~~l~~~~~~~P~~~l~~~~~   36 (201)
T cd08420          11 GEYLLPRLLARFRKRYPEVRVSLTIG   36 (201)
T ss_pred             hhhhhHHHHHHHHHHCCCceEEEEeC
Confidence            45677888999999999999998764


No 48 
>cd02974 AhpF_NTD_N Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) family, N-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which in turn catalyzes the reduction of hydrogen peroxide and organic hydroperoxides. AhpF contains an NTD forming two contiguous TRX-fold subdomain similar to Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO). It also contains a catalytic core similar to TRX reductase containing FAD and NADH binding domains with an active site disulfide. The proposed mechanism of action of AhpF is similar to a TRX/TRX reductase system. The flow of reducing equivalents goes from NADH - catalytic core of AhpF - NTD of AhpF - AhpC - peroxide substrates. The N-terminal TRX-fold subdomain of AhpF NTD is redox inactive, but is proposed to contain an important residue that aids in the catalytic function of the redox-active CXXC motif contained in the C-terminal TRX-
Probab=47.43  E-value=64  Score=19.65  Aligned_cols=45  Identities=13%  Similarity=0.139  Sum_probs=31.9

Q ss_pred             EEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEEcCCCCCEEEEE
Q psy15303         12 LRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRECSGVTPVVWAR   61 (72)
Q Consensus        12 L~~~yC~~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v~~~~g~~P~l~a~   61 (72)
                      |.+.. +.++.|.=+++|++    +++..+|.+.+.+......-|.+...
T Consensus        23 l~~f~-~~~~~~~e~~~ll~----e~a~lSdkI~~~~~~~~~~~P~~~i~   67 (94)
T cd02974          23 LVASL-DDSEKSAELLELLE----EIASLSDKITLEEDNDDERKPSFSIN   67 (94)
T ss_pred             EEEEe-CCCcchHHHHHHHH----HHHHhCCceEEEEecCCCCCCEEEEe
Confidence            33343 44588888888876    79999999998876644456877764


No 49 
>cd08448 PBP2_LTTR_aromatics_like_2 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to regulators involved in the catabolism of aromatic compounds, contains type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type regulator similar to CbnR which is involved in the regulation of chlorocatechol breakdown. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Ve
Probab=47.32  E-value=29  Score=20.87  Aligned_cols=26  Identities=12%  Similarity=0.142  Sum_probs=21.7

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEE
Q psy15303         25 GVRDFLAQHYVPLKQANPKFPILVRE   50 (72)
Q Consensus        25 GvR~Fl~~~l~~~k~~NP~v~i~v~~   50 (72)
                      -...++...+.+|.+++|++.+.+..
T Consensus        10 ~~~~~l~~~l~~~~~~~P~i~i~i~~   35 (197)
T cd08448          10 MLYRGLPRILRAFRAEYPGIEVALHE   35 (197)
T ss_pred             HHHHHHHHHHHHHHHHCCCCeEEEEe
Confidence            34577888899999999999998875


No 50 
>cd08476 PBP2_CrgA_like_7 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 7. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene a
Probab=47.18  E-value=27  Score=21.03  Aligned_cols=24  Identities=13%  Similarity=0.128  Sum_probs=19.9

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEE
Q psy15303         27 RDFLAQHYVPLKQANPKFPILVRE   50 (72)
Q Consensus        27 R~Fl~~~l~~~k~~NP~v~i~v~~   50 (72)
                      ..++...+.+|++++|++.+.+..
T Consensus        11 ~~~l~~~l~~~~~~~P~v~i~~~~   34 (197)
T cd08476          11 GGLLLPVLAAFMQRYPEIELDLDF   34 (197)
T ss_pred             HHHHHHHHHHHHHHCCCeEEEEEe
Confidence            356667899999999999999854


No 51 
>cd08434 PBP2_GltC_like The substrate binding domain of LysR-type transcriptional regulator GltC, which activates gltA expression of glutamate synthase operon, contains type 2 periplasmic binding fold. GltC, a member of the LysR family of bacterial transcriptional factors, activates the expression of gltA gene of glutamate synthase operon and is essential for cell growth in the absence of glutamate. Glutamate synthase is a heterodimeric protein that encoded by gltA and gltB, whose expression is subject to nutritional regulation. GltC also negatively auto-regulates its own expression. This substrate-binding domain has strong homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, 
Probab=46.68  E-value=25  Score=21.09  Aligned_cols=26  Identities=4%  Similarity=0.148  Sum_probs=21.6

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++...+..|.+++|++.+.++..
T Consensus        11 ~~~~l~~~l~~~~~~~P~i~i~i~~~   36 (195)
T cd08434          11 GTSLVPDLIRAFRKEYPNVTFELHQG   36 (195)
T ss_pred             hhhhhHHHHHHHHHhCCCeEEEEecC
Confidence            34677888999999999999998864


No 52 
>cd08483 PBP2_HvrB The C-terminal substrate-binding domain of LysR-type transcriptional regulator HvrB, an activator of S-adenosyl-L-homocysteine hydrolase expression, contains the type 2 periplasmic binding fold. The transcriptional regulator HvrB of the LysR family is required for the light-dependent activation of both ahcY, which encoding the enzyme S-adenosyl-L-homocysteine hydrolase (AdoHcyase) that responsible for the reversible hydrolysis of AdoHcy to adenosine and homocysteine,  and orf5, a gene of unknown.  The topology of this C-terminal domain of HvrB is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transp
Probab=46.40  E-value=31  Score=20.85  Aligned_cols=25  Identities=8%  Similarity=0.198  Sum_probs=21.2

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEE
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVRE   50 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~   50 (72)
                      ...++...+.+|.+++|++.+.+..
T Consensus        11 ~~~~l~~~l~~~~~~~P~i~l~~~~   35 (190)
T cd08483          11 ASNWLMPRLGSFWAKHPEIELSLLP   35 (190)
T ss_pred             HHhhHHhhHHHHHHHCCCceEEEEe
Confidence            4567778899999999999999874


No 53 
>COG1182 AcpD Acyl carrier protein phosphodiesterase [Lipid metabolism]
Probab=46.12  E-value=30  Score=24.51  Aligned_cols=52  Identities=17%  Similarity=0.251  Sum_probs=33.8

Q ss_pred             EEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEE-cCCCCCEEEEEecC
Q psy15303         12 LRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRE-CSGVTPVVWARIPT   64 (72)
Q Consensus        12 L~~~yC~~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v~~-~~g~~P~l~a~Y~n   64 (72)
                      |-|.-+..++.|.- |...+.-+.++|++||+.+|..+. ....-|++..+..+
T Consensus         5 L~I~as~~~~~S~S-~~l~~~Fi~~yk~~~P~dev~~~DL~~e~iP~ld~~~~~   57 (202)
T COG1182           5 LVIKASPLGENSVS-RKLADEFIETYKEKHPNDEVIERDLAAEPIPHLDEELLA   57 (202)
T ss_pred             EEEecCCCccccHH-HHHHHHHHHHHHHhCCCCeEEEeecccCCCcccCHHHHh
Confidence            44444444333332 223344556799999999999977 56778888776665


No 54 
>cd08479 PBP2_CrgA_like_9 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 9. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene a
Probab=45.75  E-value=37  Score=20.64  Aligned_cols=27  Identities=11%  Similarity=0.127  Sum_probs=22.5

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         25 GVRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        25 GvR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      -...++...+.+|++++|++.|.+...
T Consensus        11 ~~~~~l~~~l~~f~~~~P~i~i~~~~~   37 (198)
T cd08479          11 FGRRHIAPALSDFAKRYPELEVQLELT   37 (198)
T ss_pred             HHHHHHHHHHHHHHHHCCCeEEEEEec
Confidence            355778889999999999999998753


No 55 
>cd08453 PBP2_IlvR The C-terminal substrate binding domain of LysR-type transcriptional regulator, IlvR, involved in the biosynthesis of isoleucine, leucine and valine; contains type 2 periplasmic binding fold. The IlvR is an activator of the upstream and divergently transcribed ilvD gene, which encodes dihydroxy acid dehydratase that participates in isoleucine, leucine, and valine biosynthesis. As in the case of other members of the LysR family, the expression of ilvR gene is repressed in the presence of its own gene product. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport
Probab=45.69  E-value=31  Score=21.10  Aligned_cols=26  Identities=19%  Similarity=0.295  Sum_probs=22.1

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++...+.+|.+++|++.+.+...
T Consensus        11 ~~~~l~~~l~~~~~~~P~i~l~i~~~   36 (200)
T cd08453          11 DYSVLPELVRRFREAYPDVELQLREA   36 (200)
T ss_pred             HhHHHHHHHHHHHHhCCCceEEEEeC
Confidence            34688899999999999999999764


No 56 
>cd08432 PBP2_GcdR_TrpI_HvrB_AmpR_like The C-terminal substrate domain of LysR-type GcdR, TrPI, HvR and beta-lactamase regulators, and that of other closely related homologs; contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate domain of LysR-type transcriptional regulators involved in controlling the expression of glutaryl-CoA dehydrogenase (GcdH), S-adenosyl-L-homocysteine hydrolase, cell division protein FtsW, tryptophan synthase, and beta-lactamase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex compris
Probab=45.47  E-value=39  Score=20.31  Aligned_cols=28  Identities=7%  Similarity=0.185  Sum_probs=22.6

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEEcC
Q psy15303         25 GVRDFLAQHYVPLKQANPKFPILVRECS   52 (72)
Q Consensus        25 GvR~Fl~~~l~~~k~~NP~v~i~v~~~~   52 (72)
                      -...++...+.+|.+++|++.+.+.+..
T Consensus        10 ~~~~~l~~~l~~~~~~~P~v~i~~~~~~   37 (194)
T cd08432          10 FAARWLIPRLARFQARHPDIDLRLSTSD   37 (194)
T ss_pred             HHHHHHHHHhHHHHHHCCCeEEEEEecC
Confidence            3455678889999999999999997643


No 57 
>PRK14003 potassium-transporting ATPase subunit C; Provisional
Probab=45.42  E-value=30  Score=24.35  Aligned_cols=46  Identities=13%  Similarity=0.152  Sum_probs=37.0

Q ss_pred             cCCCCCCHHHHHHHHhCHHHHHHhCCCC--eEEEEEcCCCCCEEEEEe
Q psy15303         17 CQKGGSSSGVRDFLAQHYVPLKQANPKF--PILVRECSGVTPVVWARI   62 (72)
Q Consensus        17 C~~~~sS~GvR~Fl~~~l~~~k~~NP~v--~i~v~~~~g~~P~l~a~Y   62 (72)
                      ++-++++.-+.+-+++....++++||..  +.++....|-+|.|.-++
T Consensus        93 SNl~psnp~l~~~v~~r~~~~~~~~~~pp~DlVTaSgSGLDPhISp~a  140 (194)
T PRK14003         93 SNLAPSNPALIERIKEEANRLQDAGIQPTADLVYTSGSGLDPHISPEA  140 (194)
T ss_pred             cCCCCCCHHHHHHHHHHHHHHHHcCCCCChhheecccccCCCCCCHHH
Confidence            4567889999999999999999999654  567777889999876443


No 58 
>PRK13996 potassium-transporting ATPase subunit C; Provisional
Probab=45.22  E-value=19  Score=25.43  Aligned_cols=44  Identities=14%  Similarity=0.317  Sum_probs=34.5

Q ss_pred             cCCCCCCHHHHHHHHhCHHHHHHhCCC-----Ce--EEEEEcCCCCCEEEE
Q psy15303         17 CQKGGSSSGVRDFLAQHYVPLKQANPK-----FP--ILVRECSGVTPVVWA   60 (72)
Q Consensus        17 C~~~~sS~GvR~Fl~~~l~~~k~~NP~-----v~--i~v~~~~g~~P~l~a   60 (72)
                      ++.+++|.-+++-+++....++++||.     ||  .++....|-+|.|.-
T Consensus        91 SNlgpsnp~L~~~v~~r~~~~~~~~~~v~~~~vP~DlvTaSgSGLDPhISp  141 (197)
T PRK13996         91 SNLSPASKEYEALVQERVEKIRANHPEQDEKPIPVDLVTCSGSGLDPHISV  141 (197)
T ss_pred             cCCCCCCHHHHHHHHHHHHHHHHhCCCCCCCCCCHHHHhccccCCCCCCCH
Confidence            567889999999999999999999985     44  344556677887653


No 59 
>cd08425 PBP2_CynR The C-terminal substrate-binding domain of the LysR-type transcriptional regulator CynR, contains the type 2 periplasmic binding fold. CynR is a LysR-like transcriptional regulator of the cyn operon, which encodes genes that allow cyanate to be used as a sole source of nitrogen. The operon includes three genes in the following order: cynT (cyanate permease), cynS (cyanase), and cynX (a protein of unknown function).  CynR negatively regulates its own expression independently of cyanate. CynR binds to DNA and induces bending of DNA in the presence or absence of cyanate, but the amount of bending is decreased by cyanate. The CynR of LysR-type transcriptional regulator family is composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding 
Probab=45.03  E-value=32  Score=20.91  Aligned_cols=27  Identities=11%  Similarity=0.103  Sum_probs=22.7

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         25 GVRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        25 GvR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ....++...+.+|++++|++.|.+.+.
T Consensus        11 ~~~~~l~~~l~~~~~~~P~v~i~i~~~   37 (197)
T cd08425          11 FTAYLIGPLIDRFHARYPGIALSLREM   37 (197)
T ss_pred             hhhhhhHHHHHHHHHHCCCcEEEEEEC
Confidence            456677889999999999999999764


No 60 
>cd08472 PBP2_CrgA_like_3 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 3. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene a
Probab=44.86  E-value=43  Score=20.34  Aligned_cols=25  Identities=12%  Similarity=0.089  Sum_probs=21.4

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEE
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVRE   50 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~   50 (72)
                      ...++...+.+|.+++|++.+.+..
T Consensus        12 ~~~~l~~~l~~~~~~~P~i~v~~~~   36 (202)
T cd08472          12 ARLLLIPALPDFLARYPDIELDLGV   36 (202)
T ss_pred             HHHHHHHHHHHHHHHCCCcEEEEEE
Confidence            4567788999999999999999865


No 61 
>cd08437 PBP2_MleR The substrate binding domain of LysR-type transcriptional regulator MleR which required for malolactic fermentation, contains type 2 periplasmic binidning fold. MleR, a transcription activator of malolactic fermentation system, is found in gram-positive bacteria and belongs to the lysR family of bacterial transcriptional regulators. The mleR gene is required for the expression and induction of malolactic fermentation. This substrate binding domain has significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase dom
Probab=44.52  E-value=31  Score=21.04  Aligned_cols=25  Identities=12%  Similarity=0.018  Sum_probs=21.3

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         27 RDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        27 R~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      -.++...+.+|.+.+|++.+.+...
T Consensus        12 ~~~l~~~l~~~~~~~P~v~i~~~~~   36 (198)
T cd08437          12 NYYFPKLAKDLIKTGLMIQIDTYEG   36 (198)
T ss_pred             HHHhHHHHHHHHHhCCceEEEEEEc
Confidence            4577889999999999999999753


No 62 
>cd08478 PBP2_CrgA The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA, contains the type 2 periplasmic binding domain. This CD represents the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene wh
Probab=44.29  E-value=27  Score=21.35  Aligned_cols=26  Identities=15%  Similarity=0.188  Sum_probs=21.8

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEE
Q psy15303         25 GVRDFLAQHYVPLKQANPKFPILVRE   50 (72)
Q Consensus        25 GvR~Fl~~~l~~~k~~NP~v~i~v~~   50 (72)
                      -...++...+.+|.+++|++.+.+..
T Consensus        13 ~~~~~l~~~l~~f~~~~P~v~i~~~~   38 (199)
T cd08478          13 FVLHLLAPLIAKFRERYPDIELELVS   38 (199)
T ss_pred             HHHHHHHHHHHHHHHHCCCeEEEEEe
Confidence            34567889999999999999999863


No 63 
>PF04690 YABBY:  YABBY protein;  InterPro: IPR006780 YABBY proteins are a group of plant-specific transcription factors involved in the specification of abaxial polarity in lateral organs such as leaves and floral organs [, ].
Probab=43.98  E-value=15  Score=25.31  Aligned_cols=19  Identities=21%  Similarity=0.483  Sum_probs=16.9

Q ss_pred             HHHHHhCHHHHHHhCCCCe
Q psy15303         27 RDFLAQHYVPLKQANPKFP   45 (72)
Q Consensus        27 R~Fl~~~l~~~k~~NP~v~   45 (72)
                      ..||++.+..+|..||++.
T Consensus       130 n~f~k~ei~rik~~~p~is  148 (170)
T PF04690_consen  130 NRFMKEEIQRIKAENPDIS  148 (170)
T ss_pred             HHHHHHHHHHHHhcCCCCC
Confidence            4699999999999999975


No 64 
>cd08445 PBP2_BenM_CatM_CatR The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in benzoate catabolism; contains the type 2 periplasmic binding fold. This CD includes the C-terminal of LysR-type transcription regulators, BenM, CatM, and CatR, which are involved in the benzoate catabolism. The BenM and CatM are paralogs with overlapping functions. BenM responds synergistically to two effectors, benzoate and cis,cis-muconate, to activate expression of the benABCDE operon which is involved in benzoate catabolism, while CatM responses only to muconate. BenM and CatM share high protein sequence identity and bind to the operator-promoter regions that have similar DNA sequences. In Pseudomonas species, phenolic compounds are converted by different enzymes to central intermediates, such as protocatechuate and catechols. Generally, unsubstituted compounds, such as benzoate, are metabolized by an ortho-cleavage pathway. The catBCA operon encodes three enzymes
Probab=43.87  E-value=35  Score=21.05  Aligned_cols=26  Identities=23%  Similarity=0.298  Sum_probs=21.9

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++..-+.+|.+++|++.+.+.+.
T Consensus        12 ~~~~l~~~l~~~~~~~P~i~l~i~~~   37 (203)
T cd08445          12 LYGLLPELIRRFRQAAPDVEIELIEM   37 (203)
T ss_pred             HHhHHHHHHHHHHHHCCCeEEEEEeC
Confidence            35678889999999999999998754


No 65 
>cd08421 PBP2_LTTR_like_1 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor.  The genes controlled by the LTTRs have diverse functi
Probab=43.42  E-value=35  Score=20.67  Aligned_cols=24  Identities=25%  Similarity=0.429  Sum_probs=20.6

Q ss_pred             HHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         28 DFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        28 ~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      .++..-+.+|.+.+|++++.+...
T Consensus        13 ~~l~~~l~~~~~~~P~i~i~~~~~   36 (198)
T cd08421          13 EFLPEDLASFLAAHPDVRIDLEER   36 (198)
T ss_pred             hhhHHHHHHHHHHCCCceEEEEec
Confidence            467788999999999999998764


No 66 
>cd08474 PBP2_CrgA_like_5 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 5. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene a
Probab=43.06  E-value=41  Score=20.52  Aligned_cols=26  Identities=15%  Similarity=0.091  Sum_probs=22.0

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++...+.+|++++|++.+.+...
T Consensus        14 ~~~~l~~~l~~~~~~~P~v~i~~~~~   39 (202)
T cd08474          14 ARLLLAPLLARFLARYPDIRLELVVD   39 (202)
T ss_pred             HHHHHHHHHHHHHHHCCCeEEEEEec
Confidence            35677889999999999999999753


No 67 
>cd08441 PBP2_MetR The C-terminal substrate binding domain of LysR-type transcriptional regulator metR, which regulates the expression of methionine biosynthetic genes, contains type 2 periplasmic binding fold. MetR, a member of the LysR family, is a positive regulator for the metA, metE, metF, and metH genes. The sulfur-containing amino acid methionine is the universal initiator of protein synthesis in all known organisms and its derivative S-adenosylmethionine (SAM) and autoinducer-2 (AI-2) are involved in various cellular processes. SAM plays a central role as methyl donor in methylation reactions, which are essential for the biosynthesis of phospholipids, proteins, DNA and RNA.  The interspecies signaling molecule AI-2 is involved in cell-cell communication process (quorum sensing) and gene regulation in bacteria. Although methionine biosynthetic enzymes and metabolic pathways are well conserved in bacteria, the regulation of methionine biosynthesis involves various regulatory mecha
Probab=42.77  E-value=46  Score=20.26  Aligned_cols=24  Identities=13%  Similarity=0.207  Sum_probs=20.0

Q ss_pred             HHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         28 DFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        28 ~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      .++...+.+|.+++|++.+.+...
T Consensus        13 ~~~~~~l~~~~~~~P~i~i~i~~~   36 (198)
T cd08441          13 DWLMPVLDQFRERWPDVELDLSSG   36 (198)
T ss_pred             hhhHHHHHHHHHhCCCeEEEEEeC
Confidence            467778899999999999998764


