Query         psy15323
Match_columns 139
No_of_seqs    157 out of 826
Neff          6.3 
Searched_HMMs 46136
Date          Fri Aug 16 18:04:13 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15323.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15323hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd00202 ZnF_GATA Zinc finger D  99.6 2.5E-16 5.4E-21   99.8   3.2   41   64-104     1-42  (54)
  2 cd00202 ZnF_GATA Zinc finger D  99.5 2.7E-15 5.8E-20   95.0   1.3   43   10-52      1-44  (54)
  3 smart00401 ZnF_GATA zinc finge  99.5 1.1E-14 2.4E-19   91.5   3.3   43   62-104     3-47  (52)
  4 smart00401 ZnF_GATA zinc finge  99.5 9.3E-15   2E-19   91.9   2.7   45    7-51      2-48  (52)
  5 PF00320 GATA:  GATA zinc finge  99.4 2.6E-14 5.5E-19   83.5   1.6   35   65-99      1-36  (36)
  6 PF00320 GATA:  GATA zinc finge  99.4 3.7E-14   8E-19   82.8  -0.4   34   11-44      1-35  (36)
  7 COG5641 GAT1 GATA Zn-finger-co  99.3 2.2E-12 4.7E-17  112.4   4.3   97    8-104   158-341 (498)
  8 KOG1601|consensus               99.1 1.2E-10 2.5E-15   90.3   5.8   95    9-103   143-241 (340)
  9 COG5641 GAT1 GATA Zn-finger-co  98.8 3.7E-09   8E-14   92.4   2.4   53   62-124   158-216 (498)
 10 KOG1601|consensus               98.3 2.8E-07   6E-12   71.3   2.9   42    8-49    199-241 (340)
 11 TIGR01384 TFS_arch transcripti  91.0    0.23   5E-06   34.5   2.7   80   10-94      2-101 (104)
 12 PF08271 TF_Zn_Ribbon:  TFIIB z  89.7    0.22 4.8E-06   29.4   1.5   27   10-38      2-28  (43)
 13 PF06677 Auto_anti-p27:  Sjogre  89.3    0.31 6.7E-06   29.0   1.9   25    8-36     17-41  (41)
 14 KOG3554|consensus               88.2    0.32   7E-06   43.1   2.1   37   61-97    385-424 (693)
 15 PF11781 RRN7:  RNA polymerase   85.9    0.65 1.4E-05   26.8   1.9   32    2-37      2-33  (36)
 16 KOG3554|consensus               84.8    0.35 7.5E-06   42.9   0.5   40    4-43    382-424 (693)
 17 PF14803 Nudix_N_2:  Nudix N-te  81.0    0.88 1.9E-05   26.0   1.1   26    9-37      1-30  (34)
 18 smart00105 ArfGap Putative GTP  81.0    0.85 1.8E-05   32.3   1.2   39    7-46      2-40  (112)
 19 PRK14559 putative protein seri  80.8     1.6 3.5E-05   40.0   3.2   23    9-38      2-24  (645)
 20 COG5347 GTPase-activating prot  79.0     1.4   3E-05   37.1   2.1   39    6-45     18-56  (319)
 21 COG1645 Uncharacterized Zn-fin  78.1     1.3 2.9E-05   32.8   1.5   26    8-38     28-53  (131)
 22 PRK12286 rpmF 50S ribosomal pr  77.9     1.8   4E-05   27.4   1.9   28    4-39     23-50  (57)
 23 PF01412 ArfGap:  Putative GTPa  77.1     1.5 3.2E-05   31.2   1.5   39    5-44     10-48  (116)
 24 PF12773 DZR:  Double zinc ribb  75.3       3 6.4E-05   24.9   2.3   10   62-71     29-38  (50)
 25 PRK03564 formate dehydrogenase  74.9     3.2   7E-05   34.8   3.1   70    8-96    187-265 (309)
 26 KOG0703|consensus               74.8     1.8   4E-05   35.9   1.6   31    6-37     23-53  (287)
 27 PF04216 FdhE:  Protein involve  74.7    0.78 1.7E-05   37.5  -0.6   71    8-97    172-252 (290)
 28 PF13248 zf-ribbon_3:  zinc-rib  73.3       2 4.4E-05   22.7   1.1   22    9-37      3-24  (26)
 29 PRK00420 hypothetical protein;  72.5       3 6.5E-05   30.0   2.1   29    8-40     23-51  (112)
 30 TIGR01562 FdhE formate dehydro  72.2     3.5 7.7E-05   34.5   2.8   70    8-96    184-265 (305)
 31 PRK00423 tfb transcription ini  70.7     3.4 7.3E-05   34.2   2.3   34    3-38      6-39  (310)
 32 PLN03114 ADP-ribosylation fact  67.9       4 8.6E-05   35.2   2.2   40    6-46     20-59  (395)
 33 KOG0706|consensus               67.6     3.1 6.8E-05   36.5   1.6   40    6-46     21-60  (454)
 34 PF12760 Zn_Tnp_IS1595:  Transp  67.0     5.9 0.00013   23.5   2.3   30    6-37     16-45  (46)
 35 PF02318 FYVE_2:  FYVE-type zin  66.9     2.9 6.4E-05   29.8   1.1   50    7-91     53-102 (118)
 36 PRK03988 translation initiatio  66.9     2.3 5.1E-05   31.6   0.6   30   62-91    102-131 (138)
 37 smart00653 eIF2B_5 domain pres  65.7     3.1 6.7E-05   29.7   1.0   28   10-37     82-109 (110)
 38 smart00653 eIF2B_5 domain pres  65.5     2.7 5.8E-05   30.1   0.6   30   62-91     80-109 (110)
 39 TIGR00311 aIF-2beta translatio  64.5     2.9 6.2E-05   30.9   0.6   30   62-91     97-126 (133)
 40 PF09723 Zn-ribbon_8:  Zinc rib  64.1     3.6 7.7E-05   24.2   0.9   15   29-43      5-20  (42)
 41 smart00778 Prim_Zn_Ribbon Zinc  63.5     6.4 0.00014   22.8   1.9   29    9-37      4-33  (37)
 42 PRK14892 putative transcriptio  61.5     5.2 0.00011   28.1   1.5   35   61-95     20-54  (99)
 43 smart00105 ArfGap Putative GTP  60.2     4.4 9.6E-05   28.6   0.9   43   62-105     3-49  (112)
 44 smart00661 RPOL9 RNA polymeras  60.0     8.6 0.00019   22.9   2.1   30    9-41      1-32  (52)
 45 PF01873 eIF-5_eIF-2B:  Domain   57.2     5.9 0.00013   28.9   1.2   29   63-91     94-122 (125)
 46 PF01783 Ribosomal_L32p:  Ribos  56.1     6.8 0.00015   24.5   1.2   27    5-39     23-49  (56)
 47 PRK12336 translation initiatio  55.8     5.4 0.00012   31.2   0.9   30   10-39    100-129 (201)
 48 PF09297 zf-NADH-PPase:  NADH p  55.3     9.7 0.00021   20.8   1.6   28    8-38      3-30  (32)
 49 PF07754 DUF1610:  Domain of un  55.2     8.9 0.00019   20.2   1.4   24   11-37      1-24  (24)
 50 PF07282 OrfB_Zn_ribbon:  Putat  54.8     9.2  0.0002   24.2   1.7   29    7-38     27-55  (69)
 51 PLN03119 putative ADP-ribosyla  54.0     8.9 0.00019   35.0   2.0   34    5-39     20-53  (648)
 52 PRK14559 putative protein seri  53.9      12 0.00025   34.5   2.8   46    5-78     12-57  (645)
 53 COG3529 Predicted nucleic-acid  53.2     4.2 9.1E-05   26.4  -0.1   33   61-93      9-42  (66)
 54 PRK12336 translation initiatio  52.6     5.7 0.00012   31.1   0.5   30   62-91     98-127 (201)
 55 KOG3740|consensus               52.3     5.4 0.00012   36.6   0.4   34    6-39    460-497 (706)
 56 PLN03131 hypothetical protein;  51.4      10 0.00022   34.9   2.0   33    5-38     20-52  (705)
 57 PF01412 ArfGap:  Putative GTPa  51.3      15 0.00032   26.0   2.5   37   60-97     11-47  (116)
 58 smart00659 RPOLCX RNA polymera  51.2     9.9 0.00021   22.7   1.3   24   10-37      4-27  (44)
 59 PRK11827 hypothetical protein;  50.8      16 0.00034   23.5   2.2   33   10-45     10-43  (60)
 60 PF01363 FYVE:  FYVE zinc finge  50.2     6.2 0.00013   25.0   0.3   56    7-92      8-66  (69)
 61 KOG2907|consensus               50.1     7.8 0.00017   28.1   0.8   82    7-91      6-110 (116)
 62 PRK08351 DNA-directed RNA poly  49.2      11 0.00025   24.2   1.4   16    8-23     15-31  (61)
 63 TIGR02605 CxxC_CxxC_SSSS putat  48.5      10 0.00022   22.7   1.1   27   10-37      7-34  (52)
 64 PRK14890 putative Zn-ribbon RN  48.2      15 0.00033   23.6   1.9   31    5-38      4-34  (59)
 65 COG2888 Predicted Zn-ribbon RN  48.1      11 0.00023   24.4   1.1   27    8-37      9-35  (61)
 66 TIGR01031 rpmF_bact ribosomal   47.6      14 0.00031   23.0   1.7   28    4-39     22-49  (55)
 67 PF01096 TFIIS_C:  Transcriptio  47.3       9 0.00019   22.1   0.7   30   10-39      2-38  (39)
 68 smart00834 CxxC_CXXC_SSSS Puta  47.0      11 0.00023   21.3   0.9    8   30-37      6-13  (41)
