Diaphorina citri psyllid: psy15308


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270
MQSSPGVGMHVQISNPDSKIILSRLLCVVLLAVIPFSYALYFHISETERKCFIEEIPEETQLLCVVLLAIIPFSYALYFHISETERKCFIEEIPEETQVIINYKTELFDTRTGGYMQSSPGVGMHVQISNPDSKIILSRLYSYEGRISFTSHMPGEHVICLYSNSTKWVGASQLRVHLDIQVGEHAIDYAQVAQKDKLSELQLRVRQLLDQCDQITKEQNYQRYREERFRATSESTNQRVFWWSLAQLGILVCMGVWQMRHLKSFFEAKK
cccccccCEEEEEcccccHHHHHHHHHHHHHHHccccEEEEEEEcccccccccccccHHHHHHHHHHHHHHHcEEEEEEEEccccccEEEEEcccccEEEEEEEEEEEcccccccccccccCEEEEEEEcccccEEEEEEEEcEEEEEEEEccccCEEEEcEEccccccccCEEEEEEEEEEccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
**********VQISNPDSKIILSRLLCVVLLAVIPFSYALYFHISETERKCFIEEIPEETQLLCVVLLAIIPFSYALYFHISETERKCFIEEIPEETQVIINYKTELFDTRTGGYMQSSPGVGMHVQISNPDSKIILSRLYSYEGRISFTSHMPGEHVICLYSNSTKWVGASQLRVHLDIQVGEHAIDYAQVAQKDKLSELQLRVRQLLDQCDQITKEQNYQRYREERFRATSESTNQRVFWWSLAQLGILVCMGVWQMRHLKSFFEAKK
xxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQSSPGVGMHVQISNPDSKIILSRLLCVVLLAVIPFSYALYFHISETERKCFIEEIPEETQLLCVVLLAIIPFSYALYFHISETERKCFIEEIPEETQVIINYKTELFDTRTGGYMQSSPGVGMHVQISNPDSKIILSRLYSYEGRISFTSHMPGEHVICLYSNSTKWVGASQLRVHLDIQVGEHAIDYAQVAQKDKxxxxxxxxxxxxxxxxxxxxxQNYQRYREERFRATSESTNQRVFWWSLAQLGILVCMGVWQMRHLKSFFEAKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transmembrane emp24 domain-containing protein eca Eca and bai are essential, though not redundant, for dorsoventral patterning of the embryo. Specifically required during early embryogenesis for the activity of maternal tkv, while the zygotic tkv is not affected. Involved in Golgi organization.very confidentQ9I7K5
Transmembrane emp24 domain-containing protein eca Eca and bai are essential, though not redundant, for dorsoventral patterning of the embryo. Specifically required during early embryogenesis for the activity of maternal tkv, while the zygotic tkv is not affected. Involved in Golgi organization.very confidentQ295B2
Transmembrane emp24 domain-containing protein 9 Appears to be involved in vesicular protein trafficking, mainly in the early secretory pathway. In COPI vesicle-mediated retrograde transport involved in the coatomer recruitment to membranes of the early secretory pathway. Increases coatomer-dependent activity of ARFGAP2. Thought to play a crucial role in the specific retention of p24 complexes in cis-Golgi membranes; specifically contributes to the coupled localization of TMED2 and TMED10 in the cis-Golgi network. May be involved in organization of intracellular membranes, such as of the ER-Golgi intermediate compartment and the Golgi apparatus. Involved in ER localization of PTPN2.confidentQ99KF1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000003 [BP]reproductionprobableGO:0008150
GO:0090263 [BP]positive regulation of canonical Wnt receptor signaling pathwayprobableGO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0030111, GO:0050794, GO:0023056, GO:0030177, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0060828, GO:0048522
GO:0009953 [BP]dorsal/ventral pattern formationprobableGO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0003002, GO:0007275, GO:0044699
GO:0002121 [BP]inter-male aggressive behaviorprobableGO:0050896, GO:0007610, GO:0008150, GO:0002118, GO:0051705, GO:0051704
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0034389 [BP]lipid particle organizationprobableGO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0007030 [BP]Golgi organizationprobableGO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0048042 [BP]regulation of post-mating ovipositionprobableGO:2000241, GO:0048583, GO:0050795, GO:0043900, GO:0065007, GO:0051239, GO:0008150, GO:0050789, GO:0046662
GO:0061357 [BP]positive regulation of Wnt protein secretionprobableGO:0032880, GO:0070201, GO:0051223, GO:0050708, GO:0060341, GO:0051046, GO:0050714, GO:0051049, GO:0051050, GO:0051047, GO:0050794, GO:0061356, GO:0065007, GO:0032879, GO:0023051, GO:0048518, GO:0008150, GO:0051222, GO:0010646, GO:0050789, GO:0048522
