Query         psy15313
Match_columns 134
No_of_seqs    110 out of 143
Neff          5.2 
Searched_HMMs 46136
Date          Fri Aug 16 17:50:23 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15313.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15313hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF06468 Spond_N:  Spondin_N;   100.0 1.8E-37 3.8E-42  244.9   6.1  104   31-134     1-109 (196)
  2 KOG3539|consensus              100.0 8.3E-38 1.8E-42  271.1   4.3  127    8-134   106-237 (508)
  3 PRK11372 lysozyme inhibitor; P  84.4     1.6 3.5E-05   31.6   3.8   14   69-82     77-90  (109)
  4 PF11153 DUF2931:  Protein of u  68.7       6 0.00013   31.1   3.3   44    1-55      1-44  (216)
  5 COG4314 NosL Predicted lipopro  67.6     5.5 0.00012   31.4   2.8   31    1-31      1-43  (176)
  6 PRK10449 heat-inducible protei  65.9     6.2 0.00013   29.4   2.7   21    1-21      1-21  (140)
  7 PRK13792 lysozyme inhibitor; P  60.2     6.5 0.00014   29.5   1.9   23    1-23      1-25  (127)
  8 TIGR02747 TraV type IV conjuga  59.7     7.4 0.00016   29.9   2.1   31    1-31      1-33  (144)
  9 TIGR00752 slp outer membrane l  59.7     4.8  0.0001   31.9   1.1   22    1-22      2-23  (182)
 10 PRK10002 outer membrane protei  56.9     7.8 0.00017   32.7   2.1   17    1-17      2-18  (362)
 11 TIGR03511 GldH_lipo gliding mo  54.7      13 0.00029   28.5   2.9   42   33-74     29-71  (156)
 12 COG5510 Predicted small secret  52.8      13 0.00029   23.2   2.1   19    1-19      2-24  (44)
 13 COG4851 CamS Protein involved   51.2      13 0.00028   32.3   2.5   24    1-24      1-26  (382)
 14 PRK09810 entericidin A; Provis  50.3      15 0.00032   22.6   2.0   17    1-17      2-19  (41)
 15 PF06788 UPF0257:  Uncharacteri  49.7     8.8 0.00019   31.7   1.2   18    1-18      1-18  (236)
 16 PF14466 DUF4425:  Domain of un  49.1      11 0.00023   28.3   1.5   34    5-40      2-35  (121)
 17 PF08139 LPAM_1:  Prokaryotic m  47.0      16 0.00034   20.2   1.6   16    3-18      8-23  (25)
 18 PLN02727 NAD kinase             47.0      23 0.00049   34.8   3.6   44   50-93    232-282 (986)
 19 PF06291 Lambda_Bor:  Bor prote  46.0      15 0.00032   26.4   1.7   21   71-91     40-60  (97)
 20 PRK13791 lysozyme inhibitor; P  43.7      32 0.00069   25.2   3.3   19   65-83     80-98  (113)
 21 PRK13733 conjugal transfer pro  43.5      27 0.00058   27.6   3.0   27    1-27      1-29  (171)
 22 PRK10386 curli assembly protei  43.1      23 0.00051   26.7   2.5   41   55-95     65-105 (130)
 23 PF12276 DUF3617:  Protein of u  42.0      60  0.0013   23.8   4.6   38    1-40      1-38  (162)
 24 PRK11443 lipoprotein; Provisio  40.0      30 0.00065   25.7   2.7   18    1-19      1-18  (124)
 25 PRK10957 iron-enterobactin tra  38.6      32  0.0007   27.9   2.9   43    3-53      3-45  (317)
 26 PF02402 Lysis_col:  Lysis prot  38.1      21 0.00045   22.5   1.3   21    1-21      1-23  (46)
 27 PRK10053 hypothetical protein;  37.7      27 0.00058   26.3   2.1   15    1-15      1-15  (130)
 28 PRK13859 type IV secretion sys  35.6      38 0.00083   22.0   2.3   36    1-42      1-36  (55)
 29 PRK10564 maltose regulon perip  34.9      30 0.00065   29.6   2.2   22    1-22      2-23  (303)
 30 PRK15209 long polar fimbrial p  34.8      57  0.0012   24.5   3.6   11    1-11      1-11  (174)
 31 PF13926 DUF4211:  Domain of un  34.6      27 0.00059   26.0   1.7   19   23-41    116-138 (153)
 32 COG3065 Slp Starvation-inducib  32.9      35 0.00076   27.4   2.2   22    1-22      7-28  (191)
 33 PRK10081 entericidin B membran  32.5      37  0.0008   21.6   1.8   12    1-12      2-13  (48)
 34 TIGR02122 TRAP_TAXI TRAP trans  32.1      44 0.00096   26.5   2.7   14    1-14      1-14  (320)
 35 PRK15194 type-1 fimbrial prote  31.4      63  0.0014   24.6   3.3   13    1-13      1-13  (185)
 36 PF10627 CsgE:  Curli assembly   30.2      49  0.0011   23.9   2.4   39   55-93     42-80  (107)
 37 PRK15262 putative fimbrial pro  29.3      55  0.0012   25.6   2.7   17    1-19      6-22  (197)
 38 KOG0426|consensus               28.8      32 0.00069   26.6   1.3   17   46-62     59-75  (165)
 39 PRK12696 flgH flagellar basal   28.0      43 0.00092   27.5   1.9   18    1-18      1-18  (236)
 40 PRK15175 Vi polysaccharide exp  27.5      49  0.0011   28.6   2.4   74    1-79      1-87  (355)
 41 KOG4088|consensus               26.9      34 0.00073   26.7   1.1   13    5-17      3-15  (167)
 42 TIGR01165 cbiN cobalt transpor  26.8      53  0.0012   23.4   2.0   16    1-16      3-18  (91)
 43 TIGR03656 IsdC heme uptake pro  26.6 1.1E+02  0.0023   25.1   4.0   39    1-40      1-40  (217)
 44 PF12262 Lipase_bact_N:  Bacter  26.3      41 0.00088   28.1   1.6   19    1-19      1-20  (268)
 45 PRK15240 resistance to complem  26.0      50  0.0011   25.8   1.9   17    1-17      1-17  (185)
 46 PRK15346 outer membrane secret  25.2      62  0.0013   28.9   2.6   13    1-13      1-13  (499)
 47 PRK07718 fliL flagellar basal   24.7      58  0.0013   24.2   2.0   10    1-10      1-10  (142)
 48 PRK15187 fimbrial protein BcfA  24.7      58  0.0013   24.9   2.1   12    1-12      1-12  (180)
 49 PF03823 Neurokinin_B:  Neuroki  24.5      72  0.0016   21.1   2.1   33    1-40      1-34  (59)
 50 PF15240 Pro-rich:  Proline-ric  24.3      48   0.001   26.4   1.6   14    6-19      2-15  (179)
 51 PF10614 CsgF:  Type VIII secre  23.7      61  0.0013   24.8   2.0   17    1-17      1-17  (142)
 52 PF11839 DUF3359:  Protein of u  23.5      79  0.0017   22.7   2.4   22    1-22      1-23  (96)
 53 PRK02939 lipoprotein; Reviewed  22.9      47   0.001   27.5   1.3   17    1-17      1-17  (236)
 54 cd00195 UBCc Ubiquitin-conjuga  22.9      83  0.0018   22.7   2.5   24   32-62     46-69  (141)
 55 COG3689 Predicted membrane pro  22.9      71  0.0015   27.0   2.4   39   25-72    203-241 (271)
 56 PRK12407 flgH flagellar basal   22.7      67  0.0014   26.1   2.1   18    1-18      1-18  (221)
 57 PF13617 Lipoprotein_19:  YnbE-  21.3      76  0.0016   20.8   1.8   16    4-19      3-18  (59)
 58 PRK09934 fimbrial-like adhesin  21.0 1.5E+02  0.0032   22.4   3.6   15   33-48     48-62  (171)
 59 KOG2492|consensus               20.9      53  0.0012   29.9   1.3   47   33-100   325-371 (552)
 60 PF02315 MDH:  Methanol dehydro  20.9      34 0.00074   24.5   0.1   32    1-32      1-34  (93)

No 1  
>PF06468 Spond_N:  Spondin_N;  InterPro: IPR009465 This conserved region is found in the N-terminal half of several Spondin proteins []. Spondins are involved in patterning axonal growth trajectory through either inhibiting or promoting adhesion of embryonic nerve cells [].; PDB: 3D34_A 3Q13_A.
Probab=100.00  E-value=1.8e-37  Score=244.90  Aligned_cols=104  Identities=31%  Similarity=0.481  Sum_probs=78.9