 69 PF10058 DUF2296:  Predicted in  46.9      13 0.00029   23.1   1.5   30    8-37     22-52  (54)
 70 smart00440 ZnF_C2C2 C2C2 Zinc   46.5      13 0.00028   21.6   1.3   30   10-39      2-38  (40)
 71 PHA00626 hypothetical protein   45.2     9.9 0.00021   24.3   0.7   32   64-95      2-35  (59)
 72 PF13240 zinc_ribbon_2:  zinc-r  45.0      13 0.00028   19.1   1.0    6   11-16      2-7   (23)
 73 PF09526 DUF2387:  Probable met  44.4      15 0.00032   24.3   1.4   37    8-44      8-45  (71)
 74 KOG3740|consensus               44.0     8.8 0.00019   35.3   0.4   32   60-91    460-495 (706)
 75 PF03604 DNA_RNApol_7kD:  DNA d  43.6      20 0.00044   20.0   1.7   24   10-37      2-25  (32)
 76 PRK06393 rpoE DNA-directed RNA  43.5      16 0.00035   23.8   1.5   16    8-23     17-33  (64)
 77 PF04810 zf-Sec23_Sec24:  Sec23  43.2      17 0.00037   21.0   1.5   32    8-39      2-34  (40)
 78 COG1405 SUA7 Transcription ini  43.1      16 0.00034   30.3   1.7   29    9-39      2-30  (285)
 79 PF06689 zf-C4_ClpX:  ClpX C4-t  43.0     8.4 0.00018   22.5   0.1   29    9-37      2-32  (41)
 80 PF09538 FYDLN_acid:  Protein o  42.8      18 0.00038   25.8   1.7   31    5-39      6-36  (108)
 81 KOG1598|consensus               42.1      16 0.00035   32.8   1.7   28    9-38      1-28  (521)
 82 PRK14714 DNA polymerase II lar  42.1      23  0.0005   35.2   2.9   21    9-38    668-688 (1337)
 83 PF09526 DUF2387:  Probable met  41.2      15 0.00033   24.2   1.1   35   61-95      7-42  (71)
 84 PRK00432 30S ribosomal protein  40.6      21 0.00045   21.9   1.6   26    8-37     20-45  (50)
 85 PRK11823 DNA repair protein Ra  39.7      17 0.00038   31.6   1.6   29    8-43      7-35  (446)
 86 TIGR02443 conserved hypothetic  38.6      20 0.00043   23.0   1.3   34    8-41      9-43  (59)
 87 cd01121 Sms Sms (bacterial rad  37.9      21 0.00045   30.5   1.7   27   10-43      2-28  (372)
 88 PRK00423 tfb transcription ini  37.9      17 0.00038   30.0   1.3   17   62-78     30-53  (310)
 89 PRK01110 rpmF 50S ribosomal pr  37.0      21 0.00046   22.7   1.3   26    5-39     24-49  (60)
 90 PF08273 Prim_Zn_Ribbon:  Zinc-  36.9      30 0.00065   20.3   1.8   26   10-35      5-32  (40)
 91 smart00064 FYVE Protein presen  35.7      47   0.001   20.7   2.8   28   64-91     36-64  (68)
 92 TIGR00416 sms DNA repair prote  34.6      23 0.00051   30.9   1.6   29    8-43      7-35  (454)
 93 COG5347 GTPase-activating prot  33.6      28  0.0006   29.4   1.8   35   59-94     17-51  (319)
 94 COG1405 SUA7 Transcription ini  33.4      20 0.00042   29.7   0.8   26   64-91      3-28  (285)
 95 PRK04023 DNA polymerase II lar  33.1      37 0.00079   33.2   2.6   42   28-90    625-670 (1121)
 96 COG2835 Uncharacterized conser  32.9      33 0.00072   22.1   1.7   32   14-45     11-43  (60)
 97 KOG1729|consensus               32.2      19 0.00041   29.9   0.6   26    7-37    167-193 (288)
 98 KOG1598|consensus               32.1      26 0.00056   31.5   1.4   26   64-91      2-27  (521)
 99 KOG0706|consensus               30.1      28 0.00061   30.7   1.3   41   58-99     19-59  (454)
100 PRK00085 recO DNA repair prote  29.7      40 0.00087   26.3   2.1   31    6-36    147-177 (247)
101 COG2816 NPY1 NTP pyrophosphohy  29.6      33 0.00071   28.5   1.6   28    8-38    111-138 (279)
102 PF08792 A2L_zn_ribbon:  A2L zi  29.5      56  0.0012   18.3   2.1   28    8-38      3-30  (33)
103 PF15396 FAM60A:  Protein Famil  29.2      27 0.00059   27.9   1.0   16   84-99     50-65  (213)
104 cd06955 NR_DBD_VDR DNA-binding  28.9      50  0.0011   23.4   2.2   33    7-43      5-37  (107)
105 COG1594 RPB9 DNA-directed RNA   28.8      26 0.00056   25.0   0.8   32   63-94     73-111 (113)
106 COG5525 Bacteriophage tail ass  28.6      39 0.00085   31.0   2.0   60   30-102   228-289 (611)
107 PF08274 PhnA_Zn_Ribbon:  PhnA   28.3      26 0.00056   19.4   0.5   25    9-37      3-27  (30)
108 TIGR02300 FYDLN_acid conserved  27.8      43 0.00094   24.7   1.8   32    4-39      5-36  (129)
109 PF02701 zf-Dof:  Dof domain, z  27.6      70  0.0015   20.8   2.5   41   62-102     5-49  (63)
110 PF04981 NMD3:  NMD3 family ;    27.3      51  0.0011   26.1   2.3   52   11-79      1-53  (236)
111 PRK11788 tetratricopeptide rep  27.0      54  0.0012   26.5   2.4   20   63-82    369-388 (389)
112 PHA02942 putative transposase;  26.4      50  0.0011   28.2   2.2   28    7-38    324-351 (383)
113 PF01258 zf-dskA_traR:  Prokary  26.3     8.1 0.00018   21.7  -1.8   28    9-36      4-31  (36)
114 PRK00398 rpoP DNA-directed RNA  25.9      52  0.0011   19.2   1.6   26   10-38      5-30  (46)
115 TIGR00613 reco DNA repair prot  25.8      56  0.0012   25.3   2.2   32    6-37    145-176 (241)
116 PF04161 Arv1:  Arv1-like famil  25.8      34 0.00075   26.6   1.0   29   10-38      2-33  (208)
117 cd02337 ZZ_CBP Zinc finger, ZZ  25.5      41 0.00089   19.6   1.1   29   10-38      2-31  (41)
118 COG3183 Predicted restriction   25.4      21 0.00046   29.4  -0.2   41   30-70    196-249 (272)
119 KOG0703|consensus               25.3      36 0.00079   28.4   1.1   29   61-90     24-52  (287)
120 PF10571 UPF0547:  Uncharacteri  25.1      58  0.0013   17.2   1.5    8   30-37     15-22  (26)
121 PRK12495 hypothetical protein;  24.6      40 0.00087   27.2   1.2   31    5-40     39-69  (226)
122 cd07169 NR_DBD_GCNF_like DNA-b  24.2      39 0.00085   23.0   0.9   34    5-42      3-36  (90)
123 TIGR03573 WbuX N-acetyl sugar   23.8      48   0.001   27.7   1.6   32    9-41      2-33  (343)
124 COG4888 Uncharacterized Zn rib  23.6      36 0.00077   24.2   0.6   30   64-93     24-56  (104)
125 PF03811 Zn_Tnp_IS1:  InsA N-te  23.5      55  0.0012   18.7   1.3   28   61-89      4-35  (36)
126 smart00531 TFIIE Transcription  23.4      36 0.00078   25.0   0.7    8   30-37    100-107 (147)
127 cd06966 NR_DBD_CAR DNA-binding  23.3      52  0.0011   22.6   1.4   31    9-43      1-31  (94)
128 cd06964 NR_DBD_RAR DNA-binding  23.2      67  0.0015   21.6   1.9   32    7-42      3-34  (85)
129 PF13695 zf-3CxxC:  Zinc-bindin  23.0      34 0.00074   23.5   0.4   18   60-77     36-53  (98)
130 TIGR00100 hypA hydrogenase nic  22.9      40 0.00086   23.9   0.8    8   30-37     71-78  (115)
131 COG1499 NMD3 NMD protein affec  22.9      50  0.0011   28.3   1.5   62    5-83      3-65  (355)
132 PF07191 zinc-ribbons_6:  zinc-  22.9      42 0.00092   22.2   0.9   55   10-90      3-57  (70)
133 cd07168 NR_DBD_DHR4_like DNA-b  21.6      60  0.0013   22.0   1.5   32   62-97      6-37  (90)
134 COG0675 Transposase and inacti  21.5      63  0.0014   25.5   1.8   25    6-38    307-331 (364)
135 COG0333 RpmF Ribosomal protein  21.2      69  0.0015   20.3   1.5   26    6-39     25-50  (57)
136 PF01286 XPA_N:  XPA protein N-  20.5      47   0.001   18.9   0.6   29    8-36      3-31  (34)
137 PF00569 ZZ:  Zinc finger, ZZ t  20.3      77  0.0017   18.6   1.6   31   62-92      4-37  (46)
138 PLN03114 ADP-ribosylation fact  20.3      65  0.0014   27.9   1.7   38   60-98     20-57  (395)
139 cd07173 NR_DBD_AR DNA-binding   20.1      49  0.0011   22.2   0.8   32    7-42      2-33  (82)