No 68 
>cd08415 PBP2_LysR_opines_like The C-terminal substrate-domain of LysR-type transcriptional regulators involved in the catabolism of opines and that of related regulators, contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate-domain of LysR-type transcriptional regulators, OccR and NocR, involved in the catabolism of opines and that of LysR for lysine biosynthesis which clustered together in phylogenetic trees. Opines, such as octopine and nopaline, are low molecular weight compounds found in plant crown gall tumors that are produced by the parasitic bacterium Agrobacterium. There are at least 30 different opines identified so far. Opines are utilized by tumor-colonizing bacteria as a source of carbon, nitrogen, and energy. NocR and OccR belong to the family of LysR-type transcriptional regulators that positively regulates the catabolism of nopaline and octopine, respectively. Both nopaline and octopalin are arginine derivatives. In Agrobacterium tumefa
Probab=42.75  E-value=17  Score=21.98  Aligned_cols=26  Identities=12%  Similarity=0.245  Sum_probs=21.2

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++...+.+|++++|++.+.+...
T Consensus        11 ~~~~l~~~l~~~~~~~P~i~l~i~~~   36 (196)
T cd08415          11 ALSLLPRAIARFRARHPDVRISLHTL   36 (196)
T ss_pred             cccccHHHHHHHHHHCCCcEEEEEec
Confidence            34567788899999999999988764


No 69 
>cd08423 PBP2_LTTR_like_6 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor.  The genes controlled by the LTTRs have diverse functi
Probab=42.50  E-value=37  Score=20.44  Aligned_cols=25  Identities=20%  Similarity=0.420  Sum_probs=21.2

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         27 RDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        27 R~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      -.++...+.+|++++|++.|.+...
T Consensus        12 ~~~l~~~l~~~~~~~P~i~i~~~~~   36 (200)
T cd08423          12 AALLPPALAALRARHPGLEVRLREA   36 (200)
T ss_pred             HHhhhHHHHHHHHhCCCCeEEEEeC
Confidence            4567888999999999999999764


No 70 
>cd08422 PBP2_CrgA_like The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own 
Probab=42.10  E-value=35  Score=20.47  Aligned_cols=25  Identities=16%  Similarity=0.090  Sum_probs=21.2

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         27 RDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        27 R~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ..++...+.+|++++|++.+.+...
T Consensus        13 ~~~l~~~l~~~~~~~P~v~i~i~~~   37 (197)
T cd08422          13 RLHLAPLLAEFLARYPDVRLELVLS   37 (197)
T ss_pred             HHHHHHHHHHHHHhCCceEEEEecC
Confidence            4567888999999999999999753


No 71 
>PF07315 DUF1462:  Protein of unknown function (DUF1462);  InterPro: IPR009190 There are currently no experimental data for members of this group of bacterial proteins or their homologues. A crystal structure of Q7A6J8 from SWISSPROT revealed a thioredoxin-like fold, its core consisting of three layers alpha/beta/alpha.; PDB: 1XG8_A.
Probab=41.96  E-value=48  Score=20.89  Aligned_cols=33  Identities=24%  Similarity=0.376  Sum_probs=24.0

Q ss_pred             cCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEEcC
Q psy15303         17 CQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRECS   52 (72)
Q Consensus        17 C~~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v~~~~   52 (72)
                      |=+.|||+-.-+||+   +.++++.|+.+|.++-.-
T Consensus        12 CVn~PsSkeTyeWL~---aal~RKyp~~~f~~~YiD   44 (93)
T PF07315_consen   12 CVNAPSSKETYEWLE---AALKRKYPDQPFEFTYID   44 (93)
T ss_dssp             GSSS--HHHHHHHHH---HHHHHH-TTS-EEEEEEE
T ss_pred             hcCCCCchhHHHHHH---HHHhCcCCCCceEEEEEe
Confidence            778899999999998   467899999999886543


No 72 
>PRK13997 potassium-transporting ATPase subunit C; Provisional
Probab=41.92  E-value=23  Score=24.94  Aligned_cols=45  Identities=18%  Similarity=0.320  Sum_probs=35.1

Q ss_pred             cCCCCCCHHHHHHHHhCHHHHHHhCCC-----Ce--EEEEEcCCCCCEEEEE
Q psy15303         17 CQKGGSSSGVRDFLAQHYVPLKQANPK-----FP--ILVRECSGVTPVVWAR   61 (72)
Q Consensus        17 C~~~~sS~GvR~Fl~~~l~~~k~~NP~-----v~--i~v~~~~g~~P~l~a~   61 (72)
                      ++-++++.-+++-+++....+++.||.     ||  .++....|-+|.|.-+
T Consensus        87 SNl~psnp~l~~~v~~r~~~~~~~~~~~~~~~vP~DlVTaSgSGLDPhISp~  138 (193)
T PRK13997         87 NNYAPSNPDLEKRVEKSIEEWKKQNPSVPVTEVPIDLVTNSGSGLDPDISPK  138 (193)
T ss_pred             cCCCCCCHHHHHHHHHHHHHHHHhCCCCCCCCCCHHHHhccccCCCCCCCHH
Confidence            567889999999999999999999984     44  3445566778877543


No 73 
>COG1653 UgpB ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism]
Probab=41.91  E-value=78  Score=22.17  Aligned_cols=26  Identities=19%  Similarity=0.281  Sum_probs=23.3

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEEcC
Q psy15303         27 RDFLAQHYVPLKQANPKFPILVRECS   52 (72)
Q Consensus        27 R~Fl~~~l~~~k~~NP~v~i~v~~~~   52 (72)
                      .++++....+|.++||+|+|.+....
T Consensus        45 ~~~~~~~i~~f~~~~p~ikv~~~~~~   70 (433)
T COG1653          45 ADALEELIKEFEKENPGIKVKVVNVP   70 (433)
T ss_pred             hHHHHHHHHHHHHhCCCeEEEEEecC
Confidence            88899999999999999999887754


No 74 
>cd08419 PBP2_CbbR_RubisCO_like The C-terminal substrate binding of LysR-type transcriptional regulator (CbbR) of RubisCO operon, which is involved in the carbon dioxide fixation, contains the type 2 periplasmic binding fold. CbbR, a LysR-type transcriptional regulator, is required to activate expression of RubisCO, one of two unique enzymes in the Calvin-Benson-Bassham (CBB) cycle pathway. All plants, cyanobacteria, and many autotrophic bacteria use the CBB cycle to fix carbon dioxide. Thus, this cycle plays an essential role in assimilating CO2 into organic carbon on earth. The key CBB cycle enzyme is ribulose 1,5-bisphosphate carboxylase/oxygenase (RubisCO), which catalyzes the actual CO2 fixation reaction. The CO2 concentration affects the expression of RubisCO genes.  It has also shown that NADPH enhances the DNA-binding ability of the CbbR. RubisCO is composed of eight large (CbbL) and eight small subunits (CbbS).  The topology of this substrate-binding domain is most similar to t
Probab=41.52  E-value=39  Score=20.27  Aligned_cols=25  Identities=12%  Similarity=0.183  Sum_probs=21.6

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         27 RDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        27 R~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ..++..-+..|.+++|++.+.+...
T Consensus        11 ~~~l~~~l~~~~~~~P~i~l~i~~~   35 (197)
T cd08419          11 KYFAPRLLGAFCRRHPGVEVSLRVG   35 (197)
T ss_pred             HhHhhHHHHHHHHHCCCceEEEEEC
Confidence            4678889999999999999998763


No 75 
>cd08480 PBP2_CrgA_like_10 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 10. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene
Probab=41.08  E-value=42  Score=20.65  Aligned_cols=25  Identities=12%  Similarity=0.085  Sum_probs=21.2

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEE
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVRE   50 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~   50 (72)
                      ...++...+.+|.+++|++.+.+..
T Consensus        12 ~~~~l~~~l~~~~~~~P~i~i~i~~   36 (198)
T cd08480          12 GTHFLLPLLPAFLARYPEILVDLSL   36 (198)
T ss_pred             HhHhhHHHHHHHHHHCCCeEEEEEe
Confidence            3467888999999999999998864


No 76 
>PLN02870 Probable galacturonosyltransferase
Probab=40.99  E-value=23  Score=28.53  Aligned_cols=26  Identities=23%  Similarity=0.440  Sum_probs=21.9

Q ss_pred             CccccccCceEEEEEecCCCCCCHHHHHHHHh
Q psy15303          1 MATRFGSKLKELRIHLCQKGGSSSGVRDFLAQ   32 (72)
Q Consensus         1 ~~~~f~~qLk~L~~~yC~~~~sS~GvR~Fl~~   32 (72)
                      |-.+.++.+|.++++      +|.|+||||+=
T Consensus         1 ~~~~~~~~~~~~~~~------~~~~~~~~~~~   26 (533)
T PLN02870          1 MQLHISPSMRSITIS------SSNGFIDLMKI   26 (533)
T ss_pred             CceeecCccceEEEe------cCCcHHHHHHH
Confidence            567889999999997      47999999963


No 77 
>TIGR02200 GlrX_actino Glutaredoxin-like protein. This family of glutaredoxin-like proteins is limited to the Actinobacteria and contains the conserved CxxC motif.
Probab=40.93  E-value=29  Score=18.72  Aligned_cols=23  Identities=9%  Similarity=-0.015  Sum_probs=19.4

Q ss_pred             EEEEEecCCCCCCHHHHHHHHhC
Q psy15303         11 ELRIHLCQKGGSSSGVRDFLAQH   33 (72)
Q Consensus        11 ~L~~~yC~~~~sS~GvR~Fl~~~   33 (72)
                      ++++.+-.+++.++-+|.|+.+.
T Consensus         1 ~v~ly~~~~C~~C~~~~~~L~~~   23 (77)
T TIGR02200         1 TITVYGTTWCGYCAQLMRTLDKL   23 (77)
T ss_pred             CEEEEECCCChhHHHHHHHHHHc
Confidence            36788889999999999999653


No 78 
>TIGR00681 kdpC K+-transporting ATPase, C subunit. This chain has a single predicted transmembrane region near the amino end. It is part of a K+-transport ATPase that contains two other membrane-bound subunits, KdpA and KdpB, and a small subunit KdpF. KdpA is the K+-translocating subunit, KdpB the ATP-hydrolyzing subunit. During assembly of the complex, KdpA and KdpC bind to each other. This interaction is thought to stabilize the complex [PubMed:9858692]. Data indicates that KdpC might connect the KdpA, the K+-transporting subunit, to KdpB, the ATP-hydrolyzing (energy providing) subunit [PubMed:9858692].
Probab=40.91  E-value=24  Score=24.69  Aligned_cols=44  Identities=16%  Similarity=0.224  Sum_probs=34.2

Q ss_pred             cCCCCCCHHHHHHHHhCHHHHHHhCCC----CeE--EEEEcCCCCCEEEE
Q psy15303         17 CQKGGSSSGVRDFLAQHYVPLKQANPK----FPI--LVRECSGVTPVVWA   60 (72)
Q Consensus        17 C~~~~sS~GvR~Fl~~~l~~~k~~NP~----v~i--~v~~~~g~~P~l~a   60 (72)
                      ++-++|+.-+++-+++....++++||.    ||.  ++....|-+|.|.-
T Consensus        84 SNl~psnp~l~~~v~~r~~~~~~~~~~~~~~vP~DlvTaSgSGLDPhISp  133 (187)
T TIGR00681        84 SNLAPSNPDLLSRIAARVEAQRLENLDAAVQVPVDLVTSSGSGLDPHISP  133 (187)
T ss_pred             cCCCCCCHHHHHHHHHHHHHHHHhCCCCCCCCCHHHHhcccccCCCCCCH
Confidence            567889999999999999999999984    553  34555677887653


No 79 
>cd08449 PBP2_XapR The C-terminal substrate binding domain of LysR-type transcriptional regulator XapR involved in xanthosine catabolism, contains the type 2 periplasmic binding fold. In Escherichia coli, XapR is a positive regulator for the expression of xapA gene, encoding xanthosine phosphorylase, and xapB gene, encoding a polypeptide similar to the nucleotide transport protein NupG. As an operon, the expression of both xapA and xapB is fully dependent on the presence of both XapR and the inducer xanthosine. Expression of the xapR is constitutive but not auto-regulated, unlike many other LysR family proteins. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their 
Probab=40.65  E-value=39  Score=20.37  Aligned_cols=25  Identities=16%  Similarity=0.197  Sum_probs=21.3

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEE
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVRE   50 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~   50 (72)
                      ...++..-+.+|++++|++.|.+..
T Consensus        11 ~~~~l~~~l~~~~~~~P~i~i~~~~   35 (197)
T cd08449          11 LWGGLGPALRRFKRQYPNVTVRFHE   35 (197)
T ss_pred             hhhhHHHHHHHHHHHCCCeEEEEEE
Confidence            3467788899999999999999875


No 80 
>cd08471 PBP2_CrgA_like_2 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 2. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene a
Probab=40.48  E-value=51  Score=19.97  Aligned_cols=25  Identities=12%  Similarity=0.041  Sum_probs=21.4

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEE
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVRE   50 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~   50 (72)
                      ...++...+.+|.+.+|++.+.+..
T Consensus        12 ~~~~l~~~l~~~~~~~P~v~i~i~~   36 (201)
T cd08471          12 GRLHVLPIITDFLDAYPEVSVRLLL   36 (201)
T ss_pred             HHHHHHHHHHHHHHHCCCcEEEEEE
Confidence            4467788999999999999999875


No 81 
>cd08447 PBP2_LTTR_aromatics_like_1 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to regulators involved in the catabolism of aromatic compounds, contains type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type regulator similar to CbnR which is involved in the regulation of chlorocatechol breakdown. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Ve
Probab=40.37  E-value=48  Score=20.04  Aligned_cols=26  Identities=23%  Similarity=0.413  Sum_probs=21.6

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++...+.+|.+++|++.+.+.+.
T Consensus        11 ~~~~l~~~l~~~~~~~P~i~v~~~~~   36 (198)
T cd08447          11 AYSFLPRLLAAARAALPDVDLVLREM   36 (198)
T ss_pred             HHHHHHHHHHHHHHHCCCeEEEEEeC
Confidence            45667889999999999999998654


No 82 
>cd08411 PBP2_OxyR The C-terminal substrate-binding domain of the LysR-type transcriptional regulator OxyR, a member of the type 2 periplasmic binding fold protein superfamily. OxyR senses hydrogen peroxide and is activated through the formation of an intramolecular disulfide bond. The OxyR activation induces the transcription of genes necessary for the bacterial defense against oxidative stress. The OxyR of LysR-type transcriptional regulator family is composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repre
Probab=40.08  E-value=43  Score=20.37  Aligned_cols=23  Identities=35%  Similarity=0.534  Sum_probs=19.8

Q ss_pred             HHHHhCHHHHHHhCCCCeEEEEE
Q psy15303         28 DFLAQHYVPLKQANPKFPILVRE   50 (72)
Q Consensus        28 ~Fl~~~l~~~k~~NP~v~i~v~~   50 (72)
                      .++..-+.+|++++|++.|.+..
T Consensus        14 ~~l~~~l~~~~~~~P~i~i~i~~   36 (200)
T cd08411          14 YLLPRLLPALRQAYPKLRLYLRE   36 (200)
T ss_pred             hhhHHHHHHHHHHCCCcEEEEEe
Confidence            47788899999999999998875


No 83 
>PF06244 DUF1014:  Protein of unknown function (DUF1014);  InterPro: IPR010422 This family consists of several hypothetical eukaryotic proteins of unknown function.
Probab=39.03  E-value=25  Score=22.94  Aligned_cols=20  Identities=25%  Similarity=0.428  Sum_probs=17.0

Q ss_pred             HHHHHHhCHHHHHHhCCCCe
Q psy15303         26 VRDFLAQHYVPLKQANPKFP   45 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~   45 (72)
                      -..|-+.+||.+++.||++-
T Consensus        80 y~afeE~~Lp~lK~E~PgLr   99 (122)
T PF06244_consen   80 YKAFEERRLPELKEENPGLR   99 (122)
T ss_pred             HHHHHHHHhHHHHhhCCCch
Confidence            45678899999999999874


No 84 
>cd08442 PBP2_YofA_SoxR_like The C-terminal substrate binding domain of LysR-type transcriptional regulators, YofA and SoxR, contains the type 2 periplasmic binding fold. YofA is a LysR-like transcriptional regulator of cell growth in Bacillus subtillis. YofA controls cell viability and the formation of constrictions during cell division. YofaA positively regulates expression of the cell division gene ftsW, and thus is essential for cell viability during stationary-phase growth of Bacillus substilis. YofA shows significant homology to SoxR from Arthrobacter sp. TE1826. SoxR is a negative regulator for the sarcosine oxidase gene soxA. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine, which is involved in the metabolism of creatine and choline. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides
Probab=38.92  E-value=40  Score=20.23  Aligned_cols=26  Identities=12%  Similarity=0.082  Sum_probs=21.3

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEEcC
Q psy15303         27 RDFLAQHYVPLKQANPKFPILVRECS   52 (72)
Q Consensus        27 R~Fl~~~l~~~k~~NP~v~i~v~~~~   52 (72)
                      ..++...+.+|.+++|++.+.+....
T Consensus        12 ~~~l~~~l~~~~~~~P~i~l~i~~~~   37 (193)
T cd08442          12 AVRLPPLLAAYHARYPKVDLSLSTGT   37 (193)
T ss_pred             hhhhHHHHHHHHHHCCCceEEEEeCC
Confidence            35677889999999999999997643


No 85 
>cd08459 PBP2_DntR_NahR_LinR_like The C-terminal substrate binding domain of LysR-type transcriptional regulators that are involved in the catabolism of dinitrotoluene, naphthalene and gamma-hexachlorohexane; contains the type 2 periplasmic binding fold. This CD includes LysR-like bacterial transcriptional regulators, DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded.  DntR from Burkholderia species controls genes encoding enzymes for oxidative degradation of the nitro-aromatic compound 2,4-dinitrotoluene. The active form of DntR is homotetrameric, consisting of a dimer of dimers. NahR is a salicylate-dependent transcription activator of the nah and sal operons for naphthalene degradation.  Salicylic acid is an intermediate o
Probab=38.91  E-value=65  Score=19.62  Aligned_cols=27  Identities=19%  Similarity=0.215  Sum_probs=22.1

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEcC
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVRECS   52 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~~   52 (72)
                      ...++..-+.+|++++|++.+.+....
T Consensus        11 ~~~~l~~~l~~~~~~~P~v~v~i~~~~   37 (201)
T cd08459          11 EMYFLPRLLAALREVAPGVRIETVRLP   37 (201)
T ss_pred             HHHHHHHHHHHHHHHCCCCeEEEEecC
Confidence            345678899999999999999997643


No 86 
>cd08458 PBP2_NocR The C-terminal substrate-domain of LysR-type transcriptional regulator, NocR, involved in the catabolism of nopaline, contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate-domain of LysR-type transcriptional regulator NocR, which is involved in the catabolism of nopaline. Opines are low molecular weight compounds found in plant crown gall tumors produced by the parasitic bacterium Agrobacterium. There are at least 30 different opines identified so far. Opines are utilized by tumor-colonizing bacteria as a source of carbon, nitrogen, and energy. In Agrobacterium tumefaciens,  NocR regulates expression of the divergently transcribed nocB and nocR genes of the nopaline catabolism (noc) region.   This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, an
Probab=38.68  E-value=39  Score=20.75  Aligned_cols=26  Identities=8%  Similarity=0.220  Sum_probs=21.6

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++..-+.+|++++|++.|.+...
T Consensus        11 ~~~~l~~~l~~f~~~~P~v~i~~~~~   36 (196)
T cd08458          11 ALSFMSGVIQTFIADRPDVSVYLDTV   36 (196)
T ss_pred             hhhhhHHHHHHHHHHCCCcEEEEecc
Confidence            45677888999999999999988764


No 87 
>cd08446 PBP2_Chlorocatechol The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the chlorocatechol catabolism, contains the type 2 periplasmic binding fold. This CD includes the substrate binding domain of LysR-type regulators CbnR, ClcR and TfdR, which are involved in the regulation of chlorocatechol breakdown. The chlorocatechol-degradative pathway is often found in bacteria that can use chlorinated aromatic compounds as carbon and energy sources. CbnR is found in the 3-chlorobenzoate degradative bacterium Ralstonia eutropha NH9 and forms a tetramer. CbnR activates the expression of the cbnABCD genes, which are responsible for the degradation of chlorocatechol converted from 3-chlorobenzoate and are transcribed divergently from cbnR.   In soil bacterium Pseudomonas putida, the 3-chlorocatechol-degradative pathway is encoded by clcABD operon, which requires the divergently transcribed clcR for activation. TfdR is involved in the activation of tf
Probab=38.60  E-value=46  Score=20.19  Aligned_cols=26  Identities=12%  Similarity=0.229  Sum_probs=21.2