GO:0043123 [BP]positive regulation of I-kappaB kinase/NF-kappaB cascadeprobableGO:0023051, GO:0009966, GO:0010740, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0009967, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0010627, GO:0050789, GO:0043122, GO:0048522
GO:0070863 [BP]positive regulation of protein exit from endoplasmic reticulumprobableGO:0033157, GO:0070201, GO:0032879, GO:0032388, GO:0060341, GO:0051050, GO:0051049, GO:0032386, GO:0090316, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0051222, GO:0051223, GO:0050789, GO:0070861, GO:0032880
GO:0035220 [BP]wing disc developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007444, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0004871 [MF]signal transducer activityprobableGO:0060089, GO:0003674
GO:0010638 [BP]positive regulation of organelle organizationprobableGO:0051130, GO:0033043, GO:0051128, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0050789, GO:0048522
GO:0006888 [BP]ER to Golgi vesicle-mediated transportprobableGO:0051234, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0016482
GO:0032527 [BP]protein exit from endoplasmic reticulumprobableGO:0033036, GO:0034613, GO:0046907, GO:0070727, GO:0006886, GO:0006810, GO:0045184, GO:0044765, GO:0008104, GO:0008150, GO:0051641, GO:0071702, GO:0015031, GO:0044763, GO:0009987, GO:0051234, GO:0051649, GO:0051179, GO:0044699, GO:0016482
GO:0040011 [BP]locomotionprobableGO:0008150
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0030140 [CC]trans-Golgi network transport vesicleprobableGO:0030135, GO:0043229, GO:0030133, GO:0043227, GO:0043226, GO:0030136, GO:0005737, GO:0005575, GO:0031982, GO:0016023, GO:0031410, GO:0031988, GO:0044431, GO:0005794, GO:0005798, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0030667 [CC]secretory granule membraneprobableGO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0030141, GO:0030659, GO:0012505, GO:0012506, GO:0031982, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0032403 [MF]protein complex bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005789 [CC]endoplasmic reticulum membraneprobableGO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0070765 [CC]gamma-secretase complexprobableGO:0043234, GO:0032991, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0051259 [BP]protein oligomerizationprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0048205 [BP]COPI coating of Golgi vesicleprobableGO:0048200, GO:0006901, GO:0006900, GO:0006903, GO:0061024, GO:0051656, GO:0051650, GO:0044699, GO:0016044, GO:0016043, GO:0071840, GO:0048194, GO:0009987, GO:0048193, GO:0006810, GO:0048199, GO:0044765, GO:0044763, GO:0051648, GO:0051649, GO:0051234, GO:0051179, GO:0051640, GO:0051641, GO:0006996, GO:0016192, GO:0046907, GO:0016050, GO:0035964, GO:0008150
GO:0005801 [CC]cis-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0034498 [BP]early endosome to Golgi transportprobableGO:0016197, GO:0051234, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0042147, GO:0051649, GO:0044763, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0016482
GO:0033116 [CC]endoplasmic reticulum-Golgi intermediate compartment membraneprobableGO:0005737, GO:0031090, GO:0005793, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0030134 [CC]ER to Golgi transport vesicleprobableGO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0030133, GO:0005622, GO:0030135, GO:0043226, GO:0031982
GO:0030137 [CC]COPI-coated vesicleprobableGO:0005737, GO:0005794, GO:0043231, GO:0043229, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0005798, GO:0005623, GO:0031988, GO:0044446, GO:0044431, GO:0043227, GO:0005575, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0044422, GO:0031982

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OLM, chain A
Confidence level:probable
Coverage over the Query: 78-106,121-183
View the alignment between query and template
View the model in PyMOL