No 1  
>cd00202 ZnF_GATA Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C
Probab=99.62  E-value=2.5e-16  Score=99.81  Aligned_cols=41  Identities=59%  Similarity=1.237  Sum_probs=37.7

Q ss_pred             ccccCCCCCCcceecCCCC-CcccchhhhhHHhhCCCCCchh
Q psy15323         64 CCTNCGTRMTTLWRRNNDG-EPVCNACGLYYKLHNVNRPLAM  104 (139)
Q Consensus        64 ~C~~C~t~~t~~Wr~~~~g-~~lCnaCgly~~~~~~~Rp~~~  104 (139)
                      +|+||++++||+||+++++ .+|||||||||++++..||++.
T Consensus         1 ~C~~C~~~~Tp~WR~g~~~~~~LCNaCgl~~~k~~~~rp~~~   42 (54)
T cd00202           1 ACSNCGTTTTPLWRRGPSGGSTLCNACGLYWKKHGVMRPLSK   42 (54)
T ss_pred             CCCCCCCCCCcccccCCCCcchHHHHHHHHHHhcCCCCCccc
Confidence            5999999999999999955 5999999999999999999953


No 2  
>cd00202 ZnF_GATA Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C
Probab=99.52  E-value=2.7e-15  Score=95.05  Aligned_cols=43  Identities=58%  Similarity=1.189  Sum_probs=39.6

Q ss_pred             ccccCCCCCCCceeecCC-CCcccccccccccccCCCCCCCCCc
Q psy15323         10 ECVNCGAISTPLWRRDGT-GHYLCNACGLYHKMNGMNRPLVKPS   52 (139)
Q Consensus        10 ~C~nC~~~~tp~WRr~~~-g~~lCnaCgly~k~hg~nRP~~kps   52 (139)
                      +|+||++++||+||++++ +.+||||||||+++++..||.....
T Consensus         1 ~C~~C~~~~Tp~WR~g~~~~~~LCNaCgl~~~k~~~~rp~~~~~   44 (54)
T cd00202           1 ACSNCGTTTTPLWRRGPSGGSTLCNACGLYWKKHGVMRPLSKRK   44 (54)
T ss_pred             CCCCCCCCCCcccccCCCCcchHHHHHHHHHHhcCCCCCcccCc
Confidence            599999999999999995 4899999999999999999998765


No 3  
>smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG].
Probab=99.51  E-value=1.1e-14  Score=91.52  Aligned_cols=43  Identities=58%  Similarity=1.208  Sum_probs=39.6

Q ss_pred             CcccccCCCCCCcceecCCCCC-cccchhhhhHHhhCCC-CCchh
Q psy15323         62 GLCCTNCGTRMTTLWRRNNDGE-PVCNACGLYYKLHNVN-RPLAM  104 (139)
Q Consensus        62 ~~~C~~C~t~~t~~Wr~~~~g~-~lCnaCgly~~~~~~~-Rp~~~  104 (139)
                      ...|+||++++||+||+++.|. .|||||||||++++.. ||.++
T Consensus         3 ~~~C~~C~~~~T~~WR~g~~g~~~LCnaCgl~~~k~~~~~rp~~~   47 (52)
T smart00401        3 GRSCSNCGTTETPLWRRGPSGNKTLCNACGLYYKKHGGLKRPLSL   47 (52)
T ss_pred             CCCcCCCCCCCCCccccCCCCCCcEeecccHHHHHcCCCCCcccc
Confidence            4689999999999999999997 9999999999999998 99853


No 4  
>smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG].
Probab=99.50  E-value=9.3e-15  Score=91.85  Aligned_cols=45  Identities=58%  Similarity=1.132  Sum_probs=40.2

Q ss_pred             CCCccccCCCCCCCceeecCCCC-cccccccccccccCCC-CCCCCC
Q psy15323          7 EGRECVNCGAISTPLWRRDGTGH-YLCNACGLYHKMNGMN-RPLVKP   51 (139)
Q Consensus         7 ~~~~C~nC~~~~tp~WRr~~~g~-~lCnaCgly~k~hg~n-RP~~kp   51 (139)
                      ....|+||++++||+||+++.|. +||||||||++.++.. +|....
T Consensus         2 ~~~~C~~C~~~~T~~WR~g~~g~~~LCnaCgl~~~k~~~~~rp~~~~   48 (52)
T smart00401        2 SGRSCSNCGTTETPLWRRGPSGNKTLCNACGLYYKKHGGLKRPLSLK   48 (52)
T ss_pred             CCCCcCCCCCCCCCccccCCCCCCcEeecccHHHHHcCCCCCccccc
Confidence            46799999999999999999995 9999999999999887 777654