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      .-.++..-+.+|++++|++.+.+...
T Consensus        12 ~~~~l~~~i~~~~~~~P~v~l~i~~~   37 (198)
T cd08446          12 ILDTVPRLLRAFLTARPDVTVSLHNM   37 (198)
T ss_pred             HHHHHHHHHHHHHHHCCCeEEEEeeC
Confidence            34567888999999999999998763


No 88 
>TIGR00741 yfiA ribosomal subunit interface protein. The member of this family from E. coli is now recognized as a protein at the interace between ribosomal large and small subunits, with about 1/3 as many copies per cell as the number of ribosomes.
Probab=38.50  E-value=81  Score=18.30  Aligned_cols=32  Identities=9%  Similarity=0.228  Sum_probs=25.4

Q ss_pred             EEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCC
Q psy15303         12 LRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKF   44 (72)
Q Consensus        12 L~~~yC~~~~sS~GvR~Fl~~~l~~~k~~NP~v   44 (72)
                      +.+.. .+-.-+..+++|+++.+..+.+-.|++
T Consensus         3 i~i~~-~~~~~t~~l~~~i~~k~~kl~k~~~~i   34 (95)
T TIGR00741         3 INITG-KNVEITEALREYVEEKLARLERYFTHI   34 (95)
T ss_pred             EEEEE-eccccCHHHHHHHHHHHHHHHHhcCCC
Confidence            44444 666779999999999999998888764


No 89 
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily.
Probab=38.44  E-value=13  Score=17.18  Aligned_cols=23  Identities=22%  Similarity=0.491  Sum_probs=17.0

Q ss_pred             cCceEEEEEecCCCCCCHHHHHHH
Q psy15303          7 SKLKELRIHLCQKGGSSSGVRDFL   30 (72)
Q Consensus         7 ~qLk~L~~~yC~~~~sS~GvR~Fl   30 (72)
                      ++|++|.+.+|.. =+..|++...
T Consensus         2 ~~L~~L~l~~C~~-itD~gl~~l~   24 (26)
T smart00367        2 PNLRELDLSGCTN-ITDEGLQALA   24 (26)
T ss_pred             CCCCEeCCCCCCC-cCHHHHHHHh
Confidence            5799999999973 4566776543


No 90 
>cd08427 PBP2_LTTR_like_2 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor.  The genes controlled by the LTTRs have diverse functi
Probab=38.37  E-value=50  Score=19.84  Aligned_cols=26  Identities=12%  Similarity=0.336  Sum_probs=21.6

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++...+.+|.+.+|++.+.+...
T Consensus        11 ~~~~l~~~l~~~~~~~P~i~l~~~~~   36 (195)
T cd08427          11 LTGLLPRALARLRRRHPDLEVHIVPG   36 (195)
T ss_pred             HHHHhHHHHHHHHHHCCCceEEEEeC
Confidence            34677889999999999999998753


No 91 
>cd08469 PBP2_PnbR The C-terminal substrate binding domain of LysR-type transcriptional regulator PnbR, which is involved in regulating the pnb genes encoding enzymes for 4-nitrobenzoate catabolism, contains the type 2 periplasmic binding fold. PnbR is the regulator of one or both of the two pnb genes that encoding enzymes for 4-nitrobenzoate catabolism. In Pseudomonas putida strain, pnbA encodes a 4-nitrobenzoate  reductase, which is responsible for catalyzing the direct reduction of 4-nitrobenzoate to 4-hydroxylaminobenzoate, and pnbB encodes a 4-hydroxylaminobenzoate lyase, which catalyzes the conversion of 4-hydroxylaminobenzoate to 3, 4-dihydroxybenzoic acid and ammonium. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft bet
Probab=38.32  E-value=57  Score=20.43  Aligned_cols=27  Identities=15%  Similarity=0.222  Sum_probs=22.2

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEcC
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVRECS   52 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~~   52 (72)
                      ...++...+.+|.+++|++.+.+....
T Consensus        11 ~~~~l~~~l~~f~~~~P~v~l~i~~~~   37 (221)
T cd08469          11 TAVLLPALVRRLETEAPGIDLRIRPVT   37 (221)
T ss_pred             HHHHHHHHHHHHHHHCCCcEEEEeeCC
Confidence            346778889999999999999997643


No 92 
>PRK13999 potassium-transporting ATPase subunit C; Provisional
Probab=37.73  E-value=30  Score=24.52  Aligned_cols=45  Identities=24%  Similarity=0.406  Sum_probs=34.7

Q ss_pred             cCCCCCCHHHHHHHHhCHHHHHHhCC--CCeE--EEEEcCCCCCEEEEE
Q psy15303         17 CQKGGSSSGVRDFLAQHYVPLKQANP--KFPI--LVRECSGVTPVVWAR   61 (72)
Q Consensus        17 C~~~~sS~GvR~Fl~~~l~~~k~~NP--~v~i--~v~~~~g~~P~l~a~   61 (72)
                      ++-++++.-+.+-+++....++++||  .||.  ++....|-+|.|.-+
T Consensus        97 SNlgpsnp~L~~~v~~r~~~~~~~~~~~~vP~DlvTaSgSGLDPhISp~  145 (201)
T PRK13999         97 SNLGPTSKALADRVKEDVDALKAENPGAPVPVDLVTTSGSGLDPDISPE  145 (201)
T ss_pred             cCCCCCCHHHHHHHHHHHHHHHHhCCCCCCCHHHHhcccccCCCCCCHH
Confidence            46678899999999999999999998  5553  345566778877543


No 93 
>cd08433 PBP2_Nac The C-teminal substrate binding domain of LysR-like nitrogen assimilation control (NAC) protein, contains the type 2 periplasmic binding fold. The NAC is a LysR-type transcription regulator that activates expression of operons such as hut (histidine utilization) and ure (urea utilization), allowing use of non-preferred (poor) nitrogen sources, and represses expression of operons, such as glutamate dehydrogenase (gdh), allowing assimilation of the preferred nitrogen source.  The expression of the nac gene is fully dependent on the nitrogen regulatory system (NTR) and the sigma54-containing RNA polymerase (sigma54-RNAP). In response to nitrogen starvation, NTR system activates the expression of nac, and NAC activates the expression of hut, ure, and put (proline utilization). NAC is not involved in the transcription of Sigma70-RNAP operons such as glnA, which directly respond by the NTR system, but activates the transcription of sigma70-RNAP dependent operons such as hut.
Probab=37.60  E-value=35  Score=20.73  Aligned_cols=25  Identities=8%  Similarity=0.108  Sum_probs=20.4

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         27 RDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        27 R~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ..++...+..|.+++|++.+.+...
T Consensus        12 ~~~l~~~l~~~~~~~P~i~i~~~~~   36 (198)
T cd08433          12 SVLAVPLLRAVRRRYPGIRLRIVEG   36 (198)
T ss_pred             hhcchHHHHHHHHHCCCcEEEEEec
Confidence            3566778889999999999998763


No 94 
>cd08467 PBP2_SyrM The C-terminal substrate binding of LysR-type symbiotic regulator SyrM, which activates expression of nodulation gene NodD3, contains the type 2 periplasmic binding fold. Rhizobium is a nitrogen fixing bacteria present in the roots of leguminous plants, which fixes atmospheric nitrogen to the soil. Most Rhizobium species possess multiple nodulation (nod) genes for the development of nodules. For example, Rhizobium meliloti possesses three copies of nodD genes. NodD1 and NodD2 activate nod operons when  Rhizobium is exposed to inducers synthesized by the host plant, while NodD3 acts independent of plant inducers and requires the symbiotic regulator SyrM for nod gene expression. SyrM activates the expression of the regulatory nodulation gene nodD3. In turn, NodD3 activates expression of syrM. In addition, SyrM is involved in exopolysaccharide synthesis. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are 
Probab=37.19  E-value=46  Score=20.58  Aligned_cols=26  Identities=12%  Similarity=0.139  Sum_probs=21.6

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++..-+.+|++++|++.+.+...
T Consensus        11 ~~~~l~~~l~~~~~~~P~i~l~~~~~   36 (200)
T cd08467          11 EVALLPRLAPRLRERAPGLDLRLCPI   36 (200)
T ss_pred             HHHHHHHHHHHHHhhCCCCEEEEecC
Confidence            45677788899999999999998764


No 95 
>cd08475 PBP2_CrgA_like_6 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 6. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene a
Probab=36.96  E-value=47  Score=20.02  Aligned_cols=25  Identities=16%  Similarity=0.184  Sum_probs=21.1

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEE
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVRE   50 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~   50 (72)
                      ...++...+..|++++|++.+.+..
T Consensus        12 ~~~~l~~~l~~~~~~~P~v~i~i~~   36 (199)
T cd08475          12 GRLCVAPLLLELARRHPELELELSF   36 (199)
T ss_pred             HHhhHHHHHHHHHHHCCCeEEEEEe
Confidence            4467788899999999999999964


No 96 
>PRK00315 potassium-transporting ATPase subunit C; Reviewed
Probab=36.85  E-value=29  Score=24.35  Aligned_cols=45  Identities=22%  Similarity=0.393  Sum_probs=34.5

Q ss_pred             cCCCCCCHHHHHHHHhCHHHHHHhCC----CCe--EEEEEcCCCCCEEEEE
Q psy15303         17 CQKGGSSSGVRDFLAQHYVPLKQANP----KFP--ILVRECSGVTPVVWAR   61 (72)
Q Consensus        17 C~~~~sS~GvR~Fl~~~l~~~k~~NP----~v~--i~v~~~~g~~P~l~a~   61 (72)
                      ++-++++.-+++-+++....++++||    .||  .++....|-+|.|.-+
T Consensus        86 SNl~psnp~l~~~v~~r~~~~~~~~~~~~~~vP~DlvTaSgSGLDPhIS~~  136 (193)
T PRK00315         86 SNLAPSNPALDDAIKARVAALRAANPGASSPVPVDLVTASGSGLDPHISPA  136 (193)
T ss_pred             cCCCCCCHHHHHHHHHHHHHHHHhCCCCCCCCCHHHHhccccCCCCCCCHH
Confidence            46788899999999999999999998    355  3345566778876543


No 97 
>cd08485 PBP2_ClcR The C-terminal substrate binding domain of LysR-type transcriptional regulator ClcR involved in the chlorocatechol catabolism, contains type 2 periplasmic binding fold. In soil bacterium Pseudomonas putida, the ortho-pathways of catechol and 3-chlorocatechol are central catabolic pathways that convert aromatic and chloroaromaric compounds to tricarboxylic acid (TCA) cycle intermediates. The 3-chlorocatechol-degradative pathway is encoded by clcABD operon, which requires the divergently transcribed clcR and an intermediate of the pathway, 2-chloromuconate, as an inducer for activation. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding th
Probab=36.16  E-value=37  Score=21.02  Aligned_cols=26  Identities=15%  Similarity=0.115  Sum_probs=21.2

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++..-+.+|++++|++.+.+.+.
T Consensus        12 ~~~~l~~~l~~~~~~~P~i~l~~~~~   37 (198)
T cd08485          12 VLHTLPLLLRQLLSVAPSATVSLTQM   37 (198)
T ss_pred             hhHHHHHHHHHHHHhCCCcEEEEEEC
Confidence            34577788899999999999998753


No 98 
>PRK14001 potassium-transporting ATPase subunit C; Provisional
Probab=36.15  E-value=32  Score=24.08  Aligned_cols=44  Identities=16%  Similarity=0.282  Sum_probs=34.4

Q ss_pred             cCCCCCCHHHHHHHHhCHHHHHHhCCC-----Ce--EEEEEcCCCCCEEEE
Q psy15303         17 CQKGGSSSGVRDFLAQHYVPLKQANPK-----FP--ILVRECSGVTPVVWA   60 (72)
Q Consensus        17 C~~~~sS~GvR~Fl~~~l~~~k~~NP~-----v~--i~v~~~~g~~P~l~a   60 (72)
                      ++.++++.-+++=+++....++++||.     ||  .++....|-+|.|.-
T Consensus        85 SNl~psnp~l~~~v~~r~~~~~~~~~~~~~~~vP~DlvTaSgSGLDPhIS~  135 (189)
T PRK14001         85 SNLGPTNEKLLAAVAERVTAYRKENNLPADTLVPVDAVTGSGSGLDPAISV  135 (189)
T ss_pred             cCCCCCCHHHHHHHHHHHHHHHHhCCCccCCCCCHHHHhcccccCCCCCCH
Confidence            567889999999999999999999984     44  344556677887753


No 99 
>cd08417 PBP2_Nitroaromatics_like The C-terminal substrate binding domain of LysR-type transcriptional regulators that involved in the catabolism of nitroaromatic/naphthalene compounds and that of related regulators; contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of dinitrotoluene and similar compounds, such as DntR, NahR, and LinR. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. Also included are related LysR-type regulators clustered together in phylogenetic trees, including NodD, ToxR, LeuO, SyrM, TdcA, and PnbR. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrate
Probab=36.04  E-value=54  Score=19.85  Aligned_cols=26  Identities=15%  Similarity=0.110  Sum_probs=21.5

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++..-+.+|.+++|++.|.+...
T Consensus        11 ~~~~~~~~i~~~~~~~P~i~l~~~~~   36 (200)
T cd08417          11 EALLLPPLLARLRQEAPGVRLRFVPL   36 (200)
T ss_pred             HHHHHHHHHHHHHhhCCCeEEEeccC
Confidence            35677888899999999999998754


No 100
>cd08430 PBP2_IlvY The C-terminal substrate binding of LysR-type transcriptional regulator IlvY, which activates the expression of ilvC gene that encoding acetohydroxy acid isomeroreductase for the biosynthesis of branched amino acids; contains the type 2 periplasmic binding fold. In Escherichia coli, IlvY is required for the regulation of ilvC gene expression that encodes acetohydroxy acid isomeroreductase (AHIR), a key enzyme in the biosynthesis of branched-chain amino acids (isoleucine, valine, and leucine). The ilvGMEDA operon genes encode remaining enzyme activities required for the biosynthesis of these amino acids. Activation of ilvC transcription by IlvY requires the additional binding of a co-inducer molecule (either alpha-acetolactate or alpha-acetohydoxybutyrate, the substrates for AHIR) to a preformed complex of IlvY protein-DNA.  Like many other LysR-family members, IlvY negatively auto-regulates the transcription of its own divergently transcribed ilvY gene in an inducer-i
Probab=36.02  E-value=32  Score=20.77  Aligned_cols=25  Identities=16%  Similarity=0.284  Sum_probs=20.7

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         27 RDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        27 R~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ..++...+.+|.+.+|++.+.+...
T Consensus        12 ~~~l~~~l~~~~~~~P~v~l~~~~~   36 (199)
T cd08430          12 YSFLPPILERFRAQHPQVEIKLHTG   36 (199)
T ss_pred             eeeccHHHHHHHHHCCCceEEEEeC
Confidence            3567788899999999999998764


No 101
>smart00329 BPI2 BPI/LBP/CETP C-terminal domain. Bactericidal permeability-increasing protein (BPI) / Lipopolysaccharide-binding protein (LBP) / Cholesteryl ester transfer protein (CETP) C-terminal domain
Probab=35.81  E-value=91  Score=21.04  Aligned_cols=33  Identities=9%  Similarity=0.039  Sum_probs=27.9

Q ss_pred             HHHhCHHHHHHhCCCCeEEEEEcCCCCCEEEEE
Q psy15303         29 FLAQHYVPLKQANPKFPILVRECSGVTPVVWAR   61 (72)
Q Consensus        29 Fl~~~l~~~k~~NP~v~i~v~~~~g~~P~l~a~   61 (72)
                      ++..-+|+++++.|+-++.+.-.....|.+...
T Consensus        48 ~~~~~iP~l~~~yPn~~~~L~i~~~~~P~v~i~   80 (202)
T smart00329       48 CFGTLVPEVAEQYPDSTLQLEISVLSPPRVTLQ   80 (202)
T ss_pred             HHHHHHHHHHHHCCCCcEEEEEEeCCCCEEEEe
Confidence            777888999999999888887777779998875


No 102
>COG1570 XseA Exonuclease VII, large subunit [DNA replication, recombination, and repair]
Probab=35.64  E-value=57  Score=25.67  Aligned_cols=30  Identities=20%  Similarity=0.351  Sum_probs=25.4

Q ss_pred             CCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEEcC
Q psy15303         19 KGGSSSGVRDFLAQHYVPLKQANPKFPILVRECS   52 (72)
Q Consensus        19 ~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v~~~~   52 (72)
                      ||+++..+||.+.    .+++..|.++|++.+..
T Consensus       142 TS~tgAairDIl~----~~~rR~P~~~viv~pt~  171 (440)
T COG1570         142 TSPTGAALRDILH----TLSRRFPSVEVIVYPTL  171 (440)
T ss_pred             cCCchHHHHHHHH----HHHhhCCCCeEEEEecc
Confidence            6888999999986    47889999999998753


No 103
>PRK10470 ribosome hibernation promoting factor HPF; Provisional
Probab=35.27  E-value=89  Score=18.47  Aligned_cols=27  Identities=15%  Similarity=0.341  Sum_probs=22.6

Q ss_pred             CCCCCCHHHHHHHHhCHHHHHHhCCCC
Q psy15303         18 QKGGSSSGVRDFLAQHYVPLKQANPKF   44 (72)
Q Consensus        18 ~~~~sS~GvR~Fl~~~l~~~k~~NP~v   44 (72)
                      .+-.-|.++|+|+++.+..+.+-.+++
T Consensus         8 r~i~~t~al~~~v~~kl~kL~r~~~~i   34 (95)
T PRK10470          8 HNVEITEALREFVTAKFAKLEQYFDRI   34 (95)
T ss_pred             EeeccCHHHHHHHHHHHHHHHHhcCCC
Confidence            455678999999999999999888765


No 104
>KOG1909|consensus
Probab=34.80  E-value=35  Score=26.44  Aligned_cols=36  Identities=28%  Similarity=0.538  Sum_probs=29.3

Q ss_pred             cCceEEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEE
Q psy15303          7 SKLKELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILV   48 (72)
Q Consensus         7 ~qLk~L~~~yC~~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v   48 (72)
                      ++|++|.+.||.-.  ++|+-.|++    .+++.||.+++.-
T Consensus       241 ~~L~El~l~dcll~--~~Ga~a~~~----al~~~~p~L~vl~  276 (382)
T KOG1909|consen  241 PHLRELNLGDCLLE--NEGAIAFVD----ALKESAPSLEVLE  276 (382)
T ss_pred             chheeecccccccc--cccHHHHHH----HHhccCCCCceec
Confidence            47999999999875  889988875    5677799888754


No 105
>PTZ00062 glutaredoxin; Provisional
Probab=34.67  E-value=1.1e+02  Score=21.32  Aligned_cols=37  Identities=11%  Similarity=0.036  Sum_probs=27.5

Q ss_pred             EEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEEcC
Q psy15303         12 LRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRECS   52 (72)
Q Consensus        12 L~~~yC~~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v~~~~   52 (72)
                      +-+...+|.+.++-|    ..-++++++++|++.|+.-.+.
T Consensus        21 vl~f~a~w~~~C~~m----~~vl~~l~~~~~~~~F~~V~~d   57 (204)
T PTZ00062         21 VLYVKSSKEPEYEQL----MDVCNALVEDFPSLEFYVVNLA   57 (204)
T ss_pred             EEEEeCCCCcchHHH----HHHHHHHHHHCCCcEEEEEccc
Confidence            444448888888854    5566788999999998886654


No 106
>cd08462 PBP2_NodD The C-terminal substsrate binding domain of NodD family of LysR-type transcriptional regulators that regulates the expression of nodulation (nod) genes; contains the type 2 periplasmic binding fold. The nodulation (nod) genes in soil bacteria play important roles in the development of nodules. nod genes are involved in synthesis of Nod factors that are required for bacterial entry into root hairs. Thirteen nod genes have been identified and are classified into five transcription units: nodD, nodABCIJ, nodFEL, nodMNT, and nodO. NodD is negatively auto-regulates its own expression of nodD gene, while other nod genes are inducible and positively regulated by NodD in the presence of flavonoids released by plant roots. This substrate-binding domain has significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. T
Probab=34.60  E-value=62  Score=19.91  Aligned_cols=26  Identities=8%  Similarity=0.042  Sum_probs=22.0

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++..-+.+|++.+|++.+.+...
T Consensus        11 ~~~~l~~~i~~~~~~~P~i~l~i~~~   36 (200)
T cd08462          11 ITVLLPPVIERVAREAPGVRFELLPP   36 (200)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEecC
Confidence            45677888999999999999999763