Q ss_pred             ceEEEEEEEeeecCCCCCCCCCCCCCCCcceeeeecccCCcceeeecCCccCHHHHHHHhcCCchhhhc-cc-CCcceee
Q psy15313         31 LVFYRLTVYTFWSQQAFPKHFPDTRPVAQWTKLYGISHTENLTLFQVGRLADKSLQTFAELGKTEDFES-TL-NHSQVLS  108 (134)
Q Consensus        31 ~A~Y~vtf~g~Ws~~thPk~yP~~~~~~~~S~liGaSH~~~y~lw~~G~~AS~Gvr~~AE~G~~~~Le~-~~-~~~~v~~  108 (134)
                      +|+|+|||+|+||+++||||||.++|++|||+|||++|+++|+||++|+.||+|||+|||+|++..|++ ++ +.+.+++
T Consensus         1 ~A~Y~~~f~g~Ws~~~hpk~yP~~~~~~~fSpligasH~~~~~lf~~G~~AS~gle~lAE~G~~~~L~~e~~~~~~~~~~   80 (196)
T PF06468_consen    1 TATYEVTFEGIWSRNTHPKDYPSNRPPAHFSPLIGASHNSDYTLFEYGEPASEGLERLAEDGDPSGLEAEIGSAGGNVRT   80 (196)
T ss_dssp             EEEEEEEEEEE-STTTS-TT--CTSSCSEEEEEEEEEE-TT--S--TTS---HHHHHHHHH---HHHHHHHHHHHHHCCE
T ss_pred             CceEEEEEEEEECCccCcccccccccccccchhhhhhccCcccccccCCcccHHHHHHHhcCCHHHHHHHHhhcccccce
Confidence            699999999999999999999999999999999999999999999999999999999999999999999 77 4455677


Q ss_pred             EEEcC---CccCCCCcceEEEEEcCCCCC
Q psy15313        109 TFYAP---PIRKGVGLTSSSFFVNAEYSK  134 (134)
Q Consensus       109 ~~~a~---~i~~g~G~t~a~f~Vd~~H~l  134 (134)
                      +|++.   +++.+.|.++++|+||++||+
T Consensus        81 v~~~~~~~~~~~~~~~t~~~f~vd~~~~~  109 (196)
T PF06468_consen   81 VIKAFGAPGPPPGTGSTSATFTVDRNHHL  109 (196)
T ss_dssp             EEEEEEC--BTTTCEEEEEEEEEETTC-E
T ss_pred             eEeccCcccCCCCCCceeEEEEEcCCCCE
Confidence            77654   466788999999999999985


No 2  
>KOG3539|consensus
Probab=100.00  E-value=8.3e-38  Score=271.14  Aligned_cols=127  Identities=29%  Similarity=0.441  Sum_probs=113.4

Q ss_pred             HHHHHHHHhhCCCCCCCCCCCCcceEEEEEEEeeecCCCCCCCCCCCCCCCcceeeeecccCCcceeeecCCccCHHHHH
Q psy15313          8 LTISFILAAFGPVLSSAQCSPESLVFYRLTVYTFWSQQAFPKHFPDTRPVAQWTKLYGISHTENLTLFQVGRLADKSLQT   87 (134)
Q Consensus         8 ~~~~~~~~~~~p~~~d~~C~a~~~A~Y~vtf~g~Ws~~thPk~yP~~~~~~~~S~liGaSH~~~y~lw~~G~~AS~Gvr~   87 (134)
                      .++--+.++..|......||||++|+|+++|+|+||+++||||||.+||.+|||++||++|++||.||++|++||+|+|+
T Consensus       106 ~l~~~~~~a~~p~~~~~~C~a~~~AkY~~~f~g~WS~~t~PK~yP~~r~~t~~s~~lGasH~snys~w~~g~~at~G~rd  185 (508)
T KOG3539|consen  106 DLCETKVAAIAPQEKPQTCCACDPAKYSLVFTGKWSRETHPKDYPGKRPRTRFSDALGASHSSNYSLWDIGQIATAGLRD  185 (508)
T ss_pred             hhhhhhhhccCCCCCCCccccCChhheEEEEeeeecccCCccccCccchHHHHHHHhhhhcCCCcchhhcCcccchhhhh
Confidence            44456777777877766799999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhcCCchhhhc-cc-CCcceeeEEEc---CCccCCCCcceEEEEEcCCCCC
Q psy15313         88 FAELGKTEDFES-TL-NHSQVLSTFYA---PPIRKGVGLTSSSFFVNAEYSK  134 (134)
Q Consensus        88 ~AE~G~~~~Le~-~~-~~~~v~~~~~a---~~i~~g~G~t~a~f~Vd~~H~l  134 (134)
                      |||+|++..||. ++ ....++++|++   +.|++++|.|++.|+||++||+
T Consensus       186 ~AE~G~t~~le~e~~a~~s~~rsv~~~~~~~yvP~~~g~tsa~~~Vd~~H~l  237 (508)
T KOG3539|consen  186 FAESGSTMALESELKAPGSALRSVIKVFGLPYVPNVTGDTSAKFRVDSNHSL  237 (508)
T ss_pred             hhhcCcHHHHHHHHhCcchhhhHHHHhhcCccccCCCCCcceEEEecCCcce
Confidence            999999999999 87 45555666554   5556899999999999999996


No 3  
>PRK11372 lysozyme inhibitor; Provisional
Probab=84.38  E-value=1.6  Score=31.64  Aligned_cols=14  Identities=14%  Similarity=0.154  Sum_probs=11.0

Q ss_pred             CCcceeeecCCccC
Q psy15313         69 TENLTLFQVGRLAD   82 (134)
Q Consensus        69 ~~~y~lw~~G~~AS   82 (134)
                      +..|.+|..|+-|+
T Consensus        77 ~g~~~fWtKG~eA~   90 (109)
T PRK11372         77 DGIYVFWSKGDEAT   90 (109)
T ss_pred             CCcEEEEEeCCeEE
Confidence            35799999997764


No 4  
>PF11153 DUF2931:  Protein of unknown function (DUF2931);  InterPro: IPR021326  Some members in this family of proteins are annotated as lipoproteins however this cannot be confirmed. Currently, there is no known function. 
Probab=68.66  E-value=6  Score=31.13  Aligned_cols=44  Identities=25%  Similarity=0.376  Sum_probs=24.2

Q ss_pred             CchhhHHHHHHHHHHhhCCCCCCCCCCCCcceEEEEEEEeeecCCCCCCCCCCCC
Q psy15313          1 MKSTLLLLTISFILAAFGPVLSSAQCSPESLVFYRLTVYTFWSQQAFPKHFPDTR   55 (134)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~p~~~d~~C~a~~~A~Y~vtf~g~Ws~~thPk~yP~~~   55 (134)
                      ||. |++|++++++++|........=     ..|+-.|.-     ..|+.||.+.
T Consensus         1 mk~-i~~l~l~lll~~C~~~~~~~~~-----~~~~W~~~~-----~~P~~ypv~V   44 (216)
T PF11153_consen    1 MKK-ILLLLLLLLLTGCSTNPNEPLQ-----PYFEWRFGV-----AAPKHYPVWV   44 (216)
T ss_pred             ChH-HHHHHHHHHHHhhcCCCccCCC-----CCCccEEEE-----ecCCCCEEEE
Confidence            664 4455588888888776652100     223222222     4588888643


No 5  
>COG4314 NosL Predicted lipoprotein involved in nitrous oxide reduction [Energy production and conversion]
Probab=67.57  E-value=5.5  Score=31.41  Aligned_cols=31  Identities=23%  Similarity=0.042  Sum_probs=20.9

Q ss_pred             CchhhHHHHHHHHHHhhC-CCCC-----------CCCCCCCcc
Q psy15313          1 MKSTLLLLTISFILAAFG-PVLS-----------SAQCSPESL   31 (134)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~-p~~~-----------d~~C~a~~~   31 (134)
                      ||.+||++++..++.++| +..+           +..|..|+-
T Consensus         1 mkr~Lla~la~~~llAgC~~~ed~~~p~P~~i~~~s~g~ycgM   43 (176)
T COG4314           1 MKRTLLAILAVTALLAGCRQAEDGAPPLPRQITDRSMGHYCGM   43 (176)
T ss_pred             CchhHHHHHHHHHHHHhcchhhcCCCCCCccccccccccccce
Confidence            899998888777776644 3222           246888875


No 6  
>PRK10449 heat-inducible protein; Provisional
Probab=65.90  E-value=6.2  Score=29.38  Aligned_cols=21  Identities=24%  Similarity=0.335  Sum_probs=17.2

Q ss_pred             CchhhHHHHHHHHHHhhCCCC
Q psy15313          1 MKSTLLLLTISFILAAFGPVL   21 (134)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~p~~   21 (134)
                      ||+.++++++++++++|.+..
T Consensus         1 mk~~~~~~~~~~~l~~C~~~~   21 (140)
T PRK10449          1 MKKVVALVALSLLMAGCVSSG   21 (140)
T ss_pred             ChhHHHHHHHHHHHHHhcCCC
Confidence            998888888998888887643


No 7  
>PRK13792 lysozyme inhibitor; Provisional
Probab=60.18  E-value=6.5  Score=29.52  Aligned_cols=23  Identities=35%  Similarity=0.330  Sum_probs=16.2