No 5  
>PF00320 GATA:  GATA zinc finger;  InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents GATA-type zinc fingers (Znf). A number of transcription factors (including erythroid-specific transcription factor and nitrogen regulatory proteins), specifically bind the DNA sequence (A/T)GATA(A/G) [] in the regulatory regions of genes. They are consequently termed GATA-binding transcription factors. The interactions occur via highly-conserved Znf domains in which the zinc ion is coordinated by 4 cysteine residues [, ]. NMR studies have shown the core of the Znf to comprise 2 irregular anti-parallel beta-sheets and an alpha-helix, followed by a long loop to the C-terminal end of the finger. The N-terminal part, which includes the helix, is similar in structure, but not sequence, to the N-terminal zinc module of the glucocorticoid receptor DNA-binding domain. The helix and the loop connecting the 2 beta-sheets interact with the major groove of the DNA, while the C-terminal tail wraps around into the minor groove. It is this tail that is the essential determinant of specific binding. Interactions between the Znf and DNA are mainly hydrophobic, explaining the preponderance of thymines in the binding site; a large number of interactions with the phosphate backbone have also been observed []. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contains a single copy of the domain. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 3GAT_A 2GAT_A 1GAU_A 1GAT_A 1Y0J_A 1GNF_A 2L6Z_A 2L6Y_A 3DFV_D 3DFX_B ....
Probab=99.45  E-value=2.6e-14  Score=83.50  Aligned_cols=35  Identities=54%  Similarity=1.158  Sum_probs=27.7

Q ss_pred             cccCCCCCCcceecCCCCC-cccchhhhhHHhhCCC
Q psy15323         65 CTNCGTRMTTLWRRNNDGE-PVCNACGLYYKLHNVN   99 (139)
Q Consensus        65 C~~C~t~~t~~Wr~~~~g~-~lCnaCgly~~~~~~~   99 (139)
                      |++|+|++||+||++++|. +|||+|||||++|+++
T Consensus         1 C~~C~tt~t~~WR~~~~g~~~LCn~Cg~~~kk~~~~   36 (36)
T PF00320_consen    1 CSNCGTTETPQWRRGPNGNRTLCNACGLYYKKYGKM   36 (36)
T ss_dssp             -TTT--ST-SSEEEETTSEE-EEHHHHHHHHHHSS-
T ss_pred             CcCCcCCCCchhhcCCCCCCHHHHHHHHHHHHhCCC
Confidence            8999999999999999998 5999999999998863


No 6  
>PF00320 GATA:  GATA zinc finger;  InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents GATA-type zinc fingers (Znf). A number of transcription factors (including erythroid-specific transcription factor and nitrogen regulatory proteins), specifically bind the DNA sequence (A/T)GATA(A/G) [] in the regulatory regions of genes. They are consequently termed GATA-binding transcription factors. The interactions occur via highly-conserved Znf domains in which the zinc ion is coordinated by 4 cysteine residues [, ]. NMR studies have shown the core of the Znf to comprise 2 irregular anti-parallel beta-sheets and an alpha-helix, followed by a long loop to the C-terminal end of the finger. The N-terminal part, which includes the helix, is similar in structure, but not sequence, to the N-terminal zinc module of the glucocorticoid receptor DNA-binding domain. The helix and the loop connecting the 2 beta-sheets interact with the major groove of the DNA, while the C-terminal tail wraps around into the minor groove. It is this tail that is the essential determinant of specific binding. Interactions between the Znf and DNA are mainly hydrophobic, explaining the preponderance of thymines in the binding site; a large number of interactions with the phosphate backbone have also been observed []. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contains a single copy of the domain. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 3GAT_A 2GAT_A 1GAU_A 1GAT_A 1Y0J_A 1GNF_A 2L6Z_A 2L6Y_A 3DFV_D 3DFX_B ....
Probab=99.39  E-value=3.7e-14  Score=82.82  Aligned_cols=34  Identities=59%  Similarity=1.221  Sum_probs=27.4

Q ss_pred             cccCCCCCCCceeecCCCCc-ccccccccccccCC
Q psy15323         11 CVNCGAISTPLWRRDGTGHY-LCNACGLYHKMNGM   44 (139)
Q Consensus        11 C~nC~~~~tp~WRr~~~g~~-lCnaCgly~k~hg~   44 (139)
                      |+||++++||+||++++|.. ||||||+|+++++.
T Consensus         1 C~~C~tt~t~~WR~~~~g~~~LCn~Cg~~~kk~~~   35 (36)
T PF00320_consen    1 CSNCGTTETPQWRRGPNGNRTLCNACGLYYKKYGK   35 (36)
T ss_dssp             -TTT--ST-SSEEEETTSEE-EEHHHHHHHHHHSS
T ss_pred             CcCCcCCCCchhhcCCCCCCHHHHHHHHHHHHhCC
Confidence            89999999999999999965 99999999988764


No 7  
>COG5641 GAT1 GATA Zn-finger-containing transcription factor [Transcription]
Probab=99.29  E-value=2.2e-12  Score=112.42  Aligned_cols=97  Identities=42%  Similarity=0.718  Sum_probs=75.4

Q ss_pred             CCccccCCCCCCCceeecCC-----CCcccccccccccccCCCC-CCCCCcc----chh-----------h---c-----
Q psy15323          8 GRECVNCGAISTPLWRRDGT-----GHYLCNACGLYHKMNGMNR-PLVKPSK----RLT-----------A---T-----   58 (139)
Q Consensus         8 ~~~C~nC~~~~tp~WRr~~~-----g~~lCnaCgly~k~hg~nR-P~~kpsK----R~~-----------a---t-----   58 (139)
                      +.+|.||.++.||+|||+..     |.+||||||||+++|+..| |...+..    +..           .   .     
T Consensus       158 ~~vc~Nc~t~stPlwrR~~~~~s~~~n~lcnaCgl~~klhg~~r~P~t~ks~~~ks~~~~~~~~~n~~~~~~~n~~S~~~  237 (498)
T COG5641         158 PHVCSNCKTTSTPLWRRASSESSLPGNNLCNACGLYLKLHGSPRAPISLKSDSIKSRSSRSSHNNNDSNGENANTESIGN  237 (498)
T ss_pred             cchhccccccCCccccccccccccCCccccccccccccccCCcCCCcccccccccccccccccccccccccccccccccc
Confidence            45999999999999999998     8899999999999999999 8643221    000           0   0     


Q ss_pred             --------------c------------------------------------------ccCcccccCCC-CCCcceecCCC
Q psy15323         59 --------------R------------------------------------------RLGLCCTNCGT-RMTTLWRRNND   81 (139)
Q Consensus        59 --------------k------------------------------------------~~~~~C~~C~t-~~t~~Wr~~~~   81 (139)
                                    +                                          .....+++|.+ +.||+||+...
T Consensus       238 ~~~~~~~~s~~~~~~~~~~~~~~~~~~~~s~~~k~~~le~l~gs~~~~~~~tp~~~~ps~~~~s~~~~~~~tp~~~r~~~  317 (498)
T COG5641         238 SSASKLTKSWEERPQGRQLLSDAGSLSPRSNNPKSPLLEGLMGSTSLQPVSTPKLVLPSDKKRSTLTTSTATPLWRRTSD  317 (498)
T ss_pred             cccccccchhhhccccccccccccccccccCCCcchhhhhcccCccccccCCccccchhhcCcccccccccCcccccccc
Confidence                          0                                          12345778876 67888887765


Q ss_pred             -CCcccchhhhhHHhhCCCCCchh
Q psy15323         82 -GEPVCNACGLYYKLHNVNRPLAM  104 (139)
Q Consensus        82 -g~~lCnaCgly~~~~~~~Rp~~~  104 (139)
                       ..++||+|+++.+.++.+||+.+
T Consensus       318 ~~s~~~n~~~~~~~~~~~~~p~~p  341 (498)
T COG5641         318 KSSFSCNASGSALKPPGSKRPLLP  341 (498)
T ss_pred             cccccccccccccCCcccccccCC
Confidence             45999999999999999999854


No 8  
>KOG1601|consensus
Probab=99.11  E-value=1.2e-10  Score=90.28  Aligned_cols=95  Identities=44%  Similarity=0.701  Sum_probs=70.1

