Diaphorina citri psyllid: psy15314


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--
MRGQILNLNQALKDGKSPVQLVQMPAVGSFQMFVDGYKDAEFWLRRFELEPLPAGLALSFQLQFERLVVGSFQMFVDGYKDAEFWLRRFDLEPLPAGLALSFQIQFERLVVLDYIIRNTDRGNDNWLIKYTQPDIQSNAPSGIERENEMQDATDWNVVDKADIRLAAIDNGLAFPFKHPDSWRAYPYHWAWLPQAKVPFSIETRDLVQPLLADMNFVQDLCNLTPVQIFCTY
ccccHHHHHHHHHcccccccccccccCEEEEcccccccHHHHHHHHccccccccccccccccccccccccccccccccccccHHHccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccccccccccccccHHHHHHHHcccccHHHHHHHHccccccccccc
*RGQ*L*LNQALKDGKSPVQLVQMPAVGSFQMFVDGYKDAEFWLRRFELEPLPAGL*****LQFERLVVGSFQMFVDGYKDAEFWLRRFDLEPLPAGLALSFQIQFERLVVLDYIIRNTDRGNDNWLIKYTQ***********************NVVDKADIRLAAIDNGLAFPFKHPDSWRAYPYHWAWLPQAKVPFSIETRDLVQPLLADMNFVQDLCNLTPVQIFCT*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRGQILNLNQALKDGKSPVQLVQMPAVGSFQMFVDGYKDAEFWLRRFELEPLPAGLALSFQLQFERLVVGSFQMFVDGYKDAEFWLRRFDLEPLPAGLALSFQIQFERLVVLDYIIRNTDRGNDNWLIKYTQPDIQSNAPSGIERENEMQDATDWNVVDKADIRLAAIDNGLAFPFKHPDSWRAYPYHWAWLPQAKVPFSIETRDLVQPLLADMNFVQDLCNLTPVQIFCTY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosphatidylinositol 4-kinase type 2-beta Plays a role in the phosphorylation of phosphatidylinositol (PI) in the first committed step in the production of the second messenger inositol 1,4,5,-trisphosphate (PIP). Involved in the regulation of vesicular membrane trafficking.confidentQ28G26
Phosphatidylinositol 4-kinase type 2-beta Together with PI4K2A and the type III PI4Ks (PIK4CA and PIK4CB) it contributes to the overall PI4-kinase activity of the cell. This contribution may be especially significant in plasma membrane, endosomal and Golgi compartments. The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3). Contributes to the production of InsP3 in stimulated cells and is likely to be involved in the regulation of vesicular trafficking.confidentQ8CBQ5
Phosphatidylinositol 4-kinase type 2-beta Together with PI4K2A and the type III PI4Ks (PIK4CA and PIK4CB) it contributes to the overall PI4-kinase activity of the cell. This contribution may be especially significant in plasma membrane, endosomal and Golgi compartments. The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3). Contributes to the production of InsP3 in stimulated cells and is likely to be involved in the regulation of vesicular trafficking.confidentQ8TCG2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0035838 [CC]growing cell tipprobableGO:0060187, GO:0051286, GO:0030427, GO:0044464, GO:0005623, GO:0005575
GO:0031901 [CC]early endosome membraneprobableGO:0005737, GO:0005575, GO:0043226, GO:0031090, GO:0043227, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005622, GO:0005768, GO:0005769, GO:0044422, GO:0010008
GO:0044231 [CC]host cell presynaptic membraneprobableGO:0018995, GO:0044221, GO:0044217, GO:0044216, GO:0044215, GO:0033643, GO:0044218, GO:0044279, GO:0043657, GO:0033644, GO:0072556, GO:0005575, GO:0005576, GO:0043245, GO:0044421
GO:0045121 [CC]membrane raftprobableGO:0005575, GO:0044425, GO:0016020
GO:0043204 [CC]perikaryonprobableGO:0044464, GO:0044297, GO:0005623, GO:0005575, GO:0097458, GO:0043025
GO:0031083 [CC]BLOC-1 complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044445, GO:0044424, GO:0031082
GO:0042734 [CC]presynaptic membraneprobableGO:0097060, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0044456, GO:0045202
GO:0035651 [MF]AP-3 adaptor complex bindingprobableGO:0032403, GO:0003674, GO:0005488, GO:0005515
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006644 [BP]phospholipid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0009987, GO:0044237, GO:0071704, GO:0006796, GO:0008150, GO:0008152, GO:0006793, GO:0019637, GO:0044255
GO:0030672 [CC]synaptic vesicle membraneprobableGO:0008021, GO:0043229, GO:0045202, GO:0030135, GO:0043226, GO:0030136, GO:0030665, GO:0005575, GO:0031090, GO:0030662, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0044456, GO:0005737, GO:0030659, GO:0012505, GO:0012506, GO:0031982, GO:0043227, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0004430 [MF]1-phosphatidylinositol 4-kinase activityprobableGO:0003824, GO:0052742, GO:0016772, GO:0016301, GO:0016773, GO:0016740, GO:0003674
GO:0070382 [CC]exocytic vesicleprobableGO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0030133, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3AKJ, chain A
Confidence level:probable
Coverage over the Query: 101-135,162-180
View the alignment between query and template
View the model in PyMOL