Q ss_pred             CchhhHHHHHHHH--HHhhCCCCCC
Q psy15313          1 MKSTLLLLTISFI--LAAFGPVLSS   23 (134)
Q Consensus         1 ~~~~~~~~~~~~~--~~~~~p~~~d   23 (134)
                      ||..|++|++++.  +++|.-...+
T Consensus         1 mk~~l~~ll~~~~~lLsaCs~~~~~   25 (127)
T PRK13792          1 MKKALWLLLAAVPVVLVACGGSDDD   25 (127)
T ss_pred             ChhHHHHHHHHHHhheecccCCCCC
Confidence            9988887777766  6666655443


No 8  
>TIGR02747 TraV type IV conjugative transfer system lipoprotein TraV. The TraV protein is a component of conjugative type IV secretion systems. TraV is an outer membrane lipoprotein and is believed to interact with the secretin TraK. The alignment contains three conserved cysteines in the N-terminal half.
Probab=59.72  E-value=7.4  Score=29.91  Aligned_cols=31  Identities=19%  Similarity=0.148  Sum_probs=20.2

Q ss_pred             CchhhHHHHHHHHHHhhC--CCCCCCCCCCCcc
Q psy15313          1 MKSTLLLLTISFILAAFG--PVLSSAQCSPESL   31 (134)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~--p~~~d~~C~a~~~   31 (134)
                      ||-++|+++++.+++.+|  +..+|-.|.+-+.
T Consensus         1 m~~~~l~~~~~~alLtGCsag~~~~f~C~~~~~   33 (144)
T TIGR02747         1 MRIRFLLLIACVAFLTGCSAGCNSNFSCEGTGG   33 (144)
T ss_pred             CceeehhHHHHHHHhhcccCCCCCCccccCCCC
Confidence            787877766555547777  6666666765443


No 9  
>TIGR00752 slp outer membrane lipoprotein, Slp family. Slp superfamily members are present in the Gram-negative gamma proteobacteria Escherichia coli, which also contains a close paralog, Haemophilus influenzae and Pasteurella multocida and Vibrio cholera. The known members of the family to date share a motif LX[GA]C near the N-terminus, which is compatible with the possibility that the protein is modified into a lipoprotein with Cys as the new N-terminus. Slp from Escherichia coli is known to be a lipoprotein of the outer membrane and to be expressed in response to carbon starvation.
Probab=59.68  E-value=4.8  Score=31.88  Aligned_cols=22  Identities=23%  Similarity=0.146  Sum_probs=18.4

Q ss_pred             CchhhHHHHHHHHHHhhCCCCC
Q psy15313          1 MKSTLLLLTISFILAAFGPVLS   22 (134)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~p~~~   22 (134)
                      ||.++++++++++++.|..++.
T Consensus         2 ~~~~lll~~~~l~LsgCasvP~   23 (182)
T TIGR00752         2 GKKGLLFTALCFGLTGCIAPPK   23 (182)
T ss_pred             ceEEehHHHHHHHHhcccCCCh
Confidence            7888998888888888877775


No 10 
>PRK10002 outer membrane protein F; Provisional
Probab=56.95  E-value=7.8  Score=32.75  Aligned_cols=17  Identities=29%  Similarity=0.391  Sum_probs=12.7

Q ss_pred             CchhhHHHHHHHHHHhh
Q psy15313          1 MKSTLLLLTISFILAAF   17 (134)
Q Consensus         1 ~~~~~~~~~~~~~~~~~   17 (134)
                      ||++||.|++..++++.
T Consensus         2 mkktl~a~a~~a~~~a~   18 (362)
T PRK10002          2 MKRNILAVIVPALLVAG   18 (362)
T ss_pred             ccHhHHHHHHHHHHHhc
Confidence            99999988877654443


No 11 
>TIGR03511 GldH_lipo gliding motility-associated lipoprotein GldH. Members of this protein family are predicted lipoproteins, exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). Members include GldH, a protein linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Not all Bacteroidetes with members of this protein family may have gliding motility.
Probab=54.73  E-value=13  Score=28.52  Aligned_cols=42  Identities=17%  Similarity=0.169  Sum_probs=28.7

Q ss_pred             EEEEEEEeeecCCCCCC-CCCCCCCCCcceeeeecccCCccee
Q psy15313         33 FYRLTVYTFWSQQAFPK-HFPDTRPVAQWTKLYGISHTENLTL   74 (134)
Q Consensus        33 ~Y~vtf~g~Ws~~thPk-~yP~~~~~~~~S~liGaSH~~~y~l   74 (134)
                      .|+=+=...|.++.-++ ++|.-.......-.|+.=|+.+|-+
T Consensus        29 ~y~~~p~~~W~k~d~l~F~~~~~d~~~~y~l~l~lR~n~~Ypy   71 (156)
T TIGR03511        29 SYQSTPHGGWQKSDTLDFEIPITDYTASYRLFLLIRNDNRYPY   71 (156)
T ss_pred             EeeECCccCcCCCCcEEEEEeecCCCCcEEEEEEEEcCCCCcc
Confidence            45555566788888766 4554444556777788899988865


No 12 
>COG5510 Predicted small secreted protein [Function unknown]
Probab=52.85  E-value=13  Score=23.22  Aligned_cols=19  Identities=47%  Similarity=0.560  Sum_probs=11.4

Q ss_pred             Cchhh----HHHHHHHHHHhhCC
Q psy15313          1 MKSTL----LLLTISFILAAFGP   19 (134)
Q Consensus         1 ~~~~~----~~~~~~~~~~~~~p   19 (134)
                      ||.++    +++++|+++++|-.
T Consensus         2 mk~t~l~i~~vll~s~llaaCNT   24 (44)
T COG5510           2 MKKTILLIALVLLASTLLAACNT   24 (44)
T ss_pred             chHHHHHHHHHHHHHHHHHHhhh
Confidence            56643    45566677777633


No 13 
>COG4851 CamS Protein involved in sex pheromone biosynthesis [General function prediction only]
Probab=51.25  E-value=13  Score=32.32  Aligned_cols=24  Identities=29%  Similarity=0.405  Sum_probs=17.9

Q ss_pred             CchhhHHHHHH--HHHHhhCCCCCCC
Q psy15313          1 MKSTLLLLTIS--FILAAFGPVLSSA   24 (134)
Q Consensus         1 ~~~~~~~~~~~--~~~~~~~p~~~d~   24 (134)
                      ||.||.+++++  +++++|.|.-+|.
T Consensus         1 Mkktl~i~~ta~vliLs~C~~~~dd~   26 (382)
T COG4851           1 MKKTLGIAATASVLILSGCFPFVDDT   26 (382)
T ss_pred             CchhhhHHHHHHHHHHhhccCccCCc
Confidence            99998554444  7888898988763


No 14 
>PRK09810 entericidin A; Provisional
Probab=50.30  E-value=15  Score=22.61  Aligned_cols=17  Identities=24%  Similarity=0.469  Sum_probs=8.7

Q ss_pred             CchhhHHHHHH-HHHHhh
Q psy15313          1 MKSTLLLLTIS-FILAAF   17 (134)
Q Consensus         1 ~~~~~~~~~~~-~~~~~~   17 (134)
                      ||..+++++++ +++++|
T Consensus         2 Mkk~~~l~~~~~~~L~aC   19 (41)
T PRK09810          2 MKRLIVLVLLASTLLTGC   19 (41)
T ss_pred             hHHHHHHHHHHHHHHhhh
Confidence            66666555443 334444


No 15 
>PF06788 UPF0257:  Uncharacterised protein family (UPF0257);  InterPro: IPR010646 This is a group of proteins of unknown function.; GO: 0005886 plasma membrane
Probab=49.75  E-value=8.8  Score=31.67  Aligned_cols=18  Identities=50%  Similarity=0.752  Sum_probs=16.3

Q ss_pred             CchhhHHHHHHHHHHhhC
Q psy15313          1 MKSTLLLLTISFILAAFG   18 (134)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~   18 (134)
                      ||.+++++++++++++|-
T Consensus         1 ~k~~~~~~~la~~L~~cd   18 (236)
T PF06788_consen    1 MKKTLLLLALAILLAGCD   18 (236)
T ss_pred             CceeeHHHHHHHHhhhcc
Confidence            999999999999998884


No 16 
>PF14466 DUF4425:  Domain of unknown function (DUF4425) ; PDB: 2LGE_A 2LG7_A 3U6G_B 2LRG_A.
Probab=49.15  E-value=11  Score=28.33  Aligned_cols=34  Identities=15%  Similarity=0.219  Sum_probs=8.4

Q ss_pred             hHHHHHHHHHHhhCCCCCCCCCCCCcceEEEEEEEe
Q psy15313          5 LLLLTISFILAAFGPVLSSAQCSPESLVFYRLTVYT   40 (134)
Q Consensus         5 ~~~~~~~~~~~~~~p~~~d~~C~a~~~A~Y~vtf~g   40 (134)
                      +++++++++++.|.--+++ .- .-+.+.|+|+++=
T Consensus         2 ~~~l~~~l~~vsC~~dd~~-~~-~~~tg~ykIvveq   35 (121)
T PF14466_consen    2 IVALCAGLILVSCSKDDDQ-PG-TDKTGMYKIVVEQ   35 (121)
T ss_dssp             ---------------------S-T---BSEEEEEEE
T ss_pred             HHHHHhHhhEEeeccccCC-CC-cccceeEEEEEEe
Confidence            4667778888777543332 12 2568999999984