Q ss_pred             CccccCCCCCCCceeecCCCCcccccccccccccCCCC--CCCCCccchhhcccc-CcccccCCCCCCcceecCCCC-Cc
Q psy15323          9 RECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNR--PLVKPSKRLTATRRL-GLCCTNCGTRMTTLWRRNNDG-EP   84 (139)
Q Consensus         9 ~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~k~hg~nR--P~~kpsKR~~atk~~-~~~C~~C~t~~t~~Wr~~~~g-~~   84 (139)
                      ..|.+++.+.+++|+.+..+.+++..+.++.......+  +.....+........ ...|++|+++.|++||+++.| ..
T Consensus       143 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~~~~~~t~~~r~~~~g~~~  222 (340)
T KOG1601|consen  143 GESVSSLLFPTPLQRRDSSGHYNSINKELKKKSNGESSSDLESKPKKSSSASSEQNLRQCSNCGTTKTPLWRRGPEGPKS  222 (340)
T ss_pred             cccccccccccceeccCCCCccccccccccccccccccCCccccchhhhhccccccCcccCCCCCCCCcceecCCCCCcc
Confidence            37899999999999987666778888875544444444  222222222111112 579999999999999999999 69


Q ss_pred             ccchhhhhHHhhCCCCCch
Q psy15323         85 VCNACGLYYKLHNVNRPLA  103 (139)
Q Consensus        85 lCnaCgly~~~~~~~Rp~~  103 (139)
                      +|||||+||+.+...|++.
T Consensus       223 ~cnacgl~~k~~~~~r~~~  241 (340)
T KOG1601|consen  223 LCNACGLRYKKGGVRRPLP  241 (340)
T ss_pred             ccccchhhhhhcCcccccc
Confidence            9999999999999777773


No 9  
>COG5641 GAT1 GATA Zn-finger-containing transcription factor [Transcription]
Probab=98.75  E-value=3.7e-09  Score=92.40  Aligned_cols=53  Identities=47%  Similarity=1.019  Sum_probs=46.3

Q ss_pred             CcccccCCCCCCcceecCCC-----CCcccchhhhhHHhhCCCC-CchhhhcccCcccccccccccccC
Q psy15323         62 GLCCTNCGTRMTTLWRRNND-----GEPVCNACGLYYKLHNVNR-PLAMRHLAMRPLAMRKDGIQTRKR  124 (139)
Q Consensus        62 ~~~C~~C~t~~t~~Wr~~~~-----g~~lCnaCgly~~~~~~~R-p~~~~~~~~~~~~~~~~~i~~~~r  124 (139)
                      ..+|.||.|+.||+|||+..     |.+||||||||++.|+++| |+          .++.+.|+++.+
T Consensus       158 ~~vc~Nc~t~stPlwrR~~~~~s~~~n~lcnaCgl~~klhg~~r~P~----------t~ks~~~ks~~~  216 (498)
T COG5641         158 PHVCSNCKTTSTPLWRRASSESSLPGNNLCNACGLYLKLHGSPRAPI----------SLKSDSIKSRSS  216 (498)
T ss_pred             cchhccccccCCccccccccccccCCccccccccccccccCCcCCCc----------cccccccccccc
Confidence            33899999999999999998     7799999999999999999 98          466677776664


No 10 
>KOG1601|consensus
Probab=98.35  E-value=2.8e-07  Score=71.33  Aligned_cols=42  Identities=57%  Similarity=1.117  Sum_probs=36.9

Q ss_pred             CCccccCCCCCCCceeecCCC-CcccccccccccccCCCCCCC
Q psy15323          8 GRECVNCGAISTPLWRRDGTG-HYLCNACGLYHKMNGMNRPLV   49 (139)
Q Consensus         8 ~~~C~nC~~~~tp~WRr~~~g-~~lCnaCgly~k~hg~nRP~~   49 (139)
                      ...|.+|+++.||+||++++| ..+|||||+|++++...++..
T Consensus       199 ~~~c~~~~~~~t~~~r~~~~g~~~~cnacgl~~k~~~~~r~~~  241 (340)
T KOG1601|consen  199 LRQCSNCGTTKTPLWRRGPEGPKSLCNACGLRYKKGGVRRPLP  241 (340)
T ss_pred             CcccCCCCCCCCcceecCCCCCccccccchhhhhhcCcccccc
Confidence            479999999999999999999 899999999999998444443


No 11 
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=90.96  E-value=0.23  Score=34.45  Aligned_cols=80  Identities=25%  Similarity=0.666  Sum_probs=44.8

Q ss_pred             ccccCCCCCCCceeecCCCCccccccccccccc-CCC---C-CCCCC--c------cchhhccccCcccccCCCCCCcce
Q psy15323         10 ECVNCGAISTPLWRRDGTGHYLCNACGLYHKMN-GMN---R-PLVKP--S------KRLTATRRLGLCCTNCGTRMTTLW   76 (139)
Q Consensus        10 ~C~nC~~~~tp~WRr~~~g~~lCnaCgly~k~h-g~n---R-P~~kp--s------KR~~atk~~~~~C~~C~t~~t~~W   76 (139)
                      .|.+||..-.+.     .+.+.|..|+...... ..+   + .+...  .      ............|..|+-.+.--|
T Consensus         2 fC~~Cg~~l~~~-----~~~~~C~~C~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Cp~Cg~~~a~f~   76 (104)
T TIGR01384         2 FCPKCGSLMTPK-----NGVYVCPSCGYEKEKKPEDDYKVTEKVKHKIKETIIIREEDSETLPTTRVECPKCGHKEAYYW   76 (104)
T ss_pred             CCcccCcccccC-----CCeEECcCCCCccccccccccEEEEEeccccccceeeccccccCCCcccCCCCCCCCCeeEEE
Confidence            699999655432     3578999999754331 100   0 00000  0      000111234678999998775554


Q ss_pred             ----ecCCCCC---cccchhhhhHH
Q psy15323         77 ----RRNNDGE---PVCNACGLYYK   94 (139)
Q Consensus        77 ----r~~~~g~---~lCnaCgly~~   94 (139)
                          |..+++.   ++|-.|+..|+
T Consensus        77 ~~Q~RsadE~~T~fy~C~~C~~~w~  101 (104)
T TIGR01384        77 LLQTRRADEPETRFYKCTKCGYVWR  101 (104)
T ss_pred             EeccCCCCCCcEEEEEeCCCCCeeE
Confidence                3344443   78999998775


No 12 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=89.66  E-value=0.22  Score=29.40  Aligned_cols=27  Identities=33%  Similarity=0.899  Sum_probs=19.4

Q ss_pred             ccccCCCCCCCceeecCCCCccccccccc
Q psy15323         10 ECVNCGAISTPLWRRDGTGHYLCNACGLY   38 (139)
Q Consensus        10 ~C~nC~~~~tp~WRr~~~g~~lCnaCgly   38 (139)
                      .|.+|+++. -.+. ...|+++|..||+-
T Consensus         2 ~Cp~Cg~~~-~~~D-~~~g~~vC~~CG~V   28 (43)
T PF08271_consen    2 KCPNCGSKE-IVFD-PERGELVCPNCGLV   28 (43)
T ss_dssp             SBTTTSSSE-EEEE-TTTTEEEETTT-BB
T ss_pred             CCcCCcCCc-eEEc-CCCCeEECCCCCCE
Confidence            699999866 2333 55789999999984


No 13 
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=89.25  E-value=0.31  Score=29.05  Aligned_cols=25  Identities=48%  Similarity=1.163  Sum_probs=20.6

Q ss_pred             CCccccCCCCCCCceeecCCCCccccccc
Q psy15323          8 GRECVNCGAISTPLWRRDGTGHYLCNACG   36 (139)
Q Consensus         8 ~~~C~nC~~~~tp~WRr~~~g~~lCnaCg   36 (139)
                      +..|..|+   +|+.| +.+|+.+|.+|+
T Consensus        17 ~~~Cp~C~---~PL~~-~k~g~~~Cv~C~   41 (41)
T PF06677_consen   17 DEHCPDCG---TPLMR-DKDGKIYCVSCG   41 (41)
T ss_pred             cCccCCCC---CeeEE-ecCCCEECCCCC
Confidence            45788996   99999 557789999985