No 107
>cd08484 PBP2_LTTR_beta_lactamase The C-terminal substrate-domain of LysR-type transcriptional regulators for beta-lactamase genes, contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LysR-type transcriptional regulators, BlaA and AmpR, that are involved in control of the expression of beta-lactamase genes.  Beta-lactamases are responsible for bacterial resistance to beta-lactam antibiotics such as penicillins. BlaA (a constitutive class A penicillinase) belongs to the LysR family of transcriptional regulators, while BlaB (an inducible class C cephalosporinase or AmpC) can be referred to as a penicillin-binding protein, but it does not act as a beta-lactamase. AmpR regulates the expression of beta-lactamases in many enterobacterial strains and many other gram-negative bacilli. In contrast to BlaA, AmpR acts an activator only in the presence of the beta-lactam inducer. In the absence of the inducer, AmpR acts as a repressor. The topol
Probab=34.10  E-value=71  Score=19.31  Aligned_cols=27  Identities=11%  Similarity=0.222  Sum_probs=22.3

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEcC
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVRECS   52 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~~   52 (72)
                      ...++...+.+|.+++|++.+.+....
T Consensus        11 ~~~~l~~~l~~f~~~~P~i~l~~~~~~   37 (189)
T cd08484          11 AVGWLLPRLAEFRQLHPFIDLRLSTNN   37 (189)
T ss_pred             HHHHHHhhhHHHHHHCCCceEEEeccc
Confidence            356777889999999999999997643


No 108
>cd08468 PBP2_Pa0477 The C-terminal substrate biniding domain of an uncharacterized LysR-like transcriptional regulator Pa0477 related to DntR, contains the type 2 periplasmic binding fold. LysR-type transcriptional regulator Pa0477 is related to DntR, which controls genes encoding enzymes for oxidative degradation of the nitro-aromatic compound 2,4-dinitrotoluene. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded.  The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their spec
Probab=33.30  E-value=72  Score=19.64  Aligned_cols=25  Identities=8%  Similarity=0.163  Sum_probs=20.8

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         27 RDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        27 R~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ..++..-+.+|++++|++.+.+...
T Consensus        12 ~~~l~~~l~~~~~~~P~v~i~~~~~   36 (202)
T cd08468          12 LAVMPRLMARLEELAPSVRLNLVHA   36 (202)
T ss_pred             HHHhHHHHHHHHhhCCCCEEEEEEC
Confidence            4567888899999999999988764


No 109
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif. The gene name for the human protein is TxnDC9. The two characterized members are described as Phd-like proteins, PLP1 of Saccharomyces cerevisiae and PhLP3 of Dictyostelium discoideum. Gene disruption experiments show that both PLP1 and PhLP3 are non-essential proteins. Unlike Phd and most Phd-like proteins, members of this group do not contain the Phd N-terminal helical domain which is implicated in binding to the G protein betagamma subunit.
Probab=33.18  E-value=97  Score=18.86  Aligned_cols=34  Identities=6%  Similarity=-0.139  Sum_probs=24.3

Q ss_pred             EEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEE
Q psy15303         11 ELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILV   48 (72)
Q Consensus        11 ~L~~~yC~~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v   48 (72)
                      -+...|.+|++.++-+...+    .++++++|++.|.-
T Consensus        25 vvV~f~a~~c~~C~~~~p~l----~~la~~~~~i~f~~   58 (113)
T cd02989          25 VVCHFYHPEFFRCKIMDKHL----EILAKKHLETKFIK   58 (113)
T ss_pred             EEEEEECCCCccHHHHHHHH----HHHHHHcCCCEEEE
Confidence            46677889999998776654    45666778877644


No 110
>cd08451 PBP2_BudR The C-terminal substrate binding domain of LysR-type transcrptional regulator BudR, which is responsible for activation of the expression of the butanediol operon genes; contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of BudR regulator, which is responsible for induction of the butanediol formation pathway under fermentative growth conditions. Three enzymes are involved in the production of 1 mol of 2,3 butanediol from the condensation of 2 mol of pyruvate with acetolactate and acetoin as intermediates: acetolactate synthetase, acetolactate decarboxylase, and acetoin reductase. In Klebsiella terrigena, BudR regulates the expression of the budABC operon genes, encoding these three enzymes of the butanediol pathway. In many bacterial species, the use of this pathway can prevent intracellular acidification by diverting metabolism from acid production to the formation of neutral compounds (acetoin and butanediol). This substra
Probab=33.16  E-value=43  Score=20.22  Aligned_cols=23  Identities=13%  Similarity=0.299  Sum_probs=19.6

Q ss_pred             HHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         29 FLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        29 Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ++..-+.+|++.+|++.+.+...
T Consensus        15 ~l~~~l~~~~~~~P~i~l~i~~~   37 (199)
T cd08451          15 LVPGLIRRFREAYPDVELTLEEA   37 (199)
T ss_pred             ccHHHHHHHHHHCCCcEEEEecC
Confidence            56778899999999999998754


No 111
>PLN02757 sirohydrochlorine ferrochelatase
Probab=32.98  E-value=30  Score=22.93  Aligned_cols=30  Identities=13%  Similarity=0.156  Sum_probs=19.8

Q ss_pred             HHHhCHHHHHHhCCCCeEEEEEcCCCCCEE
Q psy15303         29 FLAQHYVPLKQANPKFPILVRECSGVTPVV   58 (72)
Q Consensus        29 Fl~~~l~~~k~~NP~v~i~v~~~~g~~P~l   58 (72)
                      =|...+.++++++|++.|.+-+.=|.||.+
T Consensus        91 DIp~~v~~~~~~~p~~~i~~~~pLG~~p~l  120 (154)
T PLN02757         91 DIPALTAEAAKEHPGVKYLVTAPIGLHELM  120 (154)
T ss_pred             HHHHHHHHHHHHCCCcEEEECCCCCCCHHH
Confidence            344455567777888887777666777643


No 112
>PRK14002 potassium-transporting ATPase subunit C; Provisional
Probab=32.37  E-value=36  Score=23.80  Aligned_cols=45  Identities=18%  Similarity=0.262  Sum_probs=34.5

Q ss_pred             cCCCCCCHHHHHHHHhCHHHHHHhCCC-----Ce--EEEEEcCCCCCEEEEE
Q psy15303         17 CQKGGSSSGVRDFLAQHYVPLKQANPK-----FP--ILVRECSGVTPVVWAR   61 (72)
Q Consensus        17 C~~~~sS~GvR~Fl~~~l~~~k~~NP~-----v~--i~v~~~~g~~P~l~a~   61 (72)
                      ++-++++.-+++=+++....++++||+     ||  .++....|-+|.|.-+
T Consensus        81 SNl~psnp~L~~~v~~r~~~~~~~~~~~~~~~vP~DlvTaSgSGLDPhISp~  132 (186)
T PRK14002         81 SNKGPSNPEYLAEVQARIDTFLVHHPYLSRKDIPAEMVTASGSGLDPNISPQ  132 (186)
T ss_pred             cCCCCCCHHHHHHHHHHHHHHHHhCCCCCCCCCCHHHHhccccCCCCCCCHH
Confidence            567889999999999999999999986     33  3345566778876543


No 113
>TIGR02036 dsdC D-serine deaminase transcriptional activator. This family, part of the LysR family of transcriptional regulators, activates transcription of the gene for D-serine deaminase, dsdA. Trusted members of this family so far are found adjacent to dsdA and only in Gammaproteobacteria, including E. coli, Vibrio cholerae, and Colwellia psychrerythraea.
Probab=32.12  E-value=74  Score=22.10  Aligned_cols=28  Identities=11%  Similarity=0.159  Sum_probs=23.3

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEcCC
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVRECSG   53 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~~g   53 (72)
                      ...++...+.+|.+++|++.+.+.....
T Consensus       107 ~~~~l~~~l~~f~~~~P~i~l~l~~~~~  134 (302)
T TIGR02036       107 AQCWLVPRIGDFTRRYPSISLTVLTGNE  134 (302)
T ss_pred             HHHHHHHHHHHHHHHCCCceEEEEeCCc
Confidence            4567888999999999999999987543


No 114
>cd08413 PBP2_CysB_like The C-terminal substrate domain of LysR-type transcriptional regulators CysB-like contains type 2 periplasmic binding fold. CysB is a transcriptional activator of genes involved in sulfate and thiosulfate transport, sulfate reduction, and cysteine synthesis. In Escherichia coli, the regulation of transcription in response to sulfur source is attributed to two transcriptional regulators, CysB and Cbl. CysB, in association with Cbl, downregulates the expression of ssuEADCB operon which is required for the utilization of sulfur from aliphatic sulfonates, in the presence of cysteine. Also, Cbl and CysB together directly function as transcriptional activators of tauABCD genes, which are required for utilization of taurine as sulfur source for growth. Like many other members of the LTTR family, CysB is composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-bi
Probab=31.87  E-value=47  Score=20.49  Aligned_cols=26  Identities=15%  Similarity=0.273  Sum_probs=20.3

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++..-+.+|.+++|++++.+...
T Consensus        11 ~~~~l~~~l~~~~~~~P~i~v~~~~~   36 (198)
T cd08413          11 ARYVLPPVIAAFRKRYPKVKLSLHQG   36 (198)
T ss_pred             hhhhccHHHHHHHHhCCceEEEEEeC
Confidence            35567788889999999998888754


No 115
>PLN02958 diacylglycerol kinase/D-erythro-sphingosine kinase
Probab=31.57  E-value=91  Score=24.23  Aligned_cols=44  Identities=20%  Similarity=0.202  Sum_probs=34.9

Q ss_pred             eEEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEEcCC
Q psy15303         10 KELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRECSG   53 (72)
Q Consensus        10 k~L~~~yC~~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v~~~~g   53 (72)
                      |++.|-+.+.+|..++.+.|.+.--+.|++++-++.+.+.+..+
T Consensus       112 kr~lvIvNP~SGkg~a~k~~~~~v~~~L~~~gi~~~v~~T~~~g  155 (481)
T PLN02958        112 KRLLVFVNPFGGKKSASKIFFDVVKPLLEDADIQLTIQETKYQL  155 (481)
T ss_pred             cEEEEEEcCCCCCcchhHHHHHHHHHHHHHcCCeEEEEeccCcc
Confidence            67889999999999998888777777888888777776655543


No 116
>PF02482 Ribosomal_S30AE:  Sigma 54 modulation protein / S30EA ribosomal protein;  InterPro: IPR003489 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This family contains the sigma-54 modulation protein family and the S30Ae family of ribosomal proteins which includes the light-repressed protein (lrtA) [].; GO: 0005488 binding, 0044238 primary metabolic process; PDB: 1L4S_A 1VOX_a 1VOV_a 3V2E_Y 3V2C_Y 1N3G_A 1VOS_a 1VOZ_a 1VOQ_a 1IMU_A ....
Probab=31.51  E-value=97  Score=17.89  Aligned_cols=32  Identities=9%  Similarity=0.203  Sum_probs=22.7

Q ss_pred             EEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCC
Q psy15303         12 LRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKF   44 (72)
Q Consensus        12 L~~~yC~~~~sS~GvR~Fl~~~l~~~k~~NP~v   44 (72)
                      |.|.+ .+-.-|..+|+++++.+..+.+-.+++
T Consensus         2 i~i~~-~~~~~t~~l~~~i~~kl~kl~~~~~~i   33 (97)
T PF02482_consen    2 IQITG-RNFELTDALREYIEEKLEKLERFFDDI   33 (97)
T ss_dssp             EEEEE-CSS---HHHHHHHHHHHHHHHTTSSC-
T ss_pred             EEEEE-EcccCCHHHHHHHHHHHHHHHhhcCCC
Confidence            34444 666789999999999999999988755


No 117
>cd00026 BPI2 BPI/LBP/CETP C-terminal domain; Bactericidal permeability-increasing protein (BPI) / Lipopolysaccharide-binding protein (LBP) / Cholesteryl ester transfer protein (CETP) C-terminal domain; binds to and neutralizes lipopolysaccharides from the outer membrane of Gram-negative bacteria.; Apolar pockets on the concave surface bind a molecule of phosphatidylcholine, primarily by interacting with their acyl chains; this suggests that the pockets may also bind the acyl chains of lipopolysaccharide.
Probab=31.19  E-value=1.3e+02  Score=20.30  Aligned_cols=32  Identities=13%  Similarity=0.197  Sum_probs=25.3

Q ss_pred             HHhCHHHHHHhCCCCeEEEEEcCCCCCEEEEE
Q psy15303         30 LAQHYVPLKQANPKFPILVRECSGVTPVVWAR   61 (72)
Q Consensus        30 l~~~l~~~k~~NP~v~i~v~~~~g~~P~l~a~   61 (72)
                      +..-+|+++++.|+-++.+.-.....|.+...
T Consensus        44 ~~~~iP~l~~~yPn~~~~L~i~~~~~P~v~i~   75 (200)
T cd00026          44 FGIFIPELAKKYPNMPQQLKISVSSPPHLVLS   75 (200)
T ss_pred             HHHHHHHHHHHCCCCcEEEEEEeCCCCEEEEe
Confidence            34468999999999888887777778988764


No 118
>PF09457 RBD-FIP:  FIP domain ;  InterPro: IPR019018 The Rab11 GTPase regulates recycling of internalized plasma membrane receptors and is essential for completion of cytokinesis. A family of Rab11 interacting proteins (FIPs) that conserve a C-terminal Rab-binding domain (RBD) selectively recognise the active form of Rab11. FIPs are diverse in sequence length and composition toward their N-termini, presumably a feature that underpins their specific roles in Rab11-mediated vesicle trafficking. They have been divided into three subfamilies (classe I, II, and III)on the basis of domain architecture. Class I FIPs comprises a subfamily of three proteins (Rip11/pp75/FIP5, Rab-coupling protein (RCP), and FIP2) that possess an N- terminal C2 domain, localize to recycling endosomes, and regulate plasma membrane recycling. The class II subfamily consists of two proteins (FIP3/eferin/arfophilin and FIP4) with tandem EF hands and a proline-rich region. Class II FIPs localize to recycling endosomes, the trans-Golgi network, and have been implicated in the regulation of membrane trafficking during cytokinesis. The class III subfamily consists of a single protein, FIP1, which does not contain obvious homology domains or motifs other than the FIP-RBD [, , , ]. The FIP-RBD domain is also found in Rab6-interacting protein Erc1/Elks. Erc1 is the regulatory subunit of the IKK complex and probably recruits IkappaBalpha/NFKBIA to the complex []. It may be involved in the organisation of the cytomatrix at the nerve terminals active zone (CAZ) which regulates neurotransmitter release. It may also be involved in vesicle trafficking at the CAZ, as well as in Rab-6 regulated endosomes to Golgi transport []. The FIB-RBD domain consists of an N-terminal long alpha-helix, followed by a 90 degrees bend at a conserved proline residue, a 3(10) helix and a C-terminal short beta-strand, adopting an "L" shape. The long alpha-helix forms a parallel coiled-coil homodimer that symmetrically interacts with two Rab11 molecules on both sides, forming a quaternary Rab11-(FIP)2-Rab11 complex. The Rab11-interacting region of FIP-RBD is confined to the C-terminal 24 amino acids, which cover the C-terminal half of the long alpha-helix and the short beta-strand [, , , ].  This entry represents the FIP-RBD domain.; PDB: 2HV8_E 2D7C_D 2K6S_B 2GZD_D 2GZH_B.
Probab=31.05  E-value=18  Score=20.02  Aligned_cols=20  Identities=15%  Similarity=0.436  Sum_probs=16.6

Q ss_pred             HHHHHHHhCHHHHHHhCCCC
Q psy15303         25 GVRDFLAQHYVPLKQANPKF   44 (72)
Q Consensus        25 GvR~Fl~~~l~~~k~~NP~v   44 (72)
                      -+++||.+-+..+...+|++
T Consensus        25 eLe~YiD~LL~rVmE~~P~I   44 (48)
T PF09457_consen   25 ELEDYIDNLLVRVMEQTPSI   44 (48)
T ss_dssp             HHHHHHHHHHHHHHCC-GGG
T ss_pred             HHHHHHHHHHHHHHHhCcch
Confidence            47899999999999999975


No 119
>cd08463 PBP2_DntR_like_4 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold. This CD includes an uncharacterized LysR-type transcriptional regulator similar to DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded.  This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytra
Probab=30.63  E-value=74  Score=19.90  Aligned_cols=25  Identities=12%  Similarity=0.199  Sum_probs=21.1

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEE
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVRE   50 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~   50 (72)
                      ...++..-+.+|++.+|++.+.+.+
T Consensus        11 ~~~~~~~~l~~~~~~~P~~~v~~~~   35 (203)
T cd08463          11 NALFLPELVARFRREAPGARLEIHP   35 (203)
T ss_pred             HHHHhHHHHHHHHHHCCCCEEEEEe
Confidence            3457788999999999999999985


No 120
>KOG0863|consensus
Probab=30.39  E-value=24  Score=25.93  Aligned_cols=25  Identities=20%  Similarity=0.489  Sum_probs=21.2

Q ss_pred             CCCCCHHHHHHHHhCHHHHHHhCCC
Q psy15303         19 KGGSSSGVRDFLAQHYVPLKQANPK   43 (72)
Q Consensus        19 ~~~sS~GvR~Fl~~~l~~~k~~NP~   43 (72)
                      .|--|++.|.||+.++.+|.+.+|+
T Consensus       161 IGsRSQsARTyLEr~~e~f~~~~~e  185 (264)
T KOG0863|consen  161 IGSRSQSARTYLERNLEEFEDSSPE  185 (264)
T ss_pred             cccchhhHHHHHHHHHHHHhcCCHH
Confidence            3557999999999999999988765


No 121
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides. AhpF contains an NTD containing two contiguous TRX-fold subdomains similar to Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO). It also contains a catalytic core similar to TRX reductase containing FAD and NADH binding domains with an active site disulfide. The proposed mechanism of action of AhpF is similar to a TRX/TRX reductase system. The flow of reducing equivalents goes from NADH - catalytic core of AhpF - NTD of AhpF - AhpC - peroxide substrates. The catalytic CXXC motif of the NTD of AhpF is contained in its C-terminal TRX subdomain.
Probab=30.34  E-value=1.2e+02  Score=17.85  Aligned_cols=37  Identities=11%  Similarity=0.055  Sum_probs=29.9

Q ss_pred             EEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         11 ELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        11 ~L~~~yC~~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      +|.+...++.+...-++..+    .++++.+|++.+.+...
T Consensus        15 ~i~~F~~~~C~~C~~~~~~~----~~l~~~~~~i~~~~vd~   51 (89)
T cd03026          15 NFETYVSLSCHNCPDVVQAL----NLMAVLNPNIEHEMIDG   51 (89)
T ss_pred             EEEEEECCCCCCcHHHHHHH----HHHHHHCCCceEEEEEh
Confidence            37778888888888887777    67888999999888664


No 122
>PRK13994 potassium-transporting ATPase subunit C; Provisional
Probab=30.22  E-value=40  Score=24.26  Aligned_cols=45  Identities=13%  Similarity=0.310  Sum_probs=33.9

Q ss_pred             cCCCCCCHHHHHHHHhCHHHHHHhC--CC-------Ce--EEEEEcCCCCCEEEEE
Q psy15303         17 CQKGGSSSGVRDFLAQHYVPLKQAN--PK-------FP--ILVRECSGVTPVVWAR   61 (72)
Q Consensus        17 C~~~~sS~GvR~Fl~~~l~~~k~~N--P~-------v~--i~v~~~~g~~P~l~a~   61 (72)
                      ++.++++.-+.+-+++....+++.|  |.       ||  .++....|-+|.|.-+
T Consensus       111 SNlgpsnp~L~~~v~~r~~~~~~~~~~p~~~~~~~~VP~DlVTaSGSGLDPhISp~  166 (222)
T PRK13994        111 TNRSADNEELIQWVKDAKAAVVEDNSVPGYEVKPSDVPADAVTSSGSGLDPDISPA  166 (222)
T ss_pred             cCCCCCCHHHHHHHHHHHHHHHHhCCCCccccCCCCCCHHHHhcccccCCCCCCHH
Confidence            5678899999999999999999999  45       33  3344556778876543


No 123
>KOG1777|consensus
Probab=30.16  E-value=39  Score=27.28  Aligned_cols=24  Identities=25%  Similarity=0.195  Sum_probs=21.5