No 17 
>PF08139 LPAM_1:  Prokaryotic membrane lipoprotein lipid attachment site;  InterPro: IPR012640  In prokaryotes, membrane lipoproteins are synthesized with a precursor signal peptide, which is cleaved by a specific lipoprotein signal peptidase (signal peptidase II). The peptidase recognises a conserved sequence and cuts upstream of a cysteine residue to which a glyceride-fatty acid lipid is attached [,].  This lipid attachment site is found in homologues of the VirB proteins of type IV secretion systems (T4SS). Conjugal transfer across the cell envelope of Gram-negative bacteria is mediated by a supramolecular structure termed mating pair formation (Mpf) complex. Collectively, secretion pathways ancestrally related to bacterial conjugation systems are now known as T4SS. T4SS are involved in the delivery of effector molecules to eukaryotic target cells; each of these systems exports distinct DNA or protein substrates to effect a myriad of changes in host cell physiology during infection [].
Probab=46.97  E-value=16  Score=20.23  Aligned_cols=16  Identities=13%  Similarity=0.191  Sum_probs=7.7

Q ss_pred             hhhHHHHHHHHHHhhC
Q psy15313          3 STLLLLTISFILAAFG   18 (134)
Q Consensus         3 ~~~~~~~~~~~~~~~~   18 (134)
                      ++++++++.+.+.++|
T Consensus         8 Kkil~~l~a~~~LagC   23 (25)
T PF08139_consen    8 KKILFPLLALFMLAGC   23 (25)
T ss_pred             HHHHHHHHHHHHHhhc
Confidence            3455555555444443


No 18 
>PLN02727 NAD kinase
Probab=46.97  E-value=23  Score=34.83  Aligned_cols=44  Identities=18%  Similarity=0.345  Sum_probs=35.5

Q ss_pred             CCCCCCCCCcceee----e---ecccCCcceeeecCCccCHHHHHHHhcCC
Q psy15313         50 HFPDTRPVAQWTKL----Y---GISHTENLTLFQVGRLADKSLQTFAELGK   93 (134)
Q Consensus        50 ~yP~~~~~~~~S~l----i---GaSH~~~y~lw~~G~~AS~Gvr~~AE~G~   93 (134)
                      +||..--.+.|.++    +   -.+-++...+|+-||+.-+.++++|+.|=
T Consensus       232 ~~p~~~~~~n~~~v~~~~~~~~~~~~~~~~~~~rsgQpspe~la~LA~~Gf  282 (986)
T PLN02727        232 DYPCHTLFANWNPVYLSTSKEDIDSKESEAAFWRGGQVTEEGLKWLLEKGF  282 (986)
T ss_pred             CCCCcccccccceeeecccccccccccceeeEEEeCCCCHHHHHHHHHCCC
Confidence            67765556667766    2   46678899999999999999999999884


No 19 
>PF06291 Lambda_Bor:  Bor protein;  InterPro: IPR010438 This family consists of several Bacteriophage lambda Bor and Escherichia coli Iss proteins. Expression of bor significantly increases the survival of the E. coli host cell in animal serum. This property is a well known bacterial virulence determinant indeed, bor and its adjacent sequences are highly homologous to the iss serum resistance locus of the plasmid ColV2-K94, which confers virulence in animals. It has been suggested that lysogeny may generally have a role in bacterial survival in animal hosts, and perhaps in pathogenesis [].
Probab=46.02  E-value=15  Score=26.39  Aligned_cols=21  Identities=5%  Similarity=0.048  Sum_probs=16.2

Q ss_pred             cceeeecCCccCHHHHHHHhc
Q psy15313         71 NLTLFQVGRLADKSLQTFAEL   91 (134)
Q Consensus        71 ~y~lw~~G~~AS~Gvr~~AE~   91 (134)
                      .|-+|..|+...--.++++-.
T Consensus        40 ~ffi~Gl~q~~~vdaa~vCgg   60 (97)
T PF06291_consen   40 HFFISGLGQSKEVDAAQVCGG   60 (97)
T ss_pred             ceEEEecCCcccccHHHhcCC
Confidence            677899999877777778743


No 20 
>PRK13791 lysozyme inhibitor; Provisional
Probab=43.69  E-value=32  Score=25.23  Aligned_cols=19  Identities=21%  Similarity=0.401  Sum_probs=14.5

Q ss_pred             ecccCCcceeeecCCccCH
Q psy15313         65 GISHTENLTLFQVGRLADK   83 (134)
Q Consensus        65 GaSH~~~y~lw~~G~~AS~   83 (134)
                      +.+++..|.+|..|.-|+-
T Consensus        80 ~~~~~~~y~~WtKG~~A~L   98 (113)
T PRK13791         80 AINKNYTYKLYTKGKTAEL   98 (113)
T ss_pred             ccCCCceEEEEEcCCeEEE
Confidence            3445677999999998864


No 21 
>PRK13733 conjugal transfer protein TraV; Provisional
Probab=43.49  E-value=27  Score=27.62  Aligned_cols=27  Identities=19%  Similarity=0.215  Sum_probs=16.1

Q ss_pred             CchhhH-HHHHHHHHHhhCCCCC-CCCCC
Q psy15313          1 MKSTLL-LLTISFILAAFGPVLS-SAQCS   27 (134)
Q Consensus         1 ~~~~~~-~~~~~~~~~~~~p~~~-d~~C~   27 (134)
                      ||...+ +++++++++.+|.... |-+|.
T Consensus         1 MK~~~~li~l~~~LlL~GCAg~~s~f~C~   29 (171)
T PRK13733          1 MKQISLLIPLLGTLLLSGCAGTNSEFECN   29 (171)
T ss_pred             CchhhHHHHHHHHHHhccccCCCCCCCCC
Confidence            887554 4445556677777443 34676


No 22 
>PRK10386 curli assembly protein CsgE; Provisional
Probab=43.05  E-value=23  Score=26.73  Aligned_cols=41  Identities=12%  Similarity=0.229  Sum_probs=35.2

Q ss_pred             CCCCcceeeeecccCCcceeeecCCccCHHHHHHHhcCCch
Q psy15313         55 RPVAQWTKLYGISHTENLTLFQVGRLADKSLQTFAELGKTE   95 (134)
Q Consensus        55 ~~~~~~S~liGaSH~~~y~lw~~G~~AS~Gvr~~AE~G~~~   95 (134)
                      +|.++|+.+|..+|+..-..=..=++....+|+.||..=..
T Consensus        65 ~p~a~~GS~ItV~~n~~vIy~t~l~p~~~~lk~~A~~Ai~~  105 (130)
T PRK10386         65 RPSARWGSWITITVNQDVIYQTFLFPNKRDFEKTVVFALDQ  105 (130)
T ss_pred             EEcCCCCcEEEEEECCEEEEEEecCcchhHHHHHHHHHHHH
Confidence            47899999999999999877778899999999999876433


No 23 
>PF12276 DUF3617:  Protein of unknown function (DUF3617);  InterPro: IPR022061  This family of proteins is found in bacteria. Proteins in this family are typically between 155 and 179 amino acids in length. There is a single completely conserved residue C that may be functionally important. 
Probab=42.05  E-value=60  Score=23.83  Aligned_cols=38  Identities=26%  Similarity=0.210  Sum_probs=20.6

Q ss_pred             CchhhHHHHHHHHHHhhCCCCCCCCCCCCcceEEEEEEEe
Q psy15313          1 MKSTLLLLTISFILAAFGPVLSSAQCSPESLVFYRLTVYT   40 (134)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~p~~~d~~C~a~~~A~Y~vtf~g   40 (134)
                      ||++++++++.+++++..+......  .=..-.|+++.+.
T Consensus         1 M~~~~~~~~~~~~~~~~~~~~a~~~--~~kpGlWe~t~~~   38 (162)
T PF12276_consen    1 MKRRLLLALALALLALAAAAAAAAP--DIKPGLWEVTTTT   38 (162)
T ss_pred             CchHHHHHHHHHHHHhhcccccccC--CCCCcccEEEEEe
Confidence            8999888877776643322222111  1123456666665


No 24 
>PRK11443 lipoprotein; Provisional
Probab=40.02  E-value=30  Score=25.68  Aligned_cols=18  Identities=17%  Similarity=0.325  Sum_probs=10.1

Q ss_pred             CchhhHHHHHHHHHHhhCC
Q psy15313          1 MKSTLLLLTISFILAAFGP   19 (134)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~p   19 (134)
                      || .++++++.++|+.|..
T Consensus         1 Mk-~~~~~~~~~lLsgCa~   18 (124)
T PRK11443          1 MK-KFIAPLLALLLSGCQI   18 (124)
T ss_pred             Ch-HHHHHHHHHHHHhccC
Confidence            87 4445555555665554


No 25 
>PRK10957 iron-enterobactin transporter periplasmic binding protein; Provisional
Probab=38.59  E-value=32  Score=27.88  Aligned_cols=43  Identities=19%  Similarity=0.229  Sum_probs=25.8