No 14 
>KOG3554|consensus
Probab=88.22  E-value=0.32  Score=43.13  Aligned_cols=37  Identities=24%  Similarity=0.604  Sum_probs=31.5

Q ss_pred             cCcccccCCCCCCccee-cCCCC-C-cccchhhhhHHhhC
Q psy15323         61 LGLCCTNCGTRMTTLWR-RNNDG-E-PVCNACGLYYKLHN   97 (139)
Q Consensus        61 ~~~~C~~C~t~~t~~Wr-~~~~g-~-~lCnaCgly~~~~~   97 (139)
                      .+.-|.+|+|+.+-.|- .|+.+ + .||-.|-+||++.+
T Consensus       385 ~g~~CEsC~ttqs~qWYsWGppnmqcrLCasCWiyWKKyg  424 (693)
T KOG3554|consen  385 DGRACESCYTTQSLQWYSWGPPNMQCRLCASCWIYWKKYG  424 (693)
T ss_pred             CCCcccccccccccceeccCCCCccchhhHHHHHHHHHhc
Confidence            36689999999999998 46665 3 89999999998877


No 15 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=85.86  E-value=0.65  Score=26.77  Aligned_cols=32  Identities=31%  Similarity=0.897  Sum_probs=23.4

Q ss_pred             CCCCCCCCccccCCCCCCCceeecCCCCcccccccc
Q psy15323          2 DFQFGEGRECVNCGAISTPLWRRDGTGHYLCNACGL   37 (139)
Q Consensus         2 ~~~~~~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgl   37 (139)
                      +.--+....|..|++.    |-...+|.+.|..||-
T Consensus         2 e~~~~~~~~C~~C~~~----~~~~~dG~~yC~~cG~   33 (36)
T PF11781_consen    2 EWMRGPNEPCPVCGSR----WFYSDDGFYYCDRCGH   33 (36)
T ss_pred             cccccCCCcCCCCCCe----EeEccCCEEEhhhCce
Confidence            3344445569999976    5556789999999985


No 16 
>KOG3554|consensus
Probab=84.76  E-value=0.35  Score=42.94  Aligned_cols=40  Identities=30%  Similarity=0.643  Sum_probs=31.7

Q ss_pred             CCCCCCccccCCCCCCCceee-cCCC--CcccccccccccccC
Q psy15323          4 QFGEGRECVNCGAISTPLWRR-DGTG--HYLCNACGLYHKMNG   43 (139)
Q Consensus         4 ~~~~~~~C~nC~~~~tp~WRr-~~~g--~~lCnaCgly~k~hg   43 (139)
                      ++..++-|.+|+|+..-.|-. |+.+  ..||-.|-+|+++.|
T Consensus       382 ~~~~g~~CEsC~ttqs~qWYsWGppnmqcrLCasCWiyWKKyg  424 (693)
T KOG3554|consen  382 QNQDGRACESCYTTQSLQWYSWGPPNMQCRLCASCWIYWKKYG  424 (693)
T ss_pred             cCCCCCcccccccccccceeccCCCCccchhhHHHHHHHHHhc
Confidence            344578999999999999996 4433  579999999998763


No 17 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=81.02  E-value=0.88  Score=25.98  Aligned_cols=26  Identities=42%  Similarity=0.935  Sum_probs=13.8

Q ss_pred             CccccCCCCCCCceeecCC--C--Ccccccccc
Q psy15323          9 RECVNCGAISTPLWRRDGT--G--HYLCNACGL   37 (139)
Q Consensus         9 ~~C~nC~~~~tp~WRr~~~--g--~~lCnaCgl   37 (139)
                      +.|.+||   +|+=++-++  +  +.+|.+||.
T Consensus         1 kfC~~CG---~~l~~~ip~gd~r~R~vC~~Cg~   30 (34)
T PF14803_consen    1 KFCPQCG---GPLERRIPEGDDRERLVCPACGF   30 (34)
T ss_dssp             -B-TTT-----B-EEE--TT-SS-EEEETTTTE
T ss_pred             Ccccccc---ChhhhhcCCCCCccceECCCCCC
Confidence            4699999   455554443  2  479999987


No 18 
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF. Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs.
Probab=81.01  E-value=0.85  Score=32.29  Aligned_cols=39  Identities=31%  Similarity=0.813  Sum_probs=31.3

Q ss_pred             CCCccccCCCCCCCceeecCCCCcccccccccccccCCCC
Q psy15323          7 EGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNR   46 (139)
Q Consensus         7 ~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~k~hg~nR   46 (139)
                      ..+.|++|++ .-|.|=.-.-|.+||-.|.-..+..|.+.
T Consensus         2 ~N~~CaDC~~-~~p~w~s~~~GifvC~~CsgiHR~lg~hi   40 (112)
T smart00105        2 GNKKCFDCGA-PNPTWASVNLGVFLCIECSGIHRSLGVHI   40 (112)
T ss_pred             CCCcccCCCC-CCCCcEEeccceeEhHHhHHHHHhcCCCc
Confidence            4579999998 56999988889999999988666556543


No 19 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=80.85  E-value=1.6  Score=40.00  Aligned_cols=23  Identities=22%  Similarity=0.589  Sum_probs=14.2

Q ss_pred             CccccCCCCCCCceeecCCCCccccccccc
Q psy15323          9 RECVNCGAISTPLWRRDGTGHYLCNACGLY   38 (139)
Q Consensus         9 ~~C~nC~~~~tp~WRr~~~g~~lCnaCgly   38 (139)
                      ..|.+||+.       .+++.-.|..||..
T Consensus         2 ~~Cp~Cg~~-------n~~~akFC~~CG~~   24 (645)
T PRK14559          2 LICPQCQFE-------NPNNNRFCQKCGTS   24 (645)
T ss_pred             CcCCCCCCc-------CCCCCccccccCCC
Confidence            367777755       23444577777763


No 20 
>COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion]
Probab=78.99  E-value=1.4  Score=37.10  Aligned_cols=39  Identities=31%  Similarity=0.818  Sum_probs=31.9

Q ss_pred             CCCCccccCCCCCCCceeecCCCCcccccccccccccCCC
Q psy15323          6 GEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMN   45 (139)
Q Consensus         6 ~~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~k~hg~n   45 (139)
                      ++.+.|..|++.. |.|-.-.-|.|||-.|.--.|--|.+
T Consensus        18 ~~Nk~CaDCga~~-P~W~S~nlGvfiCi~CagvHRsLGvh   56 (319)
T COG5347          18 SSNKKCADCGAPN-PTWASVNLGVFLCIDCAGVHRSLGVH   56 (319)
T ss_pred             cccCccccCCCCC-CceEecccCeEEEeecchhhhccccc
Confidence            4578999999999 99998888999999997755444544


No 21 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=78.05  E-value=1.3  Score=32.75  Aligned_cols=26  Identities=42%  Similarity=1.132  Sum_probs=22.1

Q ss_pred             CCccccCCCCCCCceeecCCCCccccccccc
Q psy15323          8 GRECVNCGAISTPLWRRDGTGHYLCNACGLY   38 (139)
Q Consensus         8 ~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly   38 (139)
                      +.-|..||   |||++  -+|..+|..|+..
T Consensus        28 ~~hCp~Cg---~PLF~--KdG~v~CPvC~~~   53 (131)
T COG1645          28 AKHCPKCG---TPLFR--KDGEVFCPVCGYR   53 (131)
T ss_pred             HhhCcccC---Cccee--eCCeEECCCCCce
Confidence            45788888   99999  6789999999953


No 22 
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed
Probab=77.92  E-value=1.8  Score=27.41  Aligned_cols=28  Identities=39%  Similarity=0.876  Sum_probs=19.7