Q ss_pred             EEEcCCCCCEEEEEecCCcccccc
Q psy15303         48 VRECSGVTPVVWARIPTIGCLGFL   71 (72)
Q Consensus        48 v~~~~g~~P~l~a~Y~n~~~~~~~   71 (72)
                      |+.+.|..|+++..-.|.||-|||
T Consensus       421 vqirtGsNP~i~~NkIWggqNGvL  444 (625)
T KOG1777|consen  421 VQIRTGSNPKIRRNKIWGGQNGVL  444 (625)
T ss_pred             eEeecCCCCeeeecceecCcccEE
Confidence            566789999999999999999987


No 124
>cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S. cerevisiae GST protein, GTT2. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GTT2, a homodimer, exhibits GST activity with standard substrates. Strains with deleted GTT2 genes are viable but exhibit increased sensitivity to heat shock.
Probab=30.04  E-value=93  Score=16.41  Aligned_cols=19  Identities=26%  Similarity=0.282  Sum_probs=15.1

Q ss_pred             EEEecCCCCCCHHHHHHHH
Q psy15303         13 RIHLCQKGGSSSGVRDFLA   31 (72)
Q Consensus        13 ~~~yC~~~~sS~GvR~Fl~   31 (72)
                      ++....+++.|+-+|-++.
T Consensus         2 ~Ly~~~~s~~~~~~~~~L~   20 (74)
T cd03051           2 KLYDSPTAPNPRRVRIFLA   20 (74)
T ss_pred             EEEeCCCCcchHHHHHHHH
Confidence            5666677888999998885


No 125
>PF02638 DUF187:  Glycosyl hydrolase like GH101;  InterPro: IPR003790 This entry describes proteins of unknown function.
Probab=29.80  E-value=77  Score=23.12  Aligned_cols=29  Identities=14%  Similarity=0.343  Sum_probs=24.8

Q ss_pred             HHHHHHHHhCHHHHHHhCCCCeEEEEEcC
Q psy15303         24 SGVRDFLAQHYVPLKQANPKFPILVRECS   52 (72)
Q Consensus        24 ~GvR~Fl~~~l~~~k~~NP~v~i~v~~~~   52 (72)
                      .-+-+||++-+..+|+.||++.|-+.+..
T Consensus       203 ~~I~~~V~~i~~~ik~~kP~v~~sisp~g  231 (311)
T PF02638_consen  203 DNINNFVKRIYDAIKAIKPWVKFSISPFG  231 (311)
T ss_pred             HHHHHHHHHHHHHHHHhCCCCeEEEEeec
Confidence            45778999999999999999999987653


No 126
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family. This glutaredoxin-like protein family contains the conserved CxxC motif and includes the Clostridium pasteurianum protein YruB which has been cloned from a rubredoxin operon. Somewhat related to NrdH, it is unknown whether this protein actually interacts with glutathione/glutathione reducatase, or, like NrdH, some other reductant system.
Probab=29.76  E-value=61  Score=16.86  Aligned_cols=21  Identities=5%  Similarity=0.180  Sum_probs=18.4

Q ss_pred             EEEEecCCCCCCHHHHHHHHh
Q psy15303         12 LRIHLCQKGGSSSGVRDFLAQ   32 (72)
Q Consensus        12 L~~~yC~~~~sS~GvR~Fl~~   32 (72)
                      |++.+.++++.++-++.++++
T Consensus         2 i~lf~~~~C~~C~~~~~~l~~   22 (74)
T TIGR02196         2 VKVYTTPWCPPCKKAKEYLTS   22 (74)
T ss_pred             EEEEcCCCChhHHHHHHHHHH
Confidence            678889999999999999864


No 127
>PF13504 LRR_7:  Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D ....
Probab=29.72  E-value=23  Score=15.06  Aligned_cols=11  Identities=18%  Similarity=0.317  Sum_probs=7.5

Q ss_pred             CceEEEEEecC
Q psy15303          8 KLKELRIHLCQ   18 (72)
Q Consensus         8 qLk~L~~~yC~   18 (72)
                      .|+.|.++.|+
T Consensus         2 ~L~~L~l~~n~   12 (17)
T PF13504_consen    2 NLRTLDLSNNR   12 (17)
T ss_dssp             T-SEEEETSS-
T ss_pred             ccCEEECCCCC
Confidence            68888888886


No 128
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism]
Probab=28.99  E-value=75  Score=18.25  Aligned_cols=24  Identities=17%  Similarity=0.224  Sum_probs=19.8

Q ss_pred             eEEEEEecCCCCCCHHHHHHHHhC
Q psy15303         10 KELRIHLCQKGGSSSGVRDFLAQH   33 (72)
Q Consensus        10 k~L~~~yC~~~~sS~GvR~Fl~~~   33 (72)
                      .+-.+.||..|..|.-+-.++.+.
T Consensus        61 ~~~ivv~C~~G~rS~~aa~~L~~~   84 (110)
T COG0607          61 DDPIVVYCASGVRSAAAAAALKLA   84 (110)
T ss_pred             CCeEEEEeCCCCChHHHHHHHHHc
Confidence            456788999999999999888643


No 129
>PF07205 DUF1413:  Domain of unknown function (DUF1413);  InterPro: IPR010813 This family consists of several hypothetical bacterial proteins, which seem to be specific to Staphylococcus species. Members of this family are typically around 100 residues in length. The function of this family is unknown.
Probab=28.41  E-value=93  Score=17.68  Aligned_cols=33  Identities=15%  Similarity=0.118  Sum_probs=28.5

Q ss_pred             CCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEE
Q psy15303         18 QKGGSSSGVRDFLAQHYVPLKQANPKFPILVRE   50 (72)
Q Consensus        18 ~~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v~~   50 (72)
                      .|..-|.+.|..+.+.+-.+-+++|.++|.+-.
T Consensus        27 ~w~~~s~~~r~~~g~~F~~~V~~~~~~~i~~~~   59 (70)
T PF07205_consen   27 EWNTLSRAERQSLGRAFLYEVKQGPIVRIKIIG   59 (70)
T ss_pred             hhhhCCHHHHHHHHHHHHHHHHhCCCCceEEEe
Confidence            466679999999999999999999999877753


No 130
>PF08073 CHDNT:  CHDNT (NUC034) domain;  InterPro: IPR012958 The CHD N-terminal domain is found in PHD/RING fingers and chromo domain-associated helicases [].; GO: 0003677 DNA binding, 0005524 ATP binding, 0008270 zinc ion binding, 0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=28.22  E-value=83  Score=17.92  Aligned_cols=22  Identities=32%  Similarity=0.449  Sum_probs=16.0

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeE
Q psy15303         25 GVRDFLAQHYVPLKQANPKFPI   46 (72)
Q Consensus        25 GvR~Fl~~~l~~~k~~NP~v~i   46 (72)
                      ..+.|=+.-=|.++++||.++.
T Consensus        15 ~yK~Fsq~vRP~l~~~NPk~~~   36 (55)
T PF08073_consen   15 NYKAFSQHVRPLLAKANPKAPM   36 (55)
T ss_pred             HHHHHHHHHHHHHHHHCCCCcH
Confidence            3455666666889999998863


No 131
>cd08457 PBP2_OccR The C-terminal substrate-domain of LysR-type transcriptional regulator, OccR, involved in the catabolism of octopine, contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate-domain of LysR-type transcriptional regulator OccR, which is involved in the catabolism of octopine. Opines are low molecular weight compounds found in plant crown gall tumors produced by the parasitic bacterium Agrobacterium. There are at least 30 different opines identified so far. Opines are utilized by tumor-colonizing bacteria as a source of carbon, nitrogen, and energy. In Agrobacterium tumefaciens,  OccR protein activates the occQ operon of the Ti plasmid in response to octopine. This operon encodes proteins required for the uptake and catabolism of octopine, an arginine derivative. The occ operon also encodes the TraR protein, which is a quorum-sensing transcriptional regulator of the Ti plasmid tra regulon.  This substrate-binding domain shows significant h
Probab=27.87  E-value=45  Score=20.34  Aligned_cols=26  Identities=12%  Similarity=0.282  Sum_probs=20.5

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++...+.+|.+.+|++.+.++..
T Consensus        11 ~~~~l~~~l~~~~~~~P~i~l~~~~~   36 (196)
T cd08457          11 ANGFLPRFLAAFLRLRPNLHLSLMGL   36 (196)
T ss_pred             hccccHHHHHHHHHHCCCeEEEEEec
Confidence            34566778888999999999988764


No 132
>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain. Citramalate synthase (CMS) catalyzes the conversion of pyruvate and acetyl-CoA to (R)-citramalate in the first dedicated step of the citramalate pathway.  Citramalate is only found in Leptospira interrogans and a few other microorganisms.  This family belongs to the DRE-TIM metallolyase superfamily.  DRE-TIM metallolyases include 2-isopropylmalate synthase (IPMS), alpha-isopropylmalate synthase (LeuA), 3-hydroxy-3-methylglutaryl-CoA lyase, homocitrate synthase, citramalate synthase, 4-hydroxy-2-oxovalerate aldolase, re-citrate synthase, transcarboxylase 5S, pyruvate carboxylase, AksA, and FrbC.  These members all share a conserved  triose-phosphate isomerase (TIM) barrel domain consisting of a core beta(8)-alpha(8) motif with the eight parallel beta strands forming an enclosed barrel surrounded by eight alpha helices.  The domain has a catalytic center con
Probab=27.78  E-value=1.1e+02  Score=21.94  Aligned_cols=35  Identities=17%  Similarity=0.080  Sum_probs=27.7

Q ss_pred             EEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEE
Q psy15303         13 RIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVR   49 (72)
Q Consensus        13 ~~~yC~~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v~   49 (72)
                      +|.+||+.|....-+  +.+.+..+++..|++++.+.
T Consensus       163 ~i~l~DT~G~~~P~~--v~~l~~~l~~~~~~~~i~~H  197 (280)
T cd07945         163 RIMLPDTLGILSPFE--TYTYISDMVKRYPNLHFDFH  197 (280)
T ss_pred             EEEecCCCCCCCHHH--HHHHHHHHHhhCCCCeEEEE
Confidence            688999999888776  66777788888898887663


No 133
>KOG3239|consensus
Probab=27.31  E-value=32  Score=24.24  Aligned_cols=26  Identities=19%  Similarity=0.391  Sum_probs=21.7

Q ss_pred             EEEEecCCCCCCHHHHHHHHhCHHHH
Q psy15303         12 LRIHLCQKGGSSSGVRDFLAQHYVPL   37 (72)
Q Consensus        12 L~~~yC~~~~sS~GvR~Fl~~~l~~~   37 (72)
                      |-..||+.+|.-+--|.||..|.|++
T Consensus        20 lP~EYCEf~~~~~kCk~WL~~n~pdl   45 (193)
T KOG3239|consen   20 LPPEYCEFSGDLKKCKEWLEENHPDL   45 (193)
T ss_pred             CCHHHHHccccHHHHHHHHHhcChhH
Confidence            34568999999999999999887765


No 134
>COG4097 Predicted ferric reductase [Inorganic ion transport and metabolism]
Probab=27.08  E-value=64  Score=25.41  Aligned_cols=44  Identities=16%  Similarity=0.190  Sum_probs=30.4

Q ss_pred             eEEEEEecCCCCCCHHHHHHH-HhCHHHHHHhCCCCeEEEEEcCCCCCEEE
Q psy15303         10 KELRIHLCQKGGSSSGVRDFL-AQHYVPLKQANPKFPILVRECSGVTPVVW   59 (72)
Q Consensus        10 k~L~~~yC~~~~sS~GvR~Fl-~~~l~~~k~~NP~v~i~v~~~~g~~P~l~   59 (72)
                      +-+.+.||-.+.     .+=+ .+.+.+++++||++.+.+ -.++++|++-
T Consensus       344 ~~V~L~Y~~~n~-----e~~~y~~eLr~~~qkl~~~~lHi-iDSs~~g~l~  388 (438)
T COG4097         344 PPVHLFYCSRNW-----EEALYAEELRALAQKLPNVVLHI-IDSSKDGYLD  388 (438)
T ss_pred             CceEEEEEecCC-----chhHHHHHHHHHHhcCCCeEEEE-ecCCCCCccC
Confidence            347889985543     3333 457788999999999999 4444566654


No 135
>PF11247 DUF2675:  Protein of unknown function (DUF2675) ;  InterPro: IPR022611  Members in this family of proteins include Bacteriophage T7 gene 5.5; they have no known function. 
Probab=26.88  E-value=47  Score=21.08  Aligned_cols=15  Identities=13%  Similarity=0.366  Sum_probs=13.4

Q ss_pred             HHHHHHHHhCHHHHH
Q psy15303         24 SGVRDFLAQHYVPLK   38 (72)
Q Consensus        24 ~GvR~Fl~~~l~~~k   38 (72)
                      .|+|+||++.+++..
T Consensus        68 ~g~R~~IKe~~~E~s   82 (98)
T PF11247_consen   68 QGIREAIKEMLSEYS   82 (98)
T ss_pred             HHHHHHHHHHHHHhc
Confidence            699999999998887


No 136
>PRK09375 quinolinate synthetase; Provisional
Probab=26.87  E-value=93  Score=23.31  Aligned_cols=33  Identities=24%  Similarity=0.231  Sum_probs=26.5

Q ss_pred             ecCCCCCCHHHHHHHHhC-------------HHHHHHhCCCCeEEE
Q psy15303         16 LCQKGGSSSGVRDFLAQH-------------YVPLKQANPKFPILV   48 (72)
Q Consensus        16 yC~~~~sS~GvR~Fl~~~-------------l~~~k~~NP~v~i~v   48 (72)
                      .+|..+||.|+-+|+++.             .-.++++||+-.|..
T Consensus       223 ~AD~vgSTs~~i~~v~~~~~~~~iigTE~~L~~~l~~~~P~K~fi~  268 (319)
T PRK09375        223 LADFVGSTSQIIKAAKASPAKKFIVGTEIGIVHRLQKANPDKEFIP  268 (319)
T ss_pred             hcCEEecHHHHHHHHHhCCCCeEEEEccHHHHHHHHHHCCCCEEEE
Confidence            478899999999999643             346788899988875


No 137
>PLN02659 Probable galacturonosyltransferase
Probab=26.87  E-value=52  Score=26.53  Aligned_cols=25  Identities=24%  Similarity=0.573  Sum_probs=21.7

Q ss_pred             CccccccCceEEEEEecCCCCCCHHHHHHHH
Q psy15303          1 MATRFGSKLKELRIHLCQKGGSSSGVRDFLA   31 (72)
Q Consensus         1 ~~~~f~~qLk~L~~~yC~~~~sS~GvR~Fl~   31 (72)
                      |-.++++.+|.|+++      +|.|.+||++
T Consensus         1 mq~~~sp~~r~~t~~------~~~~~~~~~~   25 (534)
T PLN02659          1 MQLHISPSLRHVTVL------PGKGVREFIK   25 (534)
T ss_pred             CceeecCccceEEEc------cCccHHHHHH
Confidence            667899999999997      4799999986


No 138
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins such as ribonucleotide reductase. It contains a redox active CXXC motif in a TRX fold and uses a similar dithiol mechanism employed by TRXs for intramolecular disulfide bond reduction of protein substrates. Unlike TRX, GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. The flow of reducing equivalents in the GRX system goes from NADPH - GSH reductase - GSH - GRX - protein substrates. By altering the redox state of target proteins, GRX is involved in many cellular functions including DNA synthesis, signal transduction and the defense against oxidative stress. Different classes are known including human GRX1 and GRX2, as well as E. coli GRX1 and GRX3, which 
Probab=26.54  E-value=67  Score=16.54  Aligned_cols=21  Identities=5%  Similarity=0.012  Sum_probs=16.5

Q ss_pred             EEEEecCCCCCCHHHHHHHHh
Q psy15303         12 LRIHLCQKGGSSSGVRDFLAQ   32 (72)
Q Consensus        12 L~~~yC~~~~sS~GvR~Fl~~   32 (72)
                      +++..-++.+.++.++.++++
T Consensus         2 v~ly~~~~Cp~C~~~~~~L~~   22 (72)
T cd02066           2 VVVFSKSTCPYCKRAKRLLES   22 (72)
T ss_pred             EEEEECCCCHHHHHHHHHHHH
Confidence            566667888889999999864


No 139
>PF10262 Rdx:  Rdx family;  InterPro: IPR011893 This entry represents the Rdx family of selenoproteins, which includes mammalian selenoproteins SelW, SelV, SelT and SelH, bacterial SelW-like proteins and cysteine-containing proteins of unknown function in all three domains of life. Mammalian Rdx12 and its fish selenoprotein orthologues are also members of this family []. These proteins possess a thioredoxin-like fold and a conserved CXXC or CxxU (U is selenocysteine) motif near the N terminus, suggesting a redox function. Rdx proteins can use catalytic cysteine (or selenocysteine) to form transient mixed disulphides with substrate proteins. Selenium (Se) plays an essential role in cell survival and most of the effects of Se are probably mediated by selenoproteins.   Selenoprotein W (SelW) plays an important role in protection of neurons from oxidative stress during neuronal development [], [].   Selenoprotein T (SelT) is conserved from plants to humans. SelT is localized to the endoplasmic reticulum through a hydrophobic domain. The protein binds to UDP-glucose:glycoprotein glucosyltransferase (UGTR), the endoplasmic reticulum (ER)-resident protein, which is known to be involved in the quality control of protein folding [, ]. The function of SelT is unknown, although it may have a role in PACAP signaling during PC12 cell differentiation [, ].  Selenoprotein H (SelH) protects neurons against UVB-induced damage by inhibiting apoptotic cell death pathways, by preventing mitochondrial depolarization, and by promoting cell survival pathways [].; GO: 0008430 selenium binding, 0045454 cell redox homeostasis; PDB: 2OJL_B 2FA8_A 2P0G_C 2NPB_A 3DEX_C 2OKA_A 2OBK_G.
Probab=26.51  E-value=69  Score=18.37  Aligned_cols=36  Identities=17%  Similarity=0.269  Sum_probs=23.3

Q ss_pred             EEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCC--CeEEEEE
Q psy15303         11 ELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPK--FPILVRE   50 (72)
Q Consensus        11 ~L~~~yC~~~~sS~GvR~Fl~~~l~~~k~~NP~--v~i~v~~   50 (72)
                      +|+|.||...+-..-.-++-    ..+....|+  ..+...+
T Consensus         2 ~V~IeYC~~C~~~~~a~~l~----~~l~~~fp~~~~~v~~~~   39 (76)
T PF10262_consen    2 KVTIEYCTSCGYRPRALELA----QELLQTFPDRIAEVELSP   39 (76)
T ss_dssp             EEEEEEETTTTCHHHHHHHH----HHHHHHSTTTCSEEEEEE
T ss_pred             EEEEEECCCCCCHHHHHHHH----HHHHHHCCCcceEEEEEe
Confidence            68999999987555433322    245556677  6666655


No 140
>PF12876 Cellulase-like:  Sugar-binding cellulase-like;  InterPro: IPR024778 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. This entry represents a family of putative cellulase enzymes.; PDB: 3GYC_B.
Probab=26.46  E-value=60  Score=19.01  Aligned_cols=27  Identities=11%  Similarity=0.361  Sum_probs=20.4

Q ss_pred             CHHHHHHHHhCHHHHHHhCCCCeEEEE
Q psy15303         23 SSGVRDFLAQHYVPLKQANPKFPILVR   49 (72)
Q Consensus        23 S~GvR~Fl~~~l~~~k~~NP~v~i~v~   49 (72)
                      ..-+++++++-...+++.+|+.++.+-
T Consensus        37 ~~~~~~~l~~~~~~iR~~dP~~pvt~g   63 (88)
T PF12876_consen   37 AEAYAEWLKEAFRWIRAVDPSQPVTSG   63 (88)
T ss_dssp             SHHHHHHHHHHHHHHHTT-TTS-EE--
T ss_pred             HHHHHHHHHHHHHHHHHhCCCCcEEee
Confidence            466889999999999999999998764


No 141
>PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional
Probab=26.19  E-value=64  Score=22.57  Aligned_cols=25  Identities=8%  Similarity=-0.013  Sum_probs=20.9

Q ss_pred             CCHHHHHHHHhCHHHHHHhCCCCeE
Q psy15303         22 SSSGVRDFLAQHYVPLKQANPKFPI   46 (72)
Q Consensus        22 sS~GvR~Fl~~~l~~~k~~NP~v~i   46 (72)
                      .....|+.+++-+|.+.+.||++..
T Consensus       206 ~~~~~R~~ir~~l~~L~~~~P~~~~  230 (258)
T PRK10696        206 QENLQRQVVKEMLRDWEKEYPGRIE  230 (258)
T ss_pred             CchhHHHHHHHHHHHHHHHCccHHH
Confidence            4456899999999999999998754