Q ss_pred             hhhHHHHHHHHHHhhCCCCCCCCCCCCcceEEEEEEEeeecCCCCCCCCCC
Q psy15313          3 STLLLLTISFILAAFGPVLSSAQCSPESLVFYRLTVYTFWSQQAFPKHFPD   53 (134)
Q Consensus         3 ~~~~~~~~~~~~~~~~p~~~d~~C~a~~~A~Y~vtf~g~Ws~~thPk~yP~   53 (134)
                      +||-+|++++++++|.+...+       ++.|.+|++-.=-+.+.|+. |.
T Consensus         3 ~~~~~~~~~~~~~~~~~~~~~-------~~~~~~ti~d~~G~~~l~~~-p~   45 (317)
T PRK10957          3 YRLALLLLGLLLSGIAAAQAS-------AAGWPRTVTDSRGSVTLESK-PQ   45 (317)
T ss_pred             hhHHHHHHHHHHhccCCCccc-------ccCCCEEEEcCCcCEeccCC-Cc
Confidence            567677777777777654321       33466666654445567775 53


No 26 
>PF02402 Lysis_col:  Lysis protein;  InterPro: IPR003059 The DNA sequence of the entire colicin E2 operon has been determined []. The operon comprises the colicin activity gene (ceaB), the colicin immunity gene (ceiB) and the lysis gene (celB), which is essential for colicin release from producing cells []. A putative LexA binding site is located upstream from ceaB, and a rho-independent terminator structure is located downstream from celB []. Comparison of the amino acid sequences of colicin E2 and cloacin DF13 reveal extensive similarity. These colicins have different modes of action and recognise different cell surface receptors; the two major regions of heterology at the C terminus, and in the C-terminal end of the central region are thought to correspond to the catalytic and receptor-recognition domains, respectively [].  Sequence similarities between colicins E2, A and E1 [] are less striking. The colicin E2 (pyocin) immunity protein does not share similarity with either the colicin E3 or cloacin DF13 [] immunity proteins. By contrast, the lysis proteins of the ColE2, ColE1 and CloDF13 plasmids are almost identical except in the N-terminal regions, which themselves are similar to lipoprotein signal peptides []. Processing of the ColE2 prolysis protein to the mature form is prevented by globomycin, a specific inhibitor of the lipoprotein signal peptidase []. The mature ColE2 lysis protein is located in the cell envelope [].; GO: 0009405 pathogenesis, 0019835 cytolysis, 0019867 outer membrane
Probab=38.09  E-value=21  Score=22.49  Aligned_cols=21  Identities=24%  Similarity=0.362  Sum_probs=12.5

Q ss_pred             Cchhh--HHHHHHHHHHhhCCCC
Q psy15313          1 MKSTL--LLLTISFILAAFGPVL   21 (134)
Q Consensus         1 ~~~~~--~~~~~~~~~~~~~p~~   21 (134)
                      ||+.+  +.+++.+++++|+...
T Consensus         1 MkKi~~~~i~~~~~~L~aCQaN~   23 (46)
T PF02402_consen    1 MKKIIFIGIFLLTMLLAACQANY   23 (46)
T ss_pred             CcEEEEeHHHHHHHHHHHhhhcc
Confidence            78665  3344446677776543


No 27 
>PRK10053 hypothetical protein; Provisional
Probab=37.72  E-value=27  Score=26.27  Aligned_cols=15  Identities=20%  Similarity=0.313  Sum_probs=10.6

Q ss_pred             CchhhHHHHHHHHHH
Q psy15313          1 MKSTLLLLTISFILA   15 (134)
Q Consensus         1 ~~~~~~~~~~~~~~~   15 (134)
                      ||+.+|+++++++.+
T Consensus         1 MKK~~~~~~~~~~s~   15 (130)
T PRK10053          1 MKLQAIALASFLVMP   15 (130)
T ss_pred             CcHHHHHHHHHHHHH
Confidence            999887776665533


No 28 
>PRK13859 type IV secretion system lipoprotein VirB7; Provisional
Probab=35.65  E-value=38  Score=21.98  Aligned_cols=36  Identities=28%  Similarity=0.298  Sum_probs=20.9

Q ss_pred             CchhhHHHHHHHHHHhhCCCCCCCCCCCCcceEEEEEEEeee
Q psy15313          1 MKSTLLLLTISFILAAFGPVLSSAQCSPESLVFYRLTVYTFW   42 (134)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~p~~~d~~C~a~~~A~Y~vtf~g~W   42 (134)
                      ||+-||++++  .+++|+..+.-   -.|.-..|.+++ |.|
T Consensus         1 MKY~lL~l~l--~La~CqT~D~l---AtckGpiFpLNV-grW   36 (55)
T PRK13859          1 MKYCLLCLAL--ALAGCQTNDTL---ASCKGPIFPLNV-GRW   36 (55)
T ss_pred             CchhHHHHHH--HHHhccccCcc---ccccCCcccccc-ccc
Confidence            8887766654  56677765552   234445555554 344


No 29 
>PRK10564 maltose regulon periplasmic protein; Provisional
Probab=34.91  E-value=30  Score=29.63  Aligned_cols=22  Identities=45%  Similarity=0.452  Sum_probs=19.4

Q ss_pred             CchhhHHHHHHHHHHhhCCCCC
Q psy15313          1 MKSTLLLLTISFILAAFGPVLS   22 (134)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~p~~~   22 (134)
                      ||.+|+.+.|+.++.++.|...
T Consensus         2 mk~~~~~~~l~~~l~~~~~~~~   23 (303)
T PRK10564          2 MKKSLLALCLSAGLLASAPGIS   23 (303)
T ss_pred             chHHHHHHHHHHHHHhcccccc
Confidence            9999999999999999888754


No 30 
>PRK15209 long polar fimbrial protein LpfA; Provisional
Probab=34.80  E-value=57  Score=24.48  Aligned_cols=11  Identities=27%  Similarity=0.389  Sum_probs=7.5

Q ss_pred             CchhhHHHHHH
Q psy15313          1 MKSTLLLLTIS   11 (134)
Q Consensus         1 ~~~~~~~~~~~   11 (134)
                      ||+.++.+++.
T Consensus         1 Mkk~~~~~~~~   11 (174)
T PRK15209          1 MKKVVFALSAL   11 (174)
T ss_pred             CchHHHHHHHH
Confidence            89887655543


No 31 
>PF13926 DUF4211:  Domain of unknown function (DUF4211)
Probab=34.64  E-value=27  Score=26.05  Aligned_cols=19  Identities=11%  Similarity=0.259  Sum_probs=15.8

Q ss_pred             CCCCCCCcc----eEEEEEEEee
Q psy15313         23 SAQCSPESL----VFYRLTVYTF   41 (134)
Q Consensus        23 d~~C~a~~~----A~Y~vtf~g~   41 (134)
                      ...|.||+.    |+|.|.|.|.
T Consensus       116 ~~~C~AC~~~~~~a~~~i~l~G~  138 (153)
T PF13926_consen  116 GPSCDACNRSGHPATFRIRLSGK  138 (153)
T ss_pred             CCcCcccCCCCCCceEEEEeCCC
Confidence            357999997    5999999993


No 32 
>COG3065 Slp Starvation-inducible outer membrane lipoprotein [Cell envelope biogenesis, outer membrane]
Probab=32.87  E-value=35  Score=27.41  Aligned_cols=22  Identities=27%  Similarity=0.401  Sum_probs=18.0

Q ss_pred             CchhhHHHHHHHHHHhhCCCCC
Q psy15313          1 MKSTLLLLTISFILAAFGPVLS   22 (134)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~p~~~   22 (134)
                      ||.++|+.++||.+++|..++.
T Consensus         7 ~~~~~l~~~laflLsgC~tiPk   28 (191)
T COG3065           7 MKKGALIGTLAFLLSGCVTIPK   28 (191)
T ss_pred             hHHHHHHHHHHHHHhhcccCCh
Confidence            5677899999999999977665


No 33 
>PRK10081 entericidin B membrane lipoprotein; Provisional
Probab=32.48  E-value=37  Score=21.57  Aligned_cols=12  Identities=17%  Similarity=0.213  Sum_probs=5.9

Q ss_pred             CchhhHHHHHHH
Q psy15313          1 MKSTLLLLTISF   12 (134)
Q Consensus         1 ~~~~~~~~~~~~   12 (134)
                      ||.++.++++++
T Consensus         2 mKk~i~~i~~~l   13 (48)
T PRK10081          2 VKKTIAAIFSVL   13 (48)
T ss_pred             hHHHHHHHHHHH
Confidence            566554444433


No 34 
>TIGR02122 TRAP_TAXI TRAP transporter solute receptor, TAXI family. This family is one of at least three major families of extracytoplasmic solute receptor (ESR) for TRAP (Tripartite ATP-independent Periplasmic Transporter) transporters. The others are the DctP (TIGR00787) and SmoM (pfam03480) families. These transporters are secondary (driven by an ion gradient) but composed of three polypeptides, although in some species the 4-TM and 12-TM integral membrane proteins are fused. Substrates for this transporter family are not fully characterized but, besides C4 dicarboxylates, may include mannitol and other compounds.
Probab=32.06  E-value=44  Score=26.47  Aligned_cols=14  Identities=36%  Similarity=0.586  Sum_probs=9.4

