Diaphorina citri psyllid: psy15316


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-----
MSYVPIHKKIGVFKPKDEEPYGRLNPKWTKWMHKLCCPCCFGRACLIPNQGYLSEAGASLVDQKLGLNIVPKTKGYLSEAGASLVDQKLGLNIVPKTKEDKGFDRHLFEKQMSVMRGQILNLNQALKDGKSPVQLVQMPAVIVER
ccccccccEEEEEccccccccccccccHHHHHHHHccccccccccccccccHHHHHHHHHHHHHccccccccccEEEcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHccccEEEEc
*****IHKKIGVFKPKDEEPYGRLNPKWTKWMHKLCCPCCFGRACLIPNQGYLSEAGASLVDQKLGLNIVPKTKGYLSEAGASLVDQKLGLNIVPKTKEDKGFDRHLFEKQMSVMRGQILNLNQALKDGKSPVQLVQMPAVIVE*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYVPIHKKIGVFKPKDEEPYGRLNPKWTKWMHKLCCPCCFGRACLIPNQGYLSEAGASLVDQKLGLNIVPKTKGYLSEAGASLVDQKLGLNIVPKTKEDKGFDRHLFEKQMSVMRGQILNLNQALKDGKSPVQLVQMPAVIVER

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosphatidylinositol 4-kinase type 2-beta Plays a role in the phosphorylation of phosphatidylinositol (PI) in the first committed step in the production of the second messenger inositol 1,4,5,-trisphosphate (PIP). Involved in the regulation of vesicular membrane trafficking.confidentQ28G26
Phosphatidylinositol 4-kinase type 2-beta Contributes to the overall PI4-kinase activity of the cell. The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3).confidentQ49GP5
Phosphatidylinositol 4-kinase type 2-alpha Together with PI4K2B and the type III PI4Ks (PIK4CA and PIK4CB) it contributes to the overall PI4-kinase activity of the cell. The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3). Contributes to the production of InsP3 in stimulated cells.confidentQ2TBE6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0046854 [BP]phosphatidylinositol phosphorylationprobableGO:0044238, GO:0006644, GO:0006650, GO:0071704, GO:0016310, GO:0009987, GO:0044710, GO:0044237, GO:0046834, GO:0006796, GO:0046488, GO:0008152, GO:0006793, GO:0019637, GO:0008150, GO:0046486, GO:0030258, GO:0044255, GO:0006629
GO:0005770 [CC]late endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0005802 [CC]trans-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0032252 [BP]secretory granule localizationprobableGO:0009987, GO:0044763, GO:0051640, GO:0051648, GO:0008150, GO:0051179, GO:0044699, GO:0051641
GO:0035838 [CC]growing cell tipprobableGO:0060187, GO:0051286, GO:0030427, GO:0044464, GO:0005623, GO:0005575
GO:0031901 [CC]early endosome membraneprobableGO:0005737, GO:0005575, GO:0043226, GO:0031090, GO:0043227, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005622, GO:0005768, GO:0005769, GO:0044422, GO:0010008
GO:0032153 [CC]cell division siteprobableGO:0005575, GO:0044464, GO:0005623
GO:0044231 [CC]host cell presynaptic membraneprobableGO:0018995, GO:0044221, GO:0044217, GO:0044216, GO:0044215, GO:0033643, GO:0044218, GO:0044279, GO:0043657, GO:0033644, GO:0072556, GO:0005575, GO:0005576, GO:0043245, GO:0044421
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0045121 [CC]membrane raftprobableGO:0005575, GO:0044425, GO:0016020
GO:0043204 [CC]perikaryonprobableGO:0044464, GO:0044297, GO:0005623, GO:0005575, GO:0097458, GO:0043025
GO:0031083 [CC]BLOC-1 complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044445, GO:0044424, GO:0031082
GO:0042734 [CC]presynaptic membraneprobableGO:0097060, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0044456, GO:0045202
GO:0004430 [MF]1-phosphatidylinositol 4-kinase activityprobableGO:0003824, GO:0052742, GO:0016772, GO:0016301, GO:0016773, GO:0016740, GO:0003674
GO:0035651 [MF]AP-3 adaptor complex bindingprobableGO:0032403, GO:0003674, GO:0005488, GO:0005515
GO:0000329 [CC]fungal-type vacuole membraneprobableGO:0005737, GO:0005575, GO:0000324, GO:0000323, GO:0000322, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005774, GO:0044446, GO:0044444, GO:0044437, GO:0043231, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0030672 [CC]synaptic vesicle membraneprobableGO:0008021, GO:0043229, GO:0045202, GO:0030135, GO:0043226, GO:0030136, GO:0030665, GO:0005575, GO:0031090, GO:0030662, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0044456, GO:0005737, GO:0030659, GO:0012505, GO:0012506, GO:0031982, GO:0043227, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0040007 [BP]growthprobableGO:0008150
GO:0070382 [CC]exocytic vesicleprobableGO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0030133, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

No confident structure templates for the query are predicted