No 142
>PF10607 CLTH:  CTLH/CRA C-terminal to LisH motif domain;  InterPro: IPR019589 This entry represents the CRA (or CT11-RanBPM) domain, which is a protein-protein interaction domain present in crown eukaryotes (plants, animals, fungi) and which is found in Ran-binding proteins such as Ran-binding protein 9 (RanBP9 or RanBPM) and RanBP10. RanBPM is a scaffolding protein important in regulating cellular function in both the immune system and the nervous system, and may act as an adapter protein to couple membrane receptors to intracellular signaling pathways. This domain is at the C terminus of the proteins and is the binding domain for the CRA motif, which is comprised of approximately 100 amino acids at the C-terminal of RanBPM. It was found to be important for the interaction of RanBPM with fragile X mental retardation protein (FMRP), but its functional significance has yet to be determined []. 
Probab=25.97  E-value=48  Score=20.68  Aligned_cols=29  Identities=17%  Similarity=0.356  Sum_probs=23.8

Q ss_pred             CCCHHHHHHHHhCHHHHHHhCCCCeEEEE
Q psy15303         21 GSSSGVRDFLAQHYVPLKQANPKFPILVR   49 (72)
Q Consensus        21 ~sS~GvR~Fl~~~l~~~k~~NP~v~i~v~   49 (72)
                      |.-..+-++++++.|.+.+.|+++.|..+
T Consensus        15 g~i~~Ai~w~~~~~~~l~~~~~~L~f~L~   43 (145)
T PF10607_consen   15 GDIDPAIEWLNENFPELLKRNSSLEFELR   43 (145)
T ss_pred             CCHHHHHHHHHHcCHHHHhcCCchhHHHH
Confidence            44567889999999999999999987653


No 143
>PF09822 ABC_transp_aux:  ABC-type uncharacterized transport system;  InterPro: IPR019196  This domain is found in various eukaryotic and prokaryotic intra-flagellar transport proteins involved in gliding motility, as well as in several hypothetical proteins. 
Probab=25.77  E-value=1.9e+02  Score=20.04  Aligned_cols=39  Identities=10%  Similarity=0.123  Sum_probs=29.0

Q ss_pred             EEEEecCCCCC-CHHHHHHHHhCHHHHHHhCC-CCeEEEEE
Q psy15303         12 LRIHLCQKGGS-SSGVRDFLAQHYVPLKQANP-KFPILVRE   50 (72)
Q Consensus        12 L~~~yC~~~~s-S~GvR~Fl~~~l~~~k~~NP-~v~i~v~~   50 (72)
                      |++.+...-+. -...+.-+++-+.++++.|| ++.+....
T Consensus        29 i~~~~s~~l~~~~~~~~~~v~~lL~~y~~~s~g~i~v~~iD   69 (271)
T PF09822_consen   29 ITVYFSRELPPELSPLRKQVRDLLDEYARYSPGKIKVEFID   69 (271)
T ss_pred             EEEEECCCcchhhhHHHHHHHHHHHHHHHhCCCceEEEEEC
Confidence            66666653333 56677778888999999999 98887754


No 144
>cd06544 GH18_narbonin Narbonin is a plant 2S protein from the globulin fraction of narbon bean (Vicia narbonensis L.) cotyledons with unknown function.  Narbonin has a glycosyl hydrolase family 18 (GH18) domain without the conserved catalytic residues and with no known enzymatic activity.  Narbonin amounts to up to 3% of the total seed globulins of mature seeds and was thought to be a storage protein but was found to degrade too slowly during germination.  This family also includes the VfNOD32 nodulin from Vicia faba.
Probab=25.50  E-value=57  Score=23.20  Aligned_cols=20  Identities=10%  Similarity=0.273  Sum_probs=16.9

Q ss_pred             hCHHHHHHhCCCCeEEEEEc
Q psy15303         32 QHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        32 ~~l~~~k~~NP~v~i~v~~~   51 (72)
                      +.+.++|++||++++++.-.
T Consensus        59 ~~~~~lK~~~p~lKvllSiG   78 (253)
T cd06544          59 EAVKSIKAQHPNVKVVISIG   78 (253)
T ss_pred             HHHHHHHHhCCCcEEEEEeC
Confidence            46789999999999999653


No 145
>PRK13995 potassium-transporting ATPase subunit C; Provisional
Probab=25.06  E-value=1.1e+02  Score=21.79  Aligned_cols=44  Identities=18%  Similarity=0.302  Sum_probs=33.6

Q ss_pred             cCCCCCCHHHHHHHHhCHHHHHHhCCC-----CeE--EEEEcCCCCCEEEE
Q psy15303         17 CQKGGSSSGVRDFLAQHYVPLKQANPK-----FPI--LVRECSGVTPVVWA   60 (72)
Q Consensus        17 C~~~~sS~GvR~Fl~~~l~~~k~~NP~-----v~i--~v~~~~g~~P~l~a   60 (72)
                      ++-+++|.-+.+-+++....+++.||.     ||+  ++....|-+|.|.-
T Consensus        95 SNlgpsnp~L~~~v~~r~~~~~~~~p~~~~~~vP~DlvTaSgSGLDPhISp  145 (203)
T PRK13995         95 QNYAPTNPELHDRVQKDIDKFLKTNPTVKKEDIPTDLLTASGSGLDPHISP  145 (203)
T ss_pred             cCCCCCCHHHHHHHHHHHHHHHHhCCCCCCCCCCHHHHhccccCCCCCCCH
Confidence            466788999999999999999999985     443  33555677887653


No 146
>PF07735 FBA_2:  F-box associated;  InterPro: IPR012885 This domain is found is found towards the C terminus of proteins that contain an F-box, IPR001810 from INTERPRO, suggesting that they are effectors linked with ubiquitination. 
Probab=25.01  E-value=1.2e+02  Score=16.55  Aligned_cols=36  Identities=17%  Similarity=0.304  Sum_probs=25.4

Q ss_pred             cCceEEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEE
Q psy15303          7 SKLKELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPIL   47 (72)
Q Consensus         7 ~qLk~L~~~yC~~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~   47 (72)
                      -.++.|.+..+.  =+++.+..||.+.+.-   .||.++..
T Consensus        32 ~nc~~i~l~~~~--~t~~dln~Flk~W~~G---~~~~Le~l   67 (70)
T PF07735_consen   32 MNCKKIELWNSK--FTNEDLNKFLKHWING---SNPRLEYL   67 (70)
T ss_pred             cCCCEEEEECCC--CCHHHHHHHHHHHHcC---CCcCCcEE
Confidence            356777776544  4689999999887654   77777643


No 147
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile. In vitro, it displays protein disulfide reductase activity that is dependent on TRX reductase, not glutathione (GSH). It is part of the NrdHIEF operon, where NrdEF codes for class Ib ribonucleotide reductase (RNR-Ib), an efficient enzyme at low oxygen levels. Under these conditions when GSH is mostly conjugated to spermidine, NrdH can still function and act as a hydrogen donor for RNR-Ib. It has been suggested that the NrdHEF system may be the oldest RNR reducing system, capable of functioning in a microaerophilic environment, where GSH was not yet available. NrdH from Corynebacterium ammoniagenes can form domain-swapped dimers, although it is unknown if this happens in vivo. Domain-swapped dimerization, which results in the blocking of the TRX reductase binding site, cou
Probab=24.83  E-value=82  Score=16.36  Aligned_cols=21  Identities=10%  Similarity=0.140  Sum_probs=17.0

Q ss_pred             EEEEecCCCCCCHHHHHHHHh
Q psy15303         12 LRIHLCQKGGSSSGVRDFLAQ   32 (72)
Q Consensus        12 L~~~yC~~~~sS~GvR~Fl~~   32 (72)
                      +++....+++.+.-++.++++
T Consensus         2 v~l~~~~~c~~c~~~~~~l~~   22 (73)
T cd02976           2 VTVYTKPDCPYCKATKRFLDE   22 (73)
T ss_pred             EEEEeCCCChhHHHHHHHHHH
Confidence            567778888889999888864


No 148
>PRK11139 DNA-binding transcriptional activator GcvA; Provisional
Probab=24.78  E-value=86  Score=21.50  Aligned_cols=25  Identities=12%  Similarity=0.373  Sum_probs=21.8

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         27 RDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        27 R~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ..++...+.+|.+.+|++.|.+...
T Consensus       106 ~~~l~~~l~~f~~~~p~i~i~l~~~  130 (297)
T PRK11139        106 IQWLVPRLSSFNEAHPDIDVRLKAV  130 (297)
T ss_pred             HHHHHHHHHHHHHHCCCceEEEEeC
Confidence            5788889999999999999999754


No 149
>COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism]
Probab=24.43  E-value=71  Score=20.25  Aligned_cols=23  Identities=13%  Similarity=0.124  Sum_probs=17.9

Q ss_pred             EEEEEecCCCCCCHHHHHHHHhC
Q psy15303         11 ELRIHLCQKGGSSSGVRDFLAQH   33 (72)
Q Consensus        11 ~L~~~yC~~~~sS~GvR~Fl~~~   33 (72)
                      .++|.....+.+|+-+++|++++
T Consensus         2 ~itiy~~p~C~t~rka~~~L~~~   24 (117)
T COG1393           2 MITIYGNPNCSTCRKALAWLEEH   24 (117)
T ss_pred             eEEEEeCCCChHHHHHHHHHHHc
Confidence            36777888888888888888754


No 150
>PF01547 SBP_bac_1:  Bacterial extracellular solute-binding protein;  InterPro: IPR006059 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane. The protein components of these traffic systems include one or two transmembrane protein components, one or two membrane-associated ATP-binding proteins and a high affinity periplasmic solute-binding protein. In Gram-positive bacteria, which are surrounded by a single membrane and therefore have no periplasmic region, the equivalent proteins are bound to the membrane via an N-terminal lipid anchor. These homologue proteins do not play an integral role in the transport process per se, but probably serve as receptors to trigger or initiate translocation of the solute through the membrane by binding to external sites of the integral membrane proteins of the efflux system. In addition at least some solute-binding proteins function in the initiation of sensory transduction pathways. On the basis of sequence similarities, the vast majority of these solute-binding proteins can be grouped into eight family clusters [], which generally correlate with the nature of the solute bound. Family 1 includes the maltose/maltodextrin-binding proteins of Enterobacteriaceae (gene malE) [] and Streptococcus pneumoniae malX; multiple oligosaccharide binding protein of Streptococcus mutans (gene msmE); Escherichia coli glycerol-3-phosphate-binding protein; Serratia marcescens iron-binding protein (gene sfuA) and the homologous proteins (gene fbp) from Haemophilus influenzae and Neisseria; and the E. coli thiamine-binding protein (gene tbpA).; GO: 0005215 transporter activity, 0006810 transport; PDB: 3CFZ_A 2THI_A 3THI_A 4THI_A 1O7T_C 1D9Y_A 1URG_A 1URS_A 1URD_B 3OMB_A ....
Probab=24.14  E-value=67  Score=21.35  Aligned_cols=23  Identities=9%  Similarity=0.144  Sum_probs=18.7

Q ss_pred             HHHhCH-HHHHHhCCCCeEEEEEc
Q psy15303         29 FLAQHY-VPLKQANPKFPILVREC   51 (72)
Q Consensus        29 Fl~~~l-~~~k~~NP~v~i~v~~~   51 (72)
                      .+++.+ .+|.+.||++.|.+...
T Consensus         9 ~~~~~~~~~f~k~~~~i~V~~~~~   32 (315)
T PF01547_consen    9 ALQELIIEEFEKEHPGIKVEIEFI   32 (315)
T ss_dssp             HHHHHHHHHHHHHHTTEEEEEEEE
T ss_pred             HHHHHHHHHHHHHCCCcEEEEEEC
Confidence            666666 78999999999998664


No 151
>PF13516 LRR_6:  Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A ....
Probab=24.05  E-value=19  Score=16.09  Aligned_cols=20  Identities=20%  Similarity=0.282  Sum_probs=12.2

Q ss_pred             cCceEEEEEecCCCCCCHHHHH
Q psy15303          7 SKLKELRIHLCQKGGSSSGVRD   28 (72)
Q Consensus         7 ~qLk~L~~~yC~~~~sS~GvR~   28 (72)
                      ++|+.|.|+.|+-  +..|++.
T Consensus         2 ~~L~~L~l~~n~i--~~~g~~~   21 (24)
T PF13516_consen    2 PNLETLDLSNNQI--TDEGASA   21 (24)
T ss_dssp             TT-SEEE-TSSBE--HHHHHHH
T ss_pred             CCCCEEEccCCcC--CHHHHHH
Confidence            4788899888874  3556554


No 152
>TIGR00269 conserved hypothetical protein TIGR00269.
Probab=23.93  E-value=55  Score=20.08  Aligned_cols=24  Identities=25%  Similarity=0.290  Sum_probs=20.1

Q ss_pred             CCHHHHHHHHhCHHHHHHhCCCCe
Q psy15303         22 SSSGVRDFLAQHYVPLKQANPKFP   45 (72)
Q Consensus        22 sS~GvR~Fl~~~l~~~k~~NP~v~   45 (72)
                      +....|..+++.+.++.+.||++.
T Consensus        34 ~~~a~R~~~k~~L~~LE~~~P~~k   57 (104)
T TIGR00269        34 SSLSVRARIRDFLYDLENKKPGVK   57 (104)
T ss_pred             CCCCchHHHHHHHHHHHHHCcChH
Confidence            345789999999999999999875


No 153
>cd01388 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins. These proteins contain a single HMG box, and bind the minor groove of DNA in a highly sequence-specific manner. Members include SRY and its homologs in insects and vertebrates, and transcription factor-like proteins, TCF-1, -3, -4, and LEF-1. They appear to bind the minor groove of the A/T C A A A G/C-motif.
Probab=23.73  E-value=54  Score=18.40  Aligned_cols=18  Identities=22%  Similarity=0.119  Sum_probs=14.3

Q ss_pred             HHHHhCHHHHHHhCCCCe
Q psy15303         28 DFLAQHYVPLKQANPKFP   45 (72)
Q Consensus        28 ~Fl~~~l~~~k~~NP~v~   45 (72)
                      -|+...-++++++||++.
T Consensus        11 ~F~~~~r~~~~~~~p~~~   28 (72)
T cd01388          11 LFSKRHRRKVLQEYPLKE   28 (72)
T ss_pred             HHHHHHHHHHHHHCCCCC
Confidence            356778889999999865


No 154
>PRK10837 putative DNA-binding transcriptional regulator; Provisional
Probab=23.71  E-value=1.1e+02  Score=20.64  Aligned_cols=26  Identities=12%  Similarity=0.199  Sum_probs=21.5

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++...+..|++++|++.|.+...
T Consensus       100 ~~~~~~~~l~~~~~~~P~i~i~v~~~  125 (290)
T PRK10837        100 GNYILPAMIARYRRDYPQLPLELSVG  125 (290)
T ss_pred             HhhhhHHHHHHHHHHCCCceEEEEEC
Confidence            34667888899999999999999754


No 155
>PRK09791 putative DNA-binding transcriptional regulator; Provisional
Probab=23.65  E-value=1.1e+02  Score=21.00  Aligned_cols=37  Identities=14%  Similarity=0.244  Sum_probs=27.3

Q ss_pred             eEEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         10 KELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        10 k~L~~~yC~~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ..|+|-..+.     -...++...+..|.+++|++.|.++..
T Consensus        95 g~l~I~~~~~-----~~~~~l~~~l~~~~~~~p~i~~~~~~~  131 (302)
T PRK09791         95 GQINIGMGAS-----IARSLMPAVISRFHQQHPQVKVRIMEG  131 (302)
T ss_pred             eEEEEEechH-----HHHhhhHHHHHHHHHHCCCeEEEEEeC
Confidence            4555555332     245677889999999999999999864


No 156
>PRK11151 DNA-binding transcriptional regulator OxyR; Provisional
Probab=23.34  E-value=1.5e+02  Score=20.40  Aligned_cols=26  Identities=23%  Similarity=0.252  Sum_probs=22.1

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++..-+.+|.+.+|++.|.+...
T Consensus       102 ~~~~~~~~l~~~~~~~P~v~i~~~~~  127 (305)
T PRK11151        102 GPYLLPHIIPMLHQTFPKLEMYLHEA  127 (305)
T ss_pred             HHHHHHHHHHHHHHHCCCcEEEEEeC
Confidence            45677888899999999999999864


No 157
>PRK10324 translation inhibitor protein RaiA; Provisional
Probab=22.72  E-value=2e+02  Score=17.87  Aligned_cols=32  Identities=13%  Similarity=0.255  Sum_probs=25.1

Q ss_pred             EEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCC
Q psy15303         12 LRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKF   44 (72)
Q Consensus        12 L~~~yC~~~~sS~GvR~Fl~~~l~~~k~~NP~v   44 (72)
                      |.|.+ .+-.-|..+|+++++.+..+.+-.|++
T Consensus         3 I~Itg-r~v~~tdalr~~ie~Kl~kL~k~~~~i   34 (113)
T PRK10324          3 MNITS-KQMEITPAIRQHVADRLAKLEKWQTHL   34 (113)
T ss_pred             EEEEE-EcCcCCHHHHHHHHHHHHHHHHhcCCC
Confidence            33443 566678999999999999999988765


No 158
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions.  GRX is a glutathione (GSH) dependent reductase containing a redox active CXXC motif in a TRX fold. It has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. By altering the redox state of target proteins, GRX is involved in many cellular functions.
Probab=22.69  E-value=1.2e+02  Score=16.56  Aligned_cols=22  Identities=23%  Similarity=0.196  Sum_probs=18.3

Q ss_pred             EEEEEecCCCCCCHHHHHHHHh
Q psy15303         11 ELRIHLCQKGGSSSGVRDFLAQ   32 (72)
Q Consensus        11 ~L~~~yC~~~~sS~GvR~Fl~~   32 (72)
                      ++++..-++.+.++-++.++++
T Consensus         2 ~v~ly~~~~C~~C~ka~~~L~~   23 (73)
T cd03027           2 RVTIYSRLGCEDCTAVRLFLRE   23 (73)
T ss_pred             EEEEEecCCChhHHHHHHHHHH
Confidence            5677777888999999999974


No 159
>PF01624 MutS_I:  MutS domain I C-terminus.;  InterPro: IPR007695 Mismatch repair contributes to the overall fidelity of DNA replication and is essential for combating the adverse effects of damage to the genome. It involves the correction of mismatched base pairs that have been missed by the proofreading element of the DNA polymerase complex. The post-replicative Mismatch Repair System (MMRS) of Escherichia coli involves MutS (Mutator S), MutL and MutH proteins, and acts to correct point mutations or small insertion/deletion loops produced during DNA replication []. MutS and MutL are involved in preventing recombination between partially homologous DNA sequences. The assembly of MMRS is initiated by MutS, which recognises and binds to mispaired nucleotides and allows further action of MutL and MutH to eliminate a portion of newly synthesized DNA strand containing the mispaired base []. MutS can also collaborate with methyltransferases in the repair of O(6)-methylguanine damage, which would otherwise pair with thymine during replication to create an O(6)mG:T mismatch []. MutS exists as a dimer, where the two monomers have different conformations and form a heterodimer at the structural level []. Only one monomer recognises the mismatch specifically and has ADP bound. Non-specific major groove DNA-binding domains from both monomers embrace the DNA in a clamp-like structure. Mismatch binding induces ATP uptake and a conformational change in the MutS protein, resulting in a clamp that translocates on DNA.  MutS is a modular protein with a complex structure [], and is composed of:   N-terminal mismatch-recognition domain, which is similar in structure to tRNA endonuclease. Connector domain, which is similar in structure to Holliday junction resolvase ruvC. Core domain, which is composed of two separate subdomains that join together to form a helical bundle; from within the core domain, two helices act as levers that extend towards (but do not touch) the DNA. Clamp domain, which is inserted between the two subdomains of the core domain at the top of the lever helices; the clamp domain has a beta-sheet structure. ATPase domain (connected to the core domain), which has a classical Walker A motif. HTH (helix-turn-helix) domain, which is involved in dimer contacts.   The MutS family of proteins is named after the Salmonella typhimurium MutS protein involved in mismatch repair. Homologues of MutS have been found in many species including eukaryotes (MSH 1, 2, 3, 4, 5, and 6 proteins), archaea and bacteria, and together these proteins have been grouped into the MutS family. Although many of these proteins have similar activities to the E. coli MutS, there is significant diversity of function among the MutS family members. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein [].This diversity is even seen within species, where many species encode multiple MutS homologues with distinct functions []. Inter-species homologues may have arisen through frequent ancient horizontal gene transfer of MutS (and MutL) from bacteria to archaea and eukaryotes via endosymbiotic ancestors of mitochondria and chloroplasts [].  This entry represents the N-terminal domain of proteins in the MutS family of DNA mismatch repair proteins, as well as closely related proteins. The N-terminal domain of MutS is responsible for mismatch recognition and forms a 6-stranded mixed beta-sheet surrounded by three alpha-helices, which is similar to the structure of tRNA endonuclease. Yeast MSH3 [], bacterial proteins involved in DNA mismatch repair, and the predicted protein product of the Rep-3 gene of mouse share extensive sequence similarity. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein.; GO: 0005524 ATP binding, 0030983 mismatched DNA binding, 0006298 mismatch repair; PDB: 1FW6_A 1EWQ_A 1EWR_B 1NNE_B 3THY_B 3THZ_B 3THW_B 3THX_B 2WTU_A 1OH7_A ....
Probab=22.58  E-value=69  Score=19.57  Aligned_cols=21  Identities=29%  Similarity=0.379  Sum_probs=17.3

Q ss_pred             HhCHHHHHHhCCCCeEEEEEc
Q psy15303         31 AQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        31 ~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      .+.|.++|+++|+.-++++..
T Consensus         4 ~~~y~~lk~k~~d~i~lf~~G   24 (113)
T PF01624_consen    4 EQQYWELKEKYPDTIVLFQVG   24 (113)
T ss_dssp             HHHHHHHHCTSTTSEEEEEET
T ss_pred             HHHHHHHHhhCCCeEEEEEcC
Confidence            456889999999998888754


No 160
>TIGR02174 CXXU_selWTH selT/selW/selH selenoprotein domain. This model represents a domain found in both bacteria and animals, including animal proteins SelT, SelW, and SelH, all of which are selenoproteins. In a CXXC motif near the N-terminus of the domain, selenocysteine may replace the second Cys. Proteins with this domain may include an insert of about 70 amino acids. This model is broader than the current SelW model pfam05169 in Pfam.
Probab=22.51  E-value=1.6e+02  Score=16.74  Aligned_cols=38  Identities=18%  Similarity=0.250  Sum_probs=22.9

Q ss_pred             EEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEEcCC
Q psy15303         12 LRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRECSG   53 (72)
Q Consensus        12 L~~~yC~~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v~~~~g   53 (72)
                      ++|.||...+-. +--..+.   .++....|+.++.+...++
T Consensus         1 V~IeyC~~C~y~-~Ra~~l~---q~L~~~Fp~~~v~~~~~~~   38 (72)
T TIGR02174         1 VEIEYCGSCGYK-PRAAWLK---QELLEEFPDLEIEGENTPP   38 (72)
T ss_pred             CEEEECCCCCCh-HHHHHHH---HHHHHHCCCCeeEEeeecC
Confidence            578999988833 3333332   3556677887666655443


No 161
>cd00552 RaiA RaiA ("ribosome-associated inhibitor A", also known as Protein Y (PY), YfiA, and SpotY,  is a stress-response protein that binds the ribosomal subunit interface and arrests translation by interfering with aminoacyl-tRNA binding to the ribosomal A site.  RaiA is also thought to counteract miscoding at the A site thus reducing translation errors. The RaiA fold structurally resembles the double-stranded RNA-binding domain (dsRBD).
Probab=22.51  E-value=1e+02  Score=17.70  Aligned_cols=27  Identities=7%  Similarity=0.234  Sum_probs=21.9

Q ss_pred             CCCCCCHHHHHHHHhCHHHHHHhCCCC
Q psy15303         18 QKGGSSSGVRDFLAQHYVPLKQANPKF   44 (72)
Q Consensus        18 ~~~~sS~GvR~Fl~~~l~~~k~~NP~v   44 (72)
                      .+-..|..+|+|+++.+..+.+-.+++
T Consensus         7 r~~~~t~al~~~i~~k~~kl~r~~~~i   33 (93)
T cd00552           7 RNIEVTDALREYVEEKLEKLEKYFDRI   33 (93)
T ss_pred             EcccCCHHHHHHHHHHHHHHHHhcCCC
Confidence            444568999999999999888887754


No 162
>PF13552 DUF4127:  Protein of unknown function (DUF4127)
Probab=22.47  E-value=74  Score=24.93  Aligned_cols=19  Identities=32%  Similarity=0.511  Sum_probs=16.7

Q ss_pred             hCHHHHHHhCCCCeEEEEE
Q psy15303         32 QHYVPLKQANPKFPILVRE   50 (72)
Q Consensus        32 ~~l~~~k~~NP~v~i~v~~   50 (72)
                      +.+-+++++||+++|++..
T Consensus        92 ~~l~~lk~~~p~~~iyaf~  110 (497)
T PF13552_consen   92 ERLRELKARNPNLPIYAFS  110 (497)
T ss_pred             HHHHHHHHHCCCCeEEEEE
Confidence            6788999999999999854


No 163
>PRK11716 DNA-binding transcriptional regulator IlvY; Provisional
Probab=22.44  E-value=1.3e+02  Score=19.76  Aligned_cols=25  Identities=12%  Similarity=0.121  Sum_probs=21.1

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         27 RDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        27 R~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ..++..-+..|.+++|++.+.+...
T Consensus        79 ~~~~~~~l~~~~~~~p~i~l~i~~~  103 (269)
T PRK11716         79 YSHLPPILDRFRAEHPLVEIKLTTG  103 (269)
T ss_pred             HHHHHHHHHHHHHHCCCeEEEEEEC
Confidence            4577888999999999999988753


No 164
>PRK10974 glycerol-3-phosphate transporter periplasmic binding protein; Provisional
Probab=22.40  E-value=1.2e+02  Score=22.24  Aligned_cols=25  Identities=8%  Similarity=0.121  Sum_probs=20.5

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEE
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVRE   50 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~   50 (72)
                      -.+.++....+|.++||++.|.+..
T Consensus        38 ~~~~~~~~~~~F~~~~p~i~V~~~~   62 (438)
T PRK10974         38 LGKEVDSLAQRFNASQPDYKIVPVY   62 (438)
T ss_pred             hHHHHHHHHHHHHHhCCCeEEEEee
Confidence            3467888999999999999987753


No 165
>PRK09508 leuO leucine transcriptional activator; Reviewed
Probab=22.26  E-value=1.4e+02  Score=20.76  Aligned_cols=26  Identities=15%  Similarity=0.300  Sum_probs=22.7

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++...+.+|++++|++.|.+...
T Consensus       123 ~~~~l~~~l~~f~~~~P~i~l~i~~~  148 (314)
T PRK09508        123 DIRLTSQIYNRIEQIAPNIHVVFKSS  148 (314)
T ss_pred             HHHHHHHHHHHHHHhCCCcEEEEEeC
Confidence            35688899999999999999999875


No 166
>PRK09801 transcriptional activator TtdR; Provisional
Probab=22.19  E-value=1.5e+02  Score=20.82  Aligned_cols=28  Identities=14%  Similarity=0.134  Sum_probs=22.9

Q ss_pred             HHHHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         24 SGVRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        24 ~GvR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      .-...|+...+.+|.+++|++.|.+...
T Consensus       105 ~~~~~~l~~~l~~f~~~~P~i~l~i~~~  132 (310)
T PRK09801        105 GFGRSHIAPAITELMRNYPELQVHFELF  132 (310)
T ss_pred             HHHHHHHHHHHHHHHHHCCCeEEEEEec
Confidence            3445688899999999999999998754


No 167
>TIGR01616 nitro_assoc nitrogenase-associated protein. This model describes a small family of uncharacterized proteins found so far in alpha and gamma proteobacteria and in Nostoc sp. PCC 7120, a cyanobacterium. The gene for this protein is associated with nitrogenase genes. This family shows sequence similarity to TIGR00014, a glutaredoxin-dependent arsenate reductase that converts arsentate to arsenite for disposal. This family is one of several included in Pfam model pfam03960.
Probab=22.18  E-value=2e+02  Score=18.33  Aligned_cols=23  Identities=4%  Similarity=-0.078  Sum_probs=18.6

Q ss_pred             EEEEEecCCCCCCHHHHHHHHhC
Q psy15303         11 ELRIHLCQKGGSSSGVRDFLAQH   33 (72)
Q Consensus        11 ~L~~~yC~~~~sS~GvR~Fl~~~   33 (72)
                      .++|..-.+..+|+-+++||+.+
T Consensus         2 ~i~iY~~p~Cst~RKA~~~L~~~   24 (126)
T TIGR01616         2 TIIFYEKPGCANNARQKAALKAS   24 (126)
T ss_pred             eEEEEeCCCCHHHHHHHHHHHHC
Confidence            46777778888999999999754


No 168
>PF09217 EcoRII-N:  Restriction endonuclease EcoRII, N-terminal;  InterPro: IPR023372 There are four classes of restriction endonucleases: types I, II,III and IV. All types of enzymes recognise specific short DNA sequences and carry out the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. They differ in their recognition sequence, subunit composition, cleavage position, and cofactor requirements [, ], as summarised below:   Type I enzymes (3.1.21.3 from EC) cleave at sites remote from recognition site; require both ATP and S-adenosyl-L-methionine to function; multifunctional protein with both restriction and methylase (2.1.1.72 from EC) activities. Type II enzymes (3.1.21.4 from EC) cleave within or at short specific distances from recognition site; most require magnesium; single function (restriction) enzymes independent of methylase. Type III enzymes (3.1.21.5 from EC) cleave at sites a short distance from recognition site; require ATP (but doesn't hydrolyse it); S-adenosyl-L-methionine stimulates reaction but is not required; exists as part of a complex with a modification methylase methylase (2.1.1.72 from EC). Type IV enzymes target methylated DNA.   Type II restriction endonucleases (3.1.21.4 from EC) are components of prokaryotic DNA restriction-modification mechanisms that protect the organism against invading foreign DNA. These site-specific deoxyribonucleases catalyse the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. Of the 3000 restriction endonucleases that have been characterised, most are homodimeric or tetrameric enzymes that cleave target DNA at sequence-specific sites close to the recognition site. For homodimeric enzymes, the recognition site is usually a palindromic sequence 4-8 bp in length. Most enzymes require magnesium ions as a cofactor for catalysis. Although they can vary in their mode of recognition, many restriction endonucleases share a similar structural core comprising four beta-strands and one alpha-helix, as well as a similar mechanism of cleavage, suggesting a common ancestral origin []. However, there is still considerable diversity amongst restriction endonucleases [, ]. The target site recognition process triggers large conformational changes of the enzyme and the target DNA, leading to the activation of the catalytic centres. Like other DNA binding proteins, restriction enzymes are capable of non-specific DNA binding as well, which is the prerequisite for efficient target site location by facilitated diffusion. Non-specific binding usually does not involve interactions with the bases but only with the DNA backbone [].  This entry represents the N-terminal effector-binding domain of the type II restriction endonuclease EcoRII, which has a DNA recognition fold, allowing for binding to 5'-CCWGG sequences. It assumes a structure composed of an eight-stranded beta-sheet with the strands in the order of b2, b5, b4, b3, b7, b6, b1 and b8. They are mostly antiparallel to each other except that b3 is parallel to b7. Alternatively, it may also be viewed as consisting of two mini beta-sheets of four antiparallel beta-strands, sheet I from beta-strands b2, b5, b4, b3 and sheet II from strands b7, b6, b1, b8, folded into an open mixed beta-barrel with a novel topology. Sheet I has a simple Greek key motif while sheet II does not [].  The domain represented by this entry is only found in bacterial proteins.; PDB: 3HQF_A 1NA6_A.
Probab=22.06  E-value=50  Score=22.58  Aligned_cols=40  Identities=15%  Similarity=-0.003  Sum_probs=23.3

Q ss_pred             HHHHHHHHhCHHHHHHhCCCCeEEEEEcCCCCCEE--EEEec
Q psy15303         24 SGVRDFLAQHYVPLKQANPKFPILVRECSGVTPVV--WARIP   63 (72)
Q Consensus        24 ~GvR~Fl~~~l~~~k~~NP~v~i~v~~~~g~~P~l--~a~Y~   63 (72)
                      +...+.+--.++.-+..||++-+.++-..+--+-.  ++.|=
T Consensus        33 k~~~~~lFp~~~~~~~~Np~~~~~~~~~s~~~~~~~~r~iYY   74 (156)
T PF09217_consen   33 KSAAELLFPSINHTKEENPDIWLKARWQSHFVTDSQVRFIYY   74 (156)
T ss_dssp             HHHHHHH-GGG-SSSSSS-EEEEEEEETTTT---EEEEEEEE
T ss_pred             ccHHHHhCCCCCcccccCCceeEEEEECCCCccceeEEEEEE
Confidence            44444454556667889999999999988744434  44443


No 169
>cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells. More recently, mutations in GDAP1 have been reported to cause both axonal and demyelinating autosomal-recessive Charcot-Marie-Tooth (CMT) type 4A neuropathy. CMT is characterized by slow and progressive weakness and atrophy of muscles. Sequence analysis of GDAP1 shows similarities and differences with GSTs; it appears to contain both N-terminal TRX-fold and C-terminal alpha helical domains of GSTs, however, it also contains additional C-terminal transmembrane domains unlike GSTs. GDAP1 is mainly expressed in neuronal cells and is localized in the mitochondria through its transmembrane domains. It does not exhibit GST activity using standard substrates.
Probab=22.01  E-value=94  Score=17.33  Aligned_cols=20  Identities=30%  Similarity=0.157  Sum_probs=16.3

Q ss_pred             EEEEecCCCCCCHHHHHHHH
Q psy15303         12 LRIHLCQKGGSSSGVRDFLA   31 (72)
Q Consensus        12 L~~~yC~~~~sS~GvR~Fl~   31 (72)
                      ++|.++..+++|+-+|-.++
T Consensus         1 ~~ly~~~~s~~s~rv~~~L~   20 (73)
T cd03052           1 LVLYHWTQSFSSQKVRLVIA   20 (73)
T ss_pred             CEEecCCCCccHHHHHHHHH
Confidence            46788888999999998774


No 170
>PRK13337 putative lipid kinase; Reviewed
Probab=21.96  E-value=2.1e+02  Score=20.29  Aligned_cols=42  Identities=17%  Similarity=0.094  Sum_probs=28.7

Q ss_pred             eEEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEEcC
Q psy15303         10 KELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRECS   52 (72)
Q Consensus        10 k~L~~~yC~~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v~~~~   52 (72)
                      +++.|-+++.+|+.++.+.+ .+-...+.+.+-++.++..+..
T Consensus         2 ~r~~~I~Np~aG~~~~~~~~-~~~~~~l~~~~~~~~~~~t~~~   43 (304)
T PRK13337          2 KRARIIYNPTSGRELFKKNL-PDVLQKLEQAGYETSAHATTGP   43 (304)
T ss_pred             ceEEEEECCcccchhHHHHH-HHHHHHHHHcCCEEEEEEecCC
Confidence            57889999999998877664 3334456677766665554443


No 171
>PRK10341 DNA-binding transcriptional activator TdcA; Provisional
Probab=21.96  E-value=1.4e+02  Score=20.72  Aligned_cols=37  Identities=14%  Similarity=0.113  Sum_probs=26.7

Q ss_pred             eEEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         10 KELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        10 k~L~~~yC~~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ..|+|-.+..     -...++..-+.+|++.+|++.|.+...
T Consensus        97 ~~l~ig~~~~-----~~~~~l~~~l~~~~~~~p~v~i~~~~~  133 (312)
T PRK10341         97 VDVSFGFPSL-----IGFTFMSDMINKFKEVFPKAQVSMYEA  133 (312)
T ss_pred             eEEEEEechH-----HhHhhHHHHHHHHHHhCCCCEEEEEeC
Confidence            3466654322     234677889999999999999998754


No 172
>PF14459 Prok-E2_C:  Prokaryotic E2 family C
Probab=21.83  E-value=1.3e+02  Score=19.84  Aligned_cols=22  Identities=32%  Similarity=0.481  Sum_probs=17.7

Q ss_pred             HHHHHHhCHHHHHH-hCCCCeEE
Q psy15303         26 VRDFLAQHYVPLKQ-ANPKFPIL   47 (72)
Q Consensus        26 vR~Fl~~~l~~~k~-~NP~v~i~   47 (72)
                      .-+|+.+++.++++ -||.+.|-
T Consensus        38 as~~~a~~l~~LA~sINp~I~i~   60 (131)
T PF14459_consen   38 ASSFQAQNLQSLARSINPRIEIR   60 (131)
T ss_pred             hHHHHHHHHHHHHHhcCCCeEEE
Confidence            34688899999988 69998873


No 173
>COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion]
Probab=21.79  E-value=1.7e+02  Score=22.60  Aligned_cols=37  Identities=14%  Similarity=0.391  Sum_probs=27.9

Q ss_pred             eEEEEEecCCCCCCHHHHHHH-HhCHHHHHHhCCCCeEEEEEc
Q psy15303         10 KELRIHLCQKGGSSSGVRDFL-AQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        10 k~L~~~yC~~~~sS~GvR~Fl-~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      |+++|-|     ..+..|+-+ ++.|.+++++||+..-.+...
T Consensus       305 Rkis~WY-----GARS~rE~fY~Ed~d~L~ae~pNF~wH~aLS  342 (410)
T COG2871         305 RKISFWY-----GARSLREMFYQEDFDQLQAENPNFHWHLALS  342 (410)
T ss_pred             ceeeeee-----ccchHHHhHHHHHHHHHHhhCCCcEEEEEec
Confidence            5677776     244566654 799999999999999877654


No 174
>PF02960 K1:  K1 glycoprotein;  InterPro: IPR004121 Current genotyping systems for Human herpesvirus 8 (HHV-8) are based on the highly variable gene encoding the K1 glycoprotein []. This entry represents the C-terminal region of the K1 glycoprotein.
Probab=21.77  E-value=35  Score=22.51  Aligned_cols=43  Identities=21%  Similarity=0.356  Sum_probs=37.3

Q ss_pred             CCHHHHHHHHhCHHHHHHhCCCCeEEEEEcCCCCCEEEEEecC
Q psy15303         22 SSSGVRDFLAQHYVPLKQANPKFPILVRECSGVTPVVWARIPT   64 (72)
Q Consensus        22 sS~GvR~Fl~~~l~~~k~~NP~v~i~v~~~~g~~P~l~a~Y~n   64 (72)
                      |-.|.|.|=.+.+.++--+..+..+.++|....+|.+...+.-
T Consensus        30 STTGFrTfsTn~lvnIi~aTth~vvvvkEakstn~hi~v~fLv   72 (130)
T PF02960_consen   30 STTGFRTFSTNSLVNIIHATTHDVVVVKEAKSTNPHIQVHFLV   72 (130)
T ss_pred             cccceEEEecccccceecccccceEEEEEeecCCceEEeeeeH
Confidence            4468899988888889899999999999999999999888753


No 175
>PRK14997 LysR family transcriptional regulator; Provisional
Probab=21.76  E-value=1.7e+02  Score=19.98  Aligned_cols=27  Identities=4%  Similarity=0.144  Sum_probs=22.3

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEcC
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVRECS   52 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~~   52 (72)
                      ...++...+.+|.+++|++.|.+....
T Consensus       103 ~~~~l~~~l~~~~~~~P~i~i~~~~~~  129 (301)
T PRK14997        103 LHVHIGPMLAKFMARYPDVSLQLEATN  129 (301)
T ss_pred             HHHHHHHHHHHHHHHCCCeEEEEEecC
Confidence            446778899999999999999997644


No 176
>KOG1454|consensus
Probab=21.70  E-value=88  Score=22.90  Aligned_cols=26  Identities=19%  Similarity=0.181  Sum_probs=22.3

Q ss_pred             CHHHHHHhCCCCeEEEEEcCCCCCEE
Q psy15303         33 HYVPLKQANPKFPILVRECSGVTPVV   58 (72)
Q Consensus        33 ~l~~~k~~NP~v~i~v~~~~g~~P~l   58 (72)
                      .-..+++++|++++++-+.-|.+|.+
T Consensus       282 ~~~~~~~~~pn~~~~~I~~~gH~~h~  307 (326)
T KOG1454|consen  282 LAEELKKKLPNAELVEIPGAGHLPHL  307 (326)
T ss_pred             HHHHHHhhCCCceEEEeCCCCccccc
Confidence            35678899999999999988888876


No 177
>PRK10026 arsenate reductase; Provisional
Probab=21.65  E-value=2e+02  Score=18.85  Aligned_cols=23  Identities=13%  Similarity=0.209  Sum_probs=19.9

Q ss_pred             EEEEEecCCCCCCHHHHHHHHhC
Q psy15303         11 ELRIHLCQKGGSSSGVRDFLAQH   33 (72)
Q Consensus        11 ~L~~~yC~~~~sS~GvR~Fl~~~   33 (72)
                      .++|..-..+.+|+-+++||+.+
T Consensus         3 ~i~iY~~p~Cst~RKA~~wL~~~   25 (141)
T PRK10026          3 NITIYHNPACGTSRNTLEMIRNS   25 (141)
T ss_pred             EEEEEeCCCCHHHHHHHHHHHHC
Confidence            57888889999999999999765


No 178
>PRK12681 cysB transcriptional regulator CysB; Reviewed
Probab=21.64  E-value=1.3e+02  Score=21.35  Aligned_cols=36  Identities=14%  Similarity=0.155  Sum_probs=27.1

Q ss_pred             EEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         11 ELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        11 ~L~~~yC~~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      .|+|-.+.     .-...++...+.+|.+.+|++.|.+...
T Consensus        94 ~l~Ig~~~-----~~~~~~l~~~l~~f~~~~P~i~i~i~~~  129 (324)
T PRK12681         94 SLYIATTH-----TQARYALPPVIKGFIERYPRVSLHMHQG  129 (324)
T ss_pred             eEEEEech-----hHHHHhhHHHHHHHHHHCCCcEEEEEeC
Confidence            46664432     3345688899999999999999998764


No 179
>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. The class Delta and Epsilon subfamily is made up primarily of insect GSTs, which play major roles in insecticide resistance by facilitating reductive dehydrochlorination of insecticides or conjugating them with GSH to produce water-soluble metabolites that are easily excreted. They are also implicated in protection against cellular damage by oxidative stress.
Probab=21.63  E-value=1.2e+02  Score=16.27  Aligned_cols=20  Identities=5%  Similarity=-0.109  Sum_probs=16.9

Q ss_pred             EEEEecCCCCCCHHHHHHHH
Q psy15303         12 LRIHLCQKGGSSSGVRDFLA   31 (72)
Q Consensus        12 L~~~yC~~~~sS~GvR~Fl~   31 (72)
                      ++|.+...++.|+-+|-+++
T Consensus         1 ~~Ly~~~~~~~~~~v~~~l~   20 (74)
T cd03045           1 IDLYYLPGSPPCRAVLLTAK   20 (74)
T ss_pred             CEEEeCCCCCcHHHHHHHHH
Confidence            46788889999999999885


No 180
>PF00505 HMG_box:  HMG (high mobility group) box;  InterPro: IPR000910 High mobility group (HMG or HMGB) proteins are a family of relatively low molecular weight non-histone components in chromatin. HMG1 (also called HMG-T in fish) and HMG2 are two highly related proteins that bind single-stranded DNA preferentially and unwind double-stranded DNA. Although they have no sequence specificity, they have a high affinity for bent or distorted DNA, and bend linear DNA. HMG1 and HMG2 contain two DNA-binding HMG-box domains (A and B) that show structural and functional differences, and have a long acidic C-terminal domain rich in aspartic and glutamic acid residues. The acidic tail modulates the affinity of the tandem HMG boxes in HMG1 and 2 for a variety of DNA targets. HMG1 and 2 appear to play important architectural roles in the assembly of nucleoprotein complexes in a variety of biological processes, for example V(D)J recombination, the initiation of transcription, and DNA repair []. The profile in this entry describing the HMG-domains is much more general than the signature. In addition to the HMG1 and HMG2 proteins, HMG-domains occur in single or multiple copies in the following protein classes; the SOX family of transcription factors; SRY sex determining region Y protein and related proteins []; LEF1 lymphoid enhancer binding factor 1 []; SSRP recombination signal recognition protein; MTF1 mitochondrial transcription factor 1; UBF1/2 nucleolar transcription factors; Abf2 yeast ARS-binding factor []; and Saccharomyces cerevisiae transcription factors Ixr1, Rox1, Nhp6a, Nhp6b and Spp41.; GO: 0003677 DNA binding; PDB: 1I11_A 1J3C_A 1J3D_A 1WZ6_A 1WGF_A 2D7L_A 1GT0_D 3U2B_C 2CRJ_A 2CS1_A ....
Probab=21.50  E-value=66  Score=17.33  Aligned_cols=18  Identities=28%  Similarity=0.451  Sum_probs=14.9

Q ss_pred             HHHHhCHHHHHHhCCCCe
Q psy15303         28 DFLAQHYVPLKQANPKFP   45 (72)
Q Consensus        28 ~Fl~~~l~~~k~~NP~v~   45 (72)
                      -|.......++..||+..
T Consensus        10 lf~~~~~~~~k~~~p~~~   27 (69)
T PF00505_consen   10 LFCKEKRAKLKEENPDLS   27 (69)
T ss_dssp             HHHHHHHHHHHHHSTTST
T ss_pred             HHHHHHHHHHHHHhcccc
Confidence            466788999999999865


No 181
>PRK11914 diacylglycerol kinase; Reviewed
Probab=21.36  E-value=1.6e+02  Score=20.88  Aligned_cols=41  Identities=7%  Similarity=0.067  Sum_probs=28.4

Q ss_pred             CceEEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEE
Q psy15303          8 KLKELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVR   49 (72)
Q Consensus         8 qLk~L~~~yC~~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v~   49 (72)
                      +.+++.|-+++.+|+.++.+.+- +-...+++.+.++.+...
T Consensus         7 ~~~~~~iI~NP~sG~g~~~~~~~-~~~~~l~~~g~~~~~~~t   47 (306)
T PRK11914          7 EIGKVTVLTNPLSGHGAAPHAAE-RAIARLHHRGVDVVEIVG   47 (306)
T ss_pred             CCceEEEEECCCCCCCcHHHHHH-HHHHHHHHcCCeEEEEEe
Confidence            45788999999999887776643 334567777766655443


No 182
>PRK11074 putative DNA-binding transcriptional regulator; Provisional
Probab=21.32  E-value=1.1e+02  Score=21.18  Aligned_cols=37  Identities=16%  Similarity=0.092  Sum_probs=28.7

Q ss_pred             eEEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         10 KELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        10 k~L~~~yC~~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      .+|+|-..+..     ...++...+..|++++|++.|.+...
T Consensus        92 g~l~Ig~~~~~-----~~~~l~~~l~~~~~~~p~i~i~i~~~  128 (300)
T PRK11074         92 GQLSIAVDNIV-----RPDRTRQLIVDFYRHFDDVELIIRQE  128 (300)
T ss_pred             ceEEEEEcCcc-----chhHHHHHHHHHHHhCCCceEEEEeh
Confidence            56777764433     35788899999999999999988763


No 183
>COG5575 ORC2 Origin recognition complex, subunit 2 [DNA replication, recombination, and repair]
Probab=21.27  E-value=73  Score=25.38  Aligned_cols=27  Identities=11%  Similarity=0.229  Sum_probs=23.1

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         25 GVRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        25 GvR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      =+|+|+++++.++++++...+|.-.+.
T Consensus       493 mL~EFidH~l~~i~rn~S~~eI~wvpy  519 (535)
T COG5575         493 MLNEFIDHGLLKIKRNGSEIEICWVPY  519 (535)
T ss_pred             HHHHHHhcchhheeccCCccEEEEeec
Confidence            368999999999999999999876553


No 184
>PF10691 DUF2497:  Protein of unknown function (DUF2497) ;  InterPro: IPR019632  Members of this family belong to the Alphaproteobacteria. The function of the family is not known. 
Probab=21.03  E-value=87  Score=18.60  Aligned_cols=14  Identities=14%  Similarity=0.430  Sum_probs=9.9

Q ss_pred             HHHHHHhCHHHHHH
Q psy15303         26 VRDFLAQHYVPLKQ   39 (72)
Q Consensus        26 vR~Fl~~~l~~~k~   39 (72)
                      +++||.+|||.+-+
T Consensus        47 LkeWLD~nLP~lVE   60 (73)
T PF10691_consen   47 LKEWLDENLPGLVE   60 (73)
T ss_pred             HHHHHHhccHHHHH
Confidence            46778888887644


No 185
>PRK03601 transcriptional regulator HdfR; Provisional
Probab=20.99  E-value=1.7e+02  Score=19.97  Aligned_cols=26  Identities=15%  Similarity=0.032  Sum_probs=22.0

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ...++...+.+|.+.+|++.|.+...
T Consensus       100 ~~~~l~~~l~~f~~~~P~v~v~~~~~  125 (275)
T PRK03601        100 WECMLTPWLGRLYQNQEALQFEARIA  125 (275)
T ss_pred             HHHHHHHHHHHHHHhCCCcEEEEEEC
Confidence            36777899999999999999988654


No 186
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions. It specifically binds G protein betagamma (Gbg)-subunits with high affinity, resulting in the solubilization of Gbg from the plasma membrane. This impedes the formation of a functional G protein trimer (G protein alphabetagamma), thereby inhibiting G protein-mediated signal transduction. Phd also inhibits the GTPase activity of G protein alpha. Phd can be phosphorylated by protein kinase A and G protein-coupled receptor kinase 2, leading to its inactivation. Phd was originally isolated from the retina, where it is highly expressed and has been implicated to play an important role in light adaptation. It is also found in the pineal gland, liver, spleen, striated muscle and the brain. The C-terminal domain of Phd adopts a thioredoxin fold, but it does not contain a CXXC motif. Phd interacts with G protein beta mostly through the N-terminal helical domain.
Probab=20.78  E-value=1.7e+02  Score=19.42  Aligned_cols=36  Identities=6%  Similarity=-0.091  Sum_probs=24.8

Q ss_pred             EEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEE
Q psy15303         11 ELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRE   50 (72)
Q Consensus        11 ~L~~~yC~~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v~~   50 (72)
                      -|...|-+|.+.++-|    ...+.++++++|.+.|.--.
T Consensus        86 VVV~Fya~wc~~Ck~m----~~~l~~LA~~~~~vkF~kVd  121 (175)
T cd02987          86 VVVHIYEPGIPGCAAL----NSSLLCLAAEYPAVKFCKIR  121 (175)
T ss_pred             EEEEEECCCCchHHHH----HHHHHHHHHHCCCeEEEEEe
Confidence            3445566777888744    44677888899998876533


No 187
>PLN02495 oxidoreductase, acting on the CH-CH group of donors
Probab=20.67  E-value=1.1e+02  Score=23.28  Aligned_cols=28  Identities=21%  Similarity=0.322  Sum_probs=23.2

Q ss_pred             CCHHHHHHHHhCHHHHHHhCCCCeEEEEE
Q psy15303         22 SSSGVRDFLAQHYVPLKQANPKFPILVRE   50 (72)
Q Consensus        22 sS~GvR~Fl~~~l~~~k~~NP~v~i~v~~   50 (72)
                      +.+|+..|++. ++.++++.|++++.+.-
T Consensus        93 s~~g~~~~l~~-i~~~k~~~~~~pvIaSi  120 (385)
T PLN02495         93 SDRPFETMLAE-FKQLKEEYPDRILIASI  120 (385)
T ss_pred             cccCHHHHHHH-HHHHHhhCCCCcEEEEc
Confidence            45689999987 78898888998888765


No 188
>TIGR03418 chol_sulf_TF putative choline sulfate-utilization transcription factor. Members of this protein family are transcription factors of the LysR family. Their genes typically are divergently transcribed from choline-sulfatase genes. That enzyme makes choline, a precursor to the osmoprotectant glycine-betaine, available by hydrolysis of choline sulfate.
Probab=20.54  E-value=1.3e+02  Score=20.43  Aligned_cols=27  Identities=15%  Similarity=0.210  Sum_probs=22.5

Q ss_pred             HHHHHHhCHHHHHHhCCCCeEEEEEcC
Q psy15303         26 VRDFLAQHYVPLKQANPKFPILVRECS   52 (72)
Q Consensus        26 vR~Fl~~~l~~~k~~NP~v~i~v~~~~   52 (72)
                      ...++...+.+|.+++|++.+.+....
T Consensus       100 ~~~~l~~~l~~~~~~~p~i~i~~~~~~  126 (291)
T TIGR03418       100 ATYWLMPRLHRFKRAMPDVDVSLVTSQ  126 (291)
T ss_pred             HHHHHhhhhHHHHHhCCCceEEEEecC
Confidence            347788889999999999999997643


No 189
>PF02886 LBP_BPI_CETP_C:  LBP / BPI / CETP family, C-terminal domain;  InterPro: IPR001124 This entry represents the C-terminal domain found in several lipid-binding serum glycoproteins. The N- and C-terminal domains share a similar two-layer alpha/beta structure, but they show little sequence identity. Proteins containing this C-terminal domain include:   Bactericidal permeability-increasing protein (BPI) Lipopolysaccharide-binding protein (LBP) Cholesteryl ester transfer protein (CETP) Phospholipid transfer protein (PLTP) Palate, lung and nasal epithelium carcinoma-associated protein (PLUNC)    Bactericidal permeability-increasing protein (BPI) is a potent antimicrobial protein of 456 residues that binds to and neutralises lipopolysaccharides from the outer membrane of Gram-negative bacteria []. BPI contains two domains that adopt the same structural fold, even though they have little sequence similarity [].   Lipopolysaccharide-binding protein (LBP) is an endotoxin-binding protein that is closely related to, and functions in a co-ordinated manner with BPI to facilitate an integrated host response to invading Gram-negative bacteria []. Cholesteryl ester transfer protein (CETP) is a glycoprotein that facilitates the transfer of lipids (cholesteryl esters and triglycerides) between the different lipoproteins that transport them through plasma, including HDL, LDL, VLDL and chylomicrons. These lipoproteins shield the lipids from water by encapsulating them within a coating of polar lipids and proteins [].  Phospholipid transfer protein (PLTP) exchanges phospholipids between lipoproteins and remodels high-density lipoproteins (HDLs) []. Palate, lung and nasal epithelium carcinoma-associated protein (PLUNC) is a potential host defensive protein that is secreted from the submucosal gland to the saliva and nasal lavage fluid. PLUNC aapears to be a secreted product of neutrophil granules that participates in an aspect of the inflammatory response that contributes to host defence []. Short palate, lung and nasal epithelium clone 1 (SPLUNC1) may bind the lipopolysaccharide of Gram-negative nanobacteria, thereby playing an important role in the host defence of nasopharyngeal epithelium [].; GO: 0008289 lipid binding; PDB: 2OBD_A 1EWF_A 1BP1_A.
Probab=20.51  E-value=77  Score=21.55  Aligned_cols=33  Identities=21%  Similarity=0.247  Sum_probs=24.1

Q ss_pred             HHHhCHHHHHHhCCCCeEEEEEcCCCCCEEEEE
Q psy15303         29 FLAQHYVPLKQANPKFPILVRECSGVTPVVWAR   61 (72)
Q Consensus        29 Fl~~~l~~~k~~NP~v~i~v~~~~g~~P~l~a~   61 (72)
                      .+..-+|+++++.|+-++.++-.....|.+...
T Consensus        80 ~~g~~iP~l~~~yPn~~~~l~i~~~~~P~v~~~  112 (238)
T PF02886_consen   80 CIGDLIPELAKKYPNSPVELKIRSTKPPVVTIS  112 (238)
T ss_dssp             CCCTCCCCHHHCSCC-CEEEEEEESS--EEEEE
T ss_pred             cHHhhhhhHHhcCCCCeEEEEEEeCCCCEEEEE
Confidence            445688999999999888888877789987754


No 190
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO). All members contain a redox-active CXXC motif and may function as PDOs. The archaeal proteins Mj0307 and Mt807 show structures more similar to GRX, but activities more similar to TRX. Some members of the family are similar to PfPDO in that they contain a second CXXC motif located in a second TRX-fold subdomain at the N-terminus; the superimposable N- and C-terminal TRX subdomains form a compact structure. PfPDO is postulated to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI). The C-terminal CXXC motif of PfPDO is required for its oxidase, reductase and isomerase activities. Also included in the family is the C-terminal TRX-fold subdomain of the N-terminal domain (NTD) of bacteri
Probab=20.17  E-value=1.6e+02  Score=15.56  Aligned_cols=36  Identities=6%  Similarity=0.106  Sum_probs=26.8

Q ss_pred             EEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEE
Q psy15303         11 ELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVRE   50 (72)
Q Consensus        11 ~L~~~yC~~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v~~   50 (72)
                      ++.+.+.++.+-++=++.+++    +++..+|++++....
T Consensus         2 ~v~~f~~~~C~~C~~~~~~l~----~l~~~~~~i~~~~id   37 (67)
T cd02973           2 NIEVFVSPTCPYCPDAVQAAN----RIAALNPNISAEMID   37 (67)
T ss_pred             EEEEEECCCCCCcHHHHHHHH----HHHHhCCceEEEEEE
Confidence            577888889999988877764    456678888876654


No 191
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains. Yeast complementation studies show that ERp46 can substitute for protein disulfide isomerase (PDI) function in vivo. It has been detected in many tissues, however, transcript and protein levels do not correlate in all tissues, suggesting regulation at a posttranscriptional level. An identical protein, named endoPDI, has been identified as an endothelial PDI that is highly expressed in the endothelium of tumors and hypoxic lesions. It has a protective effect on cells exposed to hypoxia.
Probab=20.14  E-value=1.2e+02  Score=17.03  Aligned_cols=41  Identities=15%  Similarity=0.183  Sum_probs=28.5

Q ss_pred             EEEEEecCCCCCCHHHHHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         11 ELRIHLCQKGGSSSGVRDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        11 ~L~~~yC~~~~sS~GvR~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      -|...|-+|.+.++.+..-+++-..+++..+|.+.+..-.+
T Consensus        19 ~lv~f~a~wC~~C~~~~p~~~~~~~~~~~~~~~~~~~~vd~   59 (102)
T cd03005          19 HFVKFFAPWCGHCKRLAPTWEQLAKKFNNENPSVKIAKVDC   59 (102)
T ss_pred             EEEEEECCCCHHHHHhCHHHHHHHHHHhccCCcEEEEEEEC
Confidence            57778888888888887776666666655556676655433


No 192
>PRK15421 DNA-binding transcriptional regulator MetR; Provisional
Probab=20.13  E-value=1.4e+02  Score=21.00  Aligned_cols=25  Identities=8%  Similarity=0.153  Sum_probs=21.8

Q ss_pred             HHHHHhCHHHHHHhCCCCeEEEEEc
Q psy15303         27 RDFLAQHYVPLKQANPKFPILVREC   51 (72)
Q Consensus        27 R~Fl~~~l~~~k~~NP~v~i~v~~~   51 (72)
                      ..++...+.+|++++|++.+.+...
T Consensus       101 ~~~l~~~l~~~~~~~P~i~l~~~~~  125 (317)
T PRK15421        101 IQWLTPALENFHKNWPQVEMDFKSG  125 (317)
T ss_pred             HHHHHHHHHHHHHHCCCceEEEEeC
Confidence            4678889999999999999998764


No 193
>PRK10086 DNA-binding transcriptional regulator DsdC; Provisional
Probab=20.13  E-value=1.7e+02  Score=20.41  Aligned_cols=28  Identities=7%  Similarity=0.160  Sum_probs=23.6

Q ss_pred             HHHHHHHhCHHHHHHhCCCCeEEEEEcC
Q psy15303         25 GVRDFLAQHYVPLKQANPKFPILVRECS   52 (72)
Q Consensus        25 GvR~Fl~~~l~~~k~~NP~v~i~v~~~~   52 (72)
                      -...++...+..|.+++|++.|.+....
T Consensus       112 ~~~~~l~~~l~~f~~~~P~i~i~~~~~~  139 (311)
T PRK10086        112 IAQCWLVPRLADFTRRYPSISLTILTGN  139 (311)
T ss_pred             HHHHHHHHHHHHHHHHCCCeEEEEEeCC
Confidence            4567888899999999999999988644


No 194
>cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli. E. coli ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], the first step in the detoxification of arsenic, using reducing equivalents derived from glutathione (GSH) via glutaredoxin (GRX). ArsC contains a single catalytic cysteine, within a thioredoxin fold, that forms a covalent thiolate-As(V) intermediate, which is reduced by GRX through a mixed GSH-arsenate intermediate. This family of predominantly bacterial enzymes is unrelated to two other families of arsenate reductases which show similarity to low-molecular-weight acid phosphatases and phosphotyrosyl phosphatases.
Probab=20.09  E-value=1.8e+02  Score=17.77  Aligned_cols=22  Identities=14%  Similarity=0.132  Sum_probs=17.5

Q ss_pred             EEEEecCCCCCCHHHHHHHHhC
Q psy15303         12 LRIHLCQKGGSSSGVRDFLAQH   33 (72)
Q Consensus        12 L~~~yC~~~~sS~GvR~Fl~~~   33 (72)
                      |+|..-.++.+|+-++.|++.+
T Consensus         1 i~iy~~~~C~t~rkA~~~L~~~   22 (112)
T cd03034           1 ITIYHNPRCSKSRNALALLEEA   22 (112)
T ss_pred             CEEEECCCCHHHHHHHHHHHHC
Confidence            3567778888999999999754


Done!