Q ss_pred             CchhhHHHHHHHHH
Q psy15313          1 MKSTLLLLTISFIL   14 (134)
Q Consensus         1 ~~~~~~~~~~~~~~   14 (134)
                      ||+|++++.+++++
T Consensus         1 ~~~~~~~~~~~~~~   14 (320)
T TIGR02122         1 MKKRLFLLGAALAI   14 (320)
T ss_pred             CchHHHHHHHHHHH
Confidence            89999666555433


No 35 
>PRK15194 type-1 fimbrial protein subunit A; Provisional
Probab=31.42  E-value=63  Score=24.60  Aligned_cols=13  Identities=23%  Similarity=0.296  Sum_probs=8.5

Q ss_pred             CchhhHHHHHHHH
Q psy15313          1 MKSTLLLLTISFI   13 (134)
Q Consensus         1 ~~~~~~~~~~~~~   13 (134)
                      ||..++.++++++
T Consensus         1 mk~~~~~~~~~~~   13 (185)
T PRK15194          1 MKLRFISSAIASL   13 (185)
T ss_pred             CchHHHHHHHHHH
Confidence            8888876655533


No 36 
>PF10627 CsgE:  Curli assembly protein CsgE;  InterPro: IPR018900  Curli are a class highly aggregated surface fibres that are part of a complex extracellular matrix. They promote biofilm formation in addition to other activities. CsgE is a non-structural protein involved in curli biogenesis []. CsgE forms an outer membrane complex with the curli assembly proteins CsgG and CsgF []. 
Probab=30.16  E-value=49  Score=23.91  Aligned_cols=39  Identities=21%  Similarity=0.330  Sum_probs=33.5

Q ss_pred             CCCCcceeeeecccCCcceeeecCCccCHHHHHHHhcCC
Q psy15313         55 RPVAQWTKLYGISHTENLTLFQVGRLADKSLQTFAELGK   93 (134)
Q Consensus        55 ~~~~~~S~liGaSH~~~y~lw~~G~~AS~Gvr~~AE~G~   93 (134)
                      +|.++|+.+|-..|+..-.+=..=.+...-+++.||..=
T Consensus        42 ~ps~r~GS~I~V~~~~~~iy~t~l~P~~~~~~~~a~~Av   80 (107)
T PF10627_consen   42 RPSARWGSLITVEVNNKVIYQTFLSPRRRDLKEMAEQAV   80 (107)
T ss_pred             EECCCCCCEEEEEECCEEEEEEeeCccHHHHHHHHHHHH
Confidence            467889999999999998877788889999999998654


No 37 
>PRK15262 putative fimbrial protein StaF; Provisional
Probab=29.28  E-value=55  Score=25.64  Aligned_cols=17  Identities=29%  Similarity=0.643  Sum_probs=7.9

Q ss_pred             CchhhHHHHHHHHHHhhCC
Q psy15313          1 MKSTLLLLTISFILAAFGP   19 (134)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~p   19 (134)
                      ||+.+++  |.+.++.++|
T Consensus         6 ~~~~~~~--~~~~~~~~~~   22 (197)
T PRK15262          6 MKKIILF--LGLLFALTSP   22 (197)
T ss_pred             HHHHHHH--HHHHHHhccc
Confidence            5554433  3344444555


No 38 
>KOG0426|consensus
Probab=28.83  E-value=32  Score=26.57  Aligned_cols=17  Identities=29%  Similarity=0.653  Sum_probs=12.6

Q ss_pred             CCCCCCCCCCCCCccee
Q psy15313         46 AFPKHFPDTRPVAQWTK   62 (134)
Q Consensus        46 thPk~yP~~~~~~~~S~   62 (134)
                      .||+|||...|.-.|+.
T Consensus        59 ~FP~DYPLsPPkm~Ftc   75 (165)
T KOG0426|consen   59 SFPLDYPLSPPKMRFTC   75 (165)
T ss_pred             ecCCCCCCCCCceeeec
Confidence            69999999766555553


No 39 
>PRK12696 flgH flagellar basal body L-ring protein; Reviewed
Probab=27.96  E-value=43  Score=27.48  Aligned_cols=18  Identities=28%  Similarity=0.348  Sum_probs=13.9

Q ss_pred             CchhhHHHHHHHHHHhhC
Q psy15313          1 MKSTLLLLTISFILAAFG   18 (134)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~   18 (134)
                      |++++++++++++++++|
T Consensus         1 ~~~~~~~~~~~~~~l~gC   18 (236)
T PRK12696          1 MRKRLLATSLAVLLLAGC   18 (236)
T ss_pred             CcccHHHHHHHHHHHhcc
Confidence            888998888887766554


No 40 
>PRK15175 Vi polysaccharide export protein VexA; Provisional
Probab=27.53  E-value=49  Score=28.60  Aligned_cols=74  Identities=16%  Similarity=0.252  Sum_probs=42.1

Q ss_pred             CchhhHHHHHHHHHHhhCCCCCCC---CC---CCCcceEEEEEEEee------ecCCCCCCCCCCCCCCCcce-eeeecc
Q psy15313          1 MKSTLLLLTISFILAAFGPVLSSA---QC---SPESLVFYRLTVYTF------WSQQAFPKHFPDTRPVAQWT-KLYGIS   67 (134)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~p~~~d~---~C---~a~~~A~Y~vtf~g~------Ws~~thPk~yP~~~~~~~~S-~liGaS   67 (134)
                      ||+-++++++++++++|. ++.++   +-   ..-+-..|.|+=...      |=..-|...|+   . .++. ..||.=
T Consensus         1 ~~~~~~~~~~~~~~~~c~-~pr~~~~~ei~~~~~~~~~~~~v~~~~~~~~~~~~p~~g~~~~~~---~-~~~~~~~ig~G   75 (355)
T PRK15175          1 MKKIIILLTTFFLLSGCT-IPRAVFKSSLINQDDPRYNLVEVTPTLKLSAPDTVPKTIVDPVFA---A-NNWHWTSLAKG   75 (355)
T ss_pred             ChhHHHHHHHHHHHhhcC-CCCCcchhhhccccCCCeEEEEeehhhhhhhhhcCCcccCCcccc---c-CCCCCceECCC
Confidence            898888888888888887 43321   00   111335666653332      33323322233   2 4455 577777


Q ss_pred             cCCcceeeecCC
Q psy15313         68 HTENLTLFQVGR   79 (134)
Q Consensus        68 H~~~y~lw~~G~   79 (134)
                      ---+.++|+.++
T Consensus        76 DvL~ItVwe~~~   87 (355)
T PRK15175         76 DVLHITILSSGG   87 (355)
T ss_pred             CEEEEEEEecCC
Confidence            777788998753


No 41 
>KOG4088|consensus
Probab=26.86  E-value=34  Score=26.72  Aligned_cols=13  Identities=8%  Similarity=0.294  Sum_probs=9.2

Q ss_pred             hHHHHHHHHHHhh
Q psy15313          5 LLLLTISFILAAF   17 (134)
Q Consensus         5 ~~~~~~~~~~~~~   17 (134)
                      +++++||++.++|
T Consensus         3 ~~a~AlcLvas~C   15 (167)
T KOG4088|consen    3 KIAVALCLVASAC   15 (167)
T ss_pred             hhHHHHHHHHHHH
Confidence            3577778777775


No 42 
>TIGR01165 cbiN cobalt transport protein. This model describes the cobalt transporter in bacteria and its equivalents in archaea. It principally functions in the ion uptake mechanism. It is a multisubunit transporter with two integral membrane proteins and two closely associated cytoplasmic subunits. This transporter belongs to the ABC transporter superfamily (ATP stands for ATP Binding Cassette). This superfamily includes two groups, one which catalyze the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drive the both the process of uptake and efflux.
Probab=26.81  E-value=53  Score=23.45  Aligned_cols=16  Identities=38%  Similarity=0.420  Sum_probs=10.1

Q ss_pred             CchhhHHHHHHHHHHh
Q psy15313          1 MKSTLLLLTISFILAA   16 (134)
Q Consensus         1 ~~~~~~~~~~~~~~~~   16 (134)
                      ||..++|+++.++++.
T Consensus         3 ~~~~~~ll~~v~~l~~   18 (91)
T TIGR01165         3 MKKTIWLLAAVAALVV   18 (91)
T ss_pred             cchhHHHHHHHHHHHH
Confidence            7777776666655443


No 43 
>TIGR03656 IsdC heme uptake protein IsdC. Isd proteins are iron-regulated surface proteins found in Bacillus, Staphylococcus and Listeria species and are responsible for heme scavenging from hemoproteins. The IsdC protein consists of an N-terminal hydrophobic signal sequence, a central NEAT (NEAr Transporter, pfam05031) domain which confers the ability to bind heme and a C-terminal SrtB processing signal which targets the protein to the cell wall. IsdC is believed to make a direct contact with, and transfer heme to, the heme-binding component (IsdE) of an ABC transporter in the cytoplasmic membrane, and to receive heme from other NEAT-containing heme-binding proteins also localized in the cell wall.
Probab=26.58  E-value=1.1e+02  Score=25.09  Aligned_cols=39  Identities=10%  Similarity=0.034  Sum_probs=21.2