Q ss_pred             CCCCCCccccCCCCCCCceeecCCCCcccccccccc
Q psy15323          4 QFGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYH   39 (139)
Q Consensus         4 ~~~~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~   39 (139)
                      ..+..-.|.+||...-|        +.+|..||.|.
T Consensus        23 ~~~~l~~C~~CG~~~~~--------H~vC~~CG~Y~   50 (57)
T PRK12286         23 KAPGLVECPNCGEPKLP--------HRVCPSCGYYK   50 (57)
T ss_pred             cCCcceECCCCCCccCC--------eEECCCCCcCC
Confidence            34555679999954433        56999999875


No 23 
>PF01412 ArfGap:  Putative GTPase activating protein for Arf;  InterPro: IPR001164  This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins []. The GTP-bound form of ARF is essential for the maintenance of normal Golgi morphology, it participates in recruitment of coat proteins which are required for budding and fission of membranes. Before the fusion with an acceptor compartment the membrane must be uncoated. This step required the hydrolysis of GTP associated to ARF. These proteins contain a characteristic zinc finger motif (Cys-x2-Cys-x(16,17)-x2-Cys) which displays some similarity to the C4-type GATA zinc finger. The ARFGAP domain display no obvious similarity to other GAP proteins.  The 3D structure of the ARFGAP domain of the PYK2-associated protein beta has been solved []. It consists of a three-stranded beta-sheet surrounded by 5 alpha helices. The domain is organised around a central zinc atom which is coordinated by 4 cysteines. The ARFGAP domain is clearly unrelated to the other GAP proteins structures which are exclusively helical. Classical GAP proteins accelerate GTPase activity by supplying an arginine finger to the active site. The crystal structure of ARFGAP bound to ARF revealed that the ARFGAP domain does not supply an arginine to the active site which suggests a more indirect role of the ARFGAP domain in the GTPase hydrolysis []. The Rev protein of human immunodeficiency virus type 1 (HIV-1) facilitates nuclear export of unspliced and partly-spliced viral RNAs []. Rev contains an RNA-binding domain and an effector domain; the latter is believed to interact with a cellular cofactor required for the Rev response and hence HIV-1 replication. Human Rev interacting protein (hRIP) specifically interacts with the Rev effector. The amino acid sequence of hRIP is characterised by an N-terminal, C-4 class zinc finger motif.; GO: 0008060 ARF GTPase activator activity, 0008270 zinc ion binding, 0032312 regulation of ARF GTPase activity; PDB: 2P57_A 2CRR_A 2OWA_B 3O47_B 3DWD_A 1DCQ_A 2CRW_A 3MDB_D 3FEH_A 3LJU_X ....
Probab=77.10  E-value=1.5  Score=31.22  Aligned_cols=39  Identities=31%  Similarity=0.715  Sum_probs=25.9

Q ss_pred             CCCCCccccCCCCCCCceeecCCCCcccccccccccccCC
Q psy15323          5 FGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGM   44 (139)
Q Consensus         5 ~~~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~k~hg~   44 (139)
                      .+.-+.|++|++.. |.|-.-.-|-+||-.|.-..+..|.
T Consensus        10 ~~~N~~CaDCg~~~-p~w~s~~~GiflC~~Cag~HR~lg~   48 (116)
T PF01412_consen   10 KPGNKVCADCGAPN-PTWASLNYGIFLCLECAGIHRSLGV   48 (116)
T ss_dssp             STTCTB-TTT-SBS---EEETTTTEEE-HHHHHHHHHHTT
T ss_pred             CcCcCcCCCCCCCC-CCEEEeecChhhhHHHHHHHHHhcc
Confidence            35568999999554 5999888899999999876555554


No 24 
>PF12773 DZR:  Double zinc ribbon
Probab=75.35  E-value=3  Score=24.88  Aligned_cols=10  Identities=40%  Similarity=1.006  Sum_probs=6.2

Q ss_pred             CcccccCCCC
Q psy15323         62 GLCCTNCGTR   71 (139)
Q Consensus        62 ~~~C~~C~t~   71 (139)
                      ...|.+|++.
T Consensus        29 ~~~C~~Cg~~   38 (50)
T PF12773_consen   29 KKICPNCGAE   38 (50)
T ss_pred             CCCCcCCcCC
Confidence            4467777763


No 25 
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=74.88  E-value=3.2  Score=34.79  Aligned_cols=70  Identities=23%  Similarity=0.544  Sum_probs=45.0

Q ss_pred             CCccccCCCCCCCce-ee-cCCC--CcccccccccccccCCCCCCCCCccchhhccccCcccccCCCCCCc-ceecCC--
Q psy15323          8 GRECVNCGAISTPLW-RR-DGTG--HYLCNACGLYHKMNGMNRPLVKPSKRLTATRRLGLCCTNCGTRMTT-LWRRNN--   80 (139)
Q Consensus         8 ~~~C~nC~~~~tp~W-Rr-~~~g--~~lCnaCgly~k~hg~nRP~~kpsKR~~atk~~~~~C~~C~t~~t~-~Wr~~~--   80 (139)
                      ...|-.||+...--. +. +.+|  ...|.-|+-.|....                   ..|++|+.++.- .|--..  
T Consensus       187 ~~~CPvCGs~P~~s~v~~~~~~G~RyL~CslC~teW~~~R-------------------~~C~~Cg~~~~l~y~~~~~~~  247 (309)
T PRK03564        187 RQFCPVCGSMPVSSVVQIGTTQGLRYLHCNLCESEWHVVR-------------------VKCSNCEQSGKLHYWSLDSEQ  247 (309)
T ss_pred             CCCCCCCCCcchhheeeccCCCCceEEEcCCCCCcccccC-------------------ccCCCCCCCCceeeeeecCCC
Confidence            568999998765443 32 3345  358999998664432                   259999976543 343222  


Q ss_pred             CCC--cccchhhhhHHhh
Q psy15323         81 DGE--PVCNACGLYYKLH   96 (139)
Q Consensus        81 ~g~--~lCnaCgly~~~~   96 (139)
                      .+.  .+|..|+.|.|.-
T Consensus       248 ~~~r~e~C~~C~~YlK~~  265 (309)
T PRK03564        248 AAVKAESCGDCGTYLKIL  265 (309)
T ss_pred             cceEeeecccccccceec
Confidence            222  6899999998763


No 26 
>KOG0703|consensus
Probab=74.83  E-value=1.8  Score=35.94  Aligned_cols=31  Identities=29%  Similarity=0.797  Sum_probs=26.6

Q ss_pred             CCCCccccCCCCCCCceeecCCCCcccccccc
Q psy15323          6 GEGRECVNCGAISTPLWRRDGTGHYLCNACGL   37 (139)
Q Consensus         6 ~~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgl   37 (139)
                      ++.+.|+.|++. .|.|-.---|.|+|--|-=
T Consensus        23 ~~N~~CADC~a~-~P~WaSwnlGvFiC~~C~g   53 (287)
T KOG0703|consen   23 PDNKVCADCGAK-GPRWASWNLGVFICLRCAG   53 (287)
T ss_pred             cccCcccccCCC-CCCeEEeecCeEEEeeccc
Confidence            347899999998 9999987789999988754


No 27 
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=74.72  E-value=0.78  Score=37.48  Aligned_cols=71  Identities=27%  Similarity=0.520  Sum_probs=32.9

Q ss_pred             CCccccCCCCCCCceeecCC--C--CcccccccccccccCCCCCCCCCccchhhccccCcccccCCCCCCc-ceec---C
Q psy15323          8 GRECVNCGAISTPLWRRDGT--G--HYLCNACGLYHKMNGMNRPLVKPSKRLTATRRLGLCCTNCGTRMTT-LWRR---N   79 (139)
Q Consensus         8 ~~~C~nC~~~~tp~WRr~~~--g--~~lCnaCgly~k~hg~nRP~~kpsKR~~atk~~~~~C~~C~t~~t~-~Wr~---~   79 (139)
                      ...|-.||+...--+-++..  |  ...|--|+-.|....                   ..|++|+.+... +|-=   +
T Consensus       172 ~g~CPvCGs~P~~s~l~~~~~~G~R~L~Cs~C~t~W~~~R-------------------~~Cp~Cg~~~~~~l~~~~~e~  232 (290)
T PF04216_consen  172 RGYCPVCGSPPVLSVLRGGEREGKRYLHCSLCGTEWRFVR-------------------IKCPYCGNTDHEKLEYFTVEG  232 (290)
T ss_dssp             -SS-TTT---EEEEEEE------EEEEEETTT--EEE--T-------------------TS-TTT---SS-EEE------
T ss_pred             CCcCCCCCCcCceEEEecCCCCccEEEEcCCCCCeeeecC-------------------CCCcCCCCCCCcceeeEecCC
Confidence            35788888766665555554  5  357888888664422                   249999988754 4442   2


Q ss_pred             CCCC--cccchhhhhHHhhC
Q psy15323         80 NDGE--PVCNACGLYYKLHN   97 (139)
Q Consensus        80 ~~g~--~lCnaCgly~~~~~   97 (139)
                      .++.  .+|..|+.|.+.--
T Consensus       233 ~~~~rve~C~~C~~YlK~vd  252 (290)
T PF04216_consen  233 EPAYRVEVCESCGSYLKTVD  252 (290)
T ss_dssp             --SEEEEEETTTTEEEEEEE
T ss_pred             CCcEEEEECCcccchHHHHh
Confidence            3332  69999999986543


No 28 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=73.27  E-value=2  Score=22.66  Aligned_cols=22  Identities=41%  Similarity=0.815  Sum_probs=12.5

Q ss_pred             CccccCCCCCCCceeecCCCCcccccccc
Q psy15323          9 RECVNCGAISTPLWRRDGTGHYLCNACGL   37 (139)
Q Consensus         9 ~~C~nC~~~~tp~WRr~~~g~~lCnaCgl   37 (139)
                      ..|.+||+...+-       ...|..||.
T Consensus         3 ~~Cp~Cg~~~~~~-------~~fC~~CG~   24 (26)
T PF13248_consen    3 MFCPNCGAEIDPD-------AKFCPNCGA   24 (26)
T ss_pred             CCCcccCCcCCcc-------cccChhhCC
Confidence            4677777644332       236666664


No 29 
>PRK00420 hypothetical protein; Validated
Probab=72.51  E-value=3  Score=30.03  Aligned_cols=29  Identities=28%  Similarity=0.647  Sum_probs=23.4

Q ss_pred             CCccccCCCCCCCceeecCCCCccccccccccc
Q psy15323          8 GRECVNCGAISTPLWRRDGTGHYLCNACGLYHK   40 (139)
Q Consensus         8 ~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~k   40 (139)
                      +..|..||   +|+.+- .+|+.+|.+||....
T Consensus        23 ~~~CP~Cg---~pLf~l-k~g~~~Cp~Cg~~~~   51 (112)
T PRK00420         23 SKHCPVCG---LPLFEL-KDGEVVCPVHGKVYI   51 (112)
T ss_pred             cCCCCCCC---Ccceec-CCCceECCCCCCeee
Confidence            46899999   899984 567899999999543


No 30 
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=72.20  E-value=3.5  Score=34.46  Aligned_cols=70  Identities=20%  Similarity=0.434  Sum_probs=45.4

Q ss_pred             CCccccCCCCCCCce-eec--CCC--CcccccccccccccCCCCCCCCCccchhhccccCcccccCCCCCCc-ceecCC-
Q psy15323          8 GRECVNCGAISTPLW-RRD--GTG--HYLCNACGLYHKMNGMNRPLVKPSKRLTATRRLGLCCTNCGTRMTT-LWRRNN-   80 (139)
Q Consensus         8 ~~~C~nC~~~~tp~W-Rr~--~~g--~~lCnaCgly~k~hg~nRP~~kpsKR~~atk~~~~~C~~C~t~~t~-~Wr~~~-   80 (139)
                      ...|-.||+...--. +.+  .+|  ...|.-|+-.|....                   ..|++|+.+..- .|.-.. 
T Consensus       184 ~~~CPvCGs~P~~s~~~~~~~~~G~RyL~CslC~teW~~~R-------------------~~C~~Cg~~~~l~y~~~e~~  244 (305)
T TIGR01562       184 RTLCPACGSPPVASMVRQGGKETGLRYLSCSLCATEWHYVR-------------------VKCSHCEESKHLAYLSLEHD  244 (305)
T ss_pred             CCcCCCCCChhhhhhhcccCCCCCceEEEcCCCCCcccccC-------------------ccCCCCCCCCceeeEeecCC
Confidence            348999998766533 332  355  358999998664432                   259999987643 354322 


Q ss_pred             ---CCC--cccchhhhhHHhh
Q psy15323         81 ---DGE--PVCNACGLYYKLH   96 (139)
Q Consensus        81 ---~g~--~lCnaCgly~~~~   96 (139)
                         .+.  .+|..|+.|.|.-
T Consensus       245 ~~~~~~r~e~C~~C~~YlK~~  265 (305)
T TIGR01562       245 AEKAVLKAETCDSCQGYLKIL  265 (305)
T ss_pred             CCCcceEEeeccccccchhhh
Confidence               222  5899999998764


No 31 
>PRK00423 tfb transcription initiation factor IIB; Reviewed
Probab=70.70  E-value=3.4  Score=34.22  Aligned_cols=34  Identities=29%  Similarity=0.617  Sum_probs=24.4

Q ss_pred             CCCCCCCccccCCCCCCCceeecCCCCccccccccc
Q psy15323          3 FQFGEGRECVNCGAISTPLWRRDGTGHYLCNACGLY   38 (139)
Q Consensus         3 ~~~~~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly   38 (139)
                      .+......|.+|+.  +.+=-....|+++|..||+-
T Consensus         6 ~~~~~~~~Cp~Cg~--~~iv~d~~~Ge~vC~~CG~V   39 (310)
T PRK00423          6 LEEEEKLVCPECGS--DKLIYDYERGEIVCADCGLV   39 (310)
T ss_pred             hhcccCCcCcCCCC--CCeeEECCCCeEeecccCCc
Confidence            34456778999996  34433346789999999994


No 32 
>PLN03114 ADP-ribosylation factor GTPase-activating protein AGD10; Provisional
Probab=67.93  E-value=4  Score=35.19  Aligned_cols=40  Identities=28%  Similarity=0.725  Sum_probs=32.3

Q ss_pred             CCCCccccCCCCCCCceeecCCCCcccccccccccccCCCC
Q psy15323          6 GEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNR   46 (139)
Q Consensus         6 ~~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~k~hg~nR   46 (139)
                      +..+.|+.|++.. |.|=.-.-|.|||..|.-..+..|.+.
T Consensus        20 PgNk~CaDCga~n-PtWASvn~GIFLCl~CSGVHRsLGvHI   59 (395)
T PLN03114         20 SDNKICFDCNAKN-PTWASVTYGIFLCIDCSAVHRSLGVHI   59 (395)
T ss_pred             cCCCcCccCCCCC-CCceeeccceeehhhhhHhhccCCCCC
Confidence            4578999999865 999988889999999987666556543


No 33 
>KOG0706|consensus
Probab=67.58  E-value=3.1  Score=36.51  Aligned_cols=40  Identities=33%  Similarity=0.799  Sum_probs=33.2

Q ss_pred             CCCCccccCCCCCCCceeecCCCCcccccccccccccCCCC
Q psy15323          6 GEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNR   46 (139)
Q Consensus         6 ~~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~k~hg~nR   46 (139)
                      ++-++|..|++ +-|.|-.-+.|-|||-.|.-..+--|++.
T Consensus        21 ~~NKvCFDCgA-knPtWaSVTYGIFLCiDCSAvHRnLGVHi   60 (454)
T KOG0706|consen   21 SENKVCFDCGA-KNPTWASVTYGIFLCIDCSAVHRNLGVHI   60 (454)
T ss_pred             CCCceecccCC-CCCCceeecceEEEEEecchhhhccccce
Confidence            46789999996 46999999999999999998766556553


No 34 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=66.96  E-value=5.9  Score=23.53  Aligned_cols=30  Identities=30%  Similarity=0.718  Sum_probs=18.7

Q ss_pred             CCCCccccCCCCCCCceeecCCCCcccccccc