Q ss_pred             CchhhHH-HHHHHHHHhhCCCCCCCCCCCCcceEEEEEEEe
Q psy15313          1 MKSTLLL-LTISFILAAFGPVLSSAQCSPESLVFYRLTVYT   40 (134)
Q Consensus         1 ~~~~~~~-~~~~~~~~~~~p~~~d~~C~a~~~A~Y~vtf~g   40 (134)
                      ||..|.+ +++|++....+|... ..-..=..-+|+|.|.=
T Consensus         1 mk~~~~~~~~~~~~~f~~~~~~~-~~~~~L~DGtYsV~fkV   40 (217)
T TIGR03656         1 MKKILVFAFFTTILAFIILSAGF-SNSANLADGTYTINYTV   40 (217)
T ss_pred             CcchhhHHHHHHHHHHhcccccc-cccccccCceEEEEEEE
Confidence            8888855 335555555555443 11112222489999954


No 44 
>PF12262 Lipase_bact_N:  Bacterial virulence factor lipase N-terminal
Probab=26.33  E-value=41  Score=28.09  Aligned_cols=19  Identities=26%  Similarity=0.057  Sum_probs=12.3

Q ss_pred             CchhhHHHHHH-HHHHhhCC
Q psy15313          1 MKSTLLLLTIS-FILAAFGP   19 (134)
Q Consensus         1 ~~~~~~~~~~~-~~~~~~~p   19 (134)
                      ||+++|+++++ .+++++|-
T Consensus         1 Mkk~~l~~~l~sal~L~GCg   20 (268)
T PF12262_consen    1 MKKLLLSSALASALGLAGCG   20 (268)
T ss_pred             CchHHHHHHHHHHHHeeecC
Confidence            99999866665 33355554


No 45 
>PRK15240 resistance to complement killing; Provisional
Probab=26.02  E-value=50  Score=25.80  Aligned_cols=17  Identities=18%  Similarity=0.006  Sum_probs=10.8

Q ss_pred             CchhhHHHHHHHHHHhh
Q psy15313          1 MKSTLLLLTISFILAAF   17 (134)
Q Consensus         1 ~~~~~~~~~~~~~~~~~   17 (134)
                      ||+.++++++.+.++.+
T Consensus         1 Mkk~~~~~~~~~~~~~~   17 (185)
T PRK15240          1 MKKIVLSSLLLSAAGLA   17 (185)
T ss_pred             CchhHHHHHHHHHHHhc
Confidence            99999766554444333


No 46 
>PRK15346 outer membrane secretin SsaC; Provisional
Probab=25.19  E-value=62  Score=28.87  Aligned_cols=13  Identities=31%  Similarity=0.577  Sum_probs=10.0

Q ss_pred             CchhhHHHHHHHH
Q psy15313          1 MKSTLLLLTISFI   13 (134)
Q Consensus         1 ~~~~~~~~~~~~~   13 (134)
                      ||++++|++||++
T Consensus         1 ~~~~~~~~~~~~~   13 (499)
T PRK15346          1 MKKLLILIFLFLL   13 (499)
T ss_pred             CchhHHHHHHHHH
Confidence            8888887777754


No 47 
>PRK07718 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=24.73  E-value=58  Score=24.21  Aligned_cols=10  Identities=30%  Similarity=0.607  Sum_probs=7.1

Q ss_pred             CchhhHHHHH
Q psy15313          1 MKSTLLLLTI   10 (134)
Q Consensus         1 ~~~~~~~~~~   10 (134)
                      ||++++++++
T Consensus         1 ~kkkl~~i~~   10 (142)
T PRK07718          1 MKNKLIKIML   10 (142)
T ss_pred             CcchHHHHHH
Confidence            8899866543


No 48 
>PRK15187 fimbrial protein BcfA; Provisional
Probab=24.69  E-value=58  Score=24.92  Aligned_cols=12  Identities=42%  Similarity=0.520  Sum_probs=9.0

Q ss_pred             CchhhHHHHHHH
Q psy15313          1 MKSTLLLLTISF   12 (134)
Q Consensus         1 ~~~~~~~~~~~~   12 (134)
                      ||..+|+++++.
T Consensus         1 mk~~~~~~~~~~   12 (180)
T PRK15187          1 MKKPVLALMVSA   12 (180)
T ss_pred             CchhhHHHHHHH
Confidence            999987766663


No 49 
>PF03823 Neurokinin_B:  Neurokinin B;  InterPro: IPR003635 Tachykinins [, , ] are a group of biologically active peptides which excite neurons, evoke behavioral responses, are potent vasodilatators and contract (directly or indirectly) many smooth muscles. This family includes neurokinins, as well as many other peptides. Like other tachykinins, neurokinins are synthesized as larger protein precursors that are enzymatically converted to their mature forms.; GO: 0007217 tachykinin receptor signaling pathway
Probab=24.53  E-value=72  Score=21.05  Aligned_cols=33  Identities=21%  Similarity=0.022  Sum_probs=19.1

Q ss_pred             CchhhHHHHHHHHHHhhCCCCCCCCCC-CCcceEEEEEEEe
Q psy15313          1 MKSTLLLLTISFILAAFGPVLSSAQCS-PESLVFYRLTVYT   40 (134)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~p~~~d~~C~-a~~~A~Y~vtf~g   40 (134)
                      |+++||+.++-++..+-       .|- .|++-.=++..-|
T Consensus         1 MR~~lLf~aiLalsla~-------s~gavCeesQeQ~~p~g   34 (59)
T PF03823_consen    1 MRSTLLFAAILALSLAR-------SFGAVCEESQEQVVPGG   34 (59)
T ss_pred             ChhHHHHHHHHHHHHHH-------HhhhhhhhhhhccCCCC
Confidence            88888776654332221       132 5667666666666


No 50 
>PF15240 Pro-rich:  Proline-rich
Probab=24.30  E-value=48  Score=26.38  Aligned_cols=14  Identities=36%  Similarity=0.496  Sum_probs=8.5

Q ss_pred             HHHHHHHHHHhhCC
Q psy15313          6 LLLTISFILAAFGP   19 (134)
Q Consensus         6 ~~~~~~~~~~~~~p   19 (134)
                      |||||+++|+|...
T Consensus         2 LlVLLSvALLALSS   15 (179)
T PF15240_consen    2 LLVLLSVALLALSS   15 (179)
T ss_pred             hhHHHHHHHHHhhh
Confidence            66777766665543


No 51 
>PF10614 CsgF:  Type VIII secretion system (T8SS), CsgF protein;  InterPro: IPR018893  Fimbriae are cell-surface protein polymers, of e.g. Escherichia coli and Salmonella spp, that mediate interactions important for host and environmental persistence, development of biofilms, motility, colonisation and invasion of cells, and conjugation. Four general assembly pathways for different fimbriae have been proposed, one of which is extracellular nucleation-precipitation (ENP), that differs from the others in that fibre-growth occurs extracellularly. Thin aggregative fimbriae (Tafi) are the only fimbriae dependent on the ENP pathway. Tafi were first identified in Salmonella spp. and the controlling operon termed agf; however subsequent isolation of the homologous operon in E. coli led to its being called csg. Tafi are known as curli because, in the absence of extracellular polysaccharides, their morphology appears curled; however, when expressed with such polysaccharides their morphology appears as a tangled amorphous matrix []. CsgF is one of three putative curli assembly factors appearing to act as a nucleator protein. Unlike eukaryotic amyloid formation, curli biogenesis is a productive pathway requiring a specific assembly machinery []. 
Probab=23.69  E-value=61  Score=24.81  Aligned_cols=17  Identities=41%  Similarity=0.354  Sum_probs=12.1

Q ss_pred             CchhhHHHHHHHHHHhh
Q psy15313          1 MKSTLLLLTISFILAAF   17 (134)
Q Consensus         1 ~~~~~~~~~~~~~~~~~   17 (134)
                      ||+++|+.++.+++++.
T Consensus         1 mk~~~l~a~l~~~~~~~   17 (142)
T PF10614_consen    1 MKYRGLLALLLLLLAAS   17 (142)
T ss_pred             CcEeHHHHHHHHHHccc
Confidence            99999866666655544


No 52 
>PF11839 DUF3359:  Protein of unknown function (DUF3359);  InterPro: IPR021793  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are about 80 amino acids in length. 
Probab=23.52  E-value=79  Score=22.73  Aligned_cols=22  Identities=36%  Similarity=0.309  Sum_probs=14.8

Q ss_pred             CchhhH-HHHHHHHHHhhCCCCC
Q psy15313          1 MKSTLL-LLTISFILAAFGPVLS   22 (134)
Q Consensus         1 ~~~~~~-~~~~~~~~~~~~p~~~   22 (134)
                      ||..|+ .|.++++++.||....
T Consensus         1 M~k~l~sal~~~~~L~~GCAsts   23 (96)
T PF11839_consen    1 MKKLLLSALALAALLLAGCASTS   23 (96)
T ss_pred             CchHHHHHHHHHHHHHhHccCCc
Confidence            777774 4555677887877554


No 53 
>PRK02939 lipoprotein; Reviewed
Probab=22.95  E-value=47  Score=27.53  Aligned_cols=17  Identities=35%  Similarity=0.571  Sum_probs=15.1

Q ss_pred             CchhhHHHHHHHHHHhh
Q psy15313          1 MKSTLLLLTISFILAAF   17 (134)
Q Consensus         1 ~~~~~~~~~~~~~~~~~   17 (134)
                      ||..+++.+++++++.|
T Consensus         1 ~k~~~~~~~~~~~l~gc   17 (236)
T PRK02939          1 MKKKLLLTLLAILLTGC   17 (236)
T ss_pred             CceeehHHHHHHHHhcc
Confidence            89999999999988877


No 54 
>cd00195 UBCc Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain. This is part of the ubiquitin-mediated protein degradation pathway in which a thiol-ester linkage forms between a conserved cysteine and the C-terminus of ubiquitin and complexes with ubiquitin protein ligase enzymes, E3.  This pathway regulates many fundamental cellular processes.  There are also other E2s which form thiol-ester linkages without the use of E3s as well as several UBC homologs (TSG101, Mms2, Croc-1 and similar proteins) which lack the active site cysteine essential for ubiquitination and appear to function in DNA repair pathways which were omitted from the scope of this CD.
Probab=22.94  E-value=83  Score=22.73  Aligned_cols=24  Identities=21%  Similarity=0.659  Sum_probs=17.1

Q ss_pred             eEEEEEEEeeecCCCCCCCCCCCCCCCccee
Q psy15313         32 VFYRLTVYTFWSQQAFPKHFPDTRPVAQWTK   62 (134)
Q Consensus        32 A~Y~vtf~g~Ws~~thPk~yP~~~~~~~~S~   62 (134)
                      ..|++++       .+|++||...|.-.|..
T Consensus        46 ~~~~~~~-------~~p~~yP~~pP~v~f~~   69 (141)
T cd00195          46 GIFKLDI-------EFPEDYPFKPPKVRFVT   69 (141)
T ss_pred             CEEEEEE-------ECCCccCCCCCeEEEeC
Confidence            4566555       48999999877777753


No 55 
>COG3689 Predicted membrane protein [Function unknown]
Probab=22.86  E-value=71  Score=27.02  Aligned_cols=39  Identities=23%  Similarity=0.342  Sum_probs=28.2

Q ss_pred             CCCCCcceEEEEEEEeeecCCCCCCCCCCCCCCCcceeeeecccCCcc
Q psy15313         25 QCSPESLVFYRLTVYTFWSQQAFPKHFPDTRPVAQWTKLYGISHTENL   72 (134)
Q Consensus        25 ~C~a~~~A~Y~vtf~g~Ws~~thPk~yP~~~~~~~~S~liGaSH~~~y   72 (134)
                      .||+.|.-.|-++.++. ++..    ||    +.-|=.+=|.-++.-|
T Consensus       203 icC~ADa~vygl~v~~~-~~~~----y~----ndtWltvkGtl~~e~~  241 (271)
T COG3689         203 ICCAADAGVYGLLVELD-NQTD----YK----NDTWLTVKGTLSSEYL  241 (271)
T ss_pred             eeeeccceeEEEEEEcc-cccc----CC----CCceEEEEeEEEeeec
Confidence            59999999999999996 5544    44    2347777776665444


No 56 
>PRK12407 flgH flagellar basal body L-ring protein; Reviewed
Probab=22.67  E-value=67  Score=26.12  Aligned_cols=18  Identities=28%  Similarity=0.381  Sum_probs=11.9

Q ss_pred             CchhhHHHHHHHHHHhhC
Q psy15313          1 MKSTLLLLTISFILAAFG   18 (134)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~   18 (134)
                      ||..++++++.++++.|.
T Consensus         1 mk~~~~~~~~~l~l~gCa   18 (221)
T PRK12407          1 MKRFLILTALLLALCGCE   18 (221)
T ss_pred             ChhHHHHHHHHHHHhhcc
Confidence            877776666666665554


No 57 
>PF13617 Lipoprotein_19:  YnbE-like lipoprotein
Probab=21.33  E-value=76  Score=20.83  Aligned_cols=16  Identities=38%  Similarity=0.650  Sum_probs=9.1

Q ss_pred             hhHHHHHHHHHHhhCC
Q psy15313          4 TLLLLTISFILAAFGP   19 (134)
Q Consensus         4 ~~~~~~~~~~~~~~~p   19 (134)
                      .++++++++++++|.|
T Consensus         3 l~~~~~~~~~l~gCtP   18 (59)
T PF13617_consen    3 LLLLLALALALTGCTP   18 (59)
T ss_pred             hHHHHHHHHHHccCCC
Confidence            3455555566666654


No 58 
>PRK09934 fimbrial-like adhesin protein SfmF; Provisional
Probab=20.97  E-value=1.5e+02  Score=22.39  Aligned_cols=15  Identities=7%  Similarity=0.140  Sum_probs=7.5

Q ss_pred             EEEEEEEeeecCCCCC
Q psy15313         33 FYRLTVYTFWSQQAFP   48 (134)
Q Consensus        33 ~Y~vtf~g~Ws~~thP   48 (134)
                      ...|.+- .|+...+.
T Consensus        48 ~~~V~Lg-~v~~~~~~   62 (171)
T PRK09934         48 DKTVDLG-TWPTKQLL   62 (171)
T ss_pred             ceEEECC-cccHHHcc
Confidence            4455553 45555553


No 59 
>KOG2492|consensus
Probab=20.93  E-value=53  Score=29.92  Aligned_cols=47  Identities=21%  Similarity=0.317  Sum_probs=28.0

Q ss_pred             EEEEEEEeeecCCCCCCCCCCCCCCCcceeeeecccCCcceeeecCCccCHHHHHHHhcCCchhhhcc
Q psy15313         33 FYRLTVYTFWSQQAFPKHFPDTRPVAQWTKLYGISHTENLTLFQVGRLADKSLQTFAELGKTEDFEST  100 (134)
Q Consensus        33 ~Y~vtf~g~Ws~~thPk~yP~~~~~~~~S~liGaSH~~~y~lw~~G~~AS~Gvr~~AE~G~~~~Le~~  100 (134)
                      .-++-|+.     -||||||+        .++-..|+.+-.==+        ++.=|..|++..||.+
T Consensus       325 emR~RFTS-----PHPKDfpd--------evl~li~~rdnickq--------ihlPAqSgds~vLE~m  371 (552)
T KOG2492|consen  325 EMRIRFTS-----PHPKDFPD--------EVLELIRDRDNICKQ--------IHLPAQSGDSRVLEIM  371 (552)
T ss_pred             ceEEEecC-----CCCCCChH--------HHHHHHHhCcchhhe--------eeccccCCchHHHHHH
Confidence            35667776     89999995        444444443322211        1223567888888873


No 60 
>PF02315 MDH:  Methanol dehydrogenase beta subunit;  InterPro: IPR003420 Methanol dehydrogenase (MDH) (1.1.99.8 from EC), found in Gram-negative bacteria, is a pyrroloquinoline quinone (PQQ)-containing enzyme which oxidises methanol to formaldehyde. It is located in the periplasmic space and passes electrons derived from the oxidation of methanol to the soluble cytochrome cL []. The enzyme is a tetramer composed of two large alpha subunits and two smaller beta subunits. The alpha subunit binds the PQQ cofactor and contains the active site, while the function of the beta subunit is currently unknown []. The alpha subunit forms an eight-bladed propeller structure, with several novel tryptophan-docking motifs linking the individual blades together. This entry represents the beta subunit of methanol dehydrogenase.; GO: 0004022 alcohol dehydrogenase (NAD) activity, 0015946 methanol oxidation, 0055114 oxidation-reduction process; PDB: 1LRW_B 2D0V_J 2AD6_B 1G72_B 4AAH_D 2AD8_D 2AD7_D 1H4J_D 1H4I_B 1W6S_B ....
Probab=20.91  E-value=34  Score=24.48  Aligned_cols=32  Identities=25%  Similarity=0.348  Sum_probs=3.1

Q ss_pred             CchhhHHHHHHHHHHhhCC-CCCC-CCCCCCcce
Q psy15313          1 MKSTLLLLTISFILAAFGP-VLSS-AQCSPESLV   32 (134)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~p-~~~d-~~C~a~~~A   32 (134)
                      ||..+++.++.++++...+ +.-| ..|.+-+..
T Consensus         1 Mk~~~~~~~~~~~~~~a~~A~AYDGt~CkapG~C   34 (93)
T PF02315_consen    1 MKTVLLAAAAAAALATAGAALAYDGTNCKAPGNC   34 (93)
T ss_dssp             ------------------------S---SBTTB-
T ss_pred             ChhhHHHHHHHHHHhcchhhhhccCcccCCCccc
Confidence            8888876666655543332 2222 467765543


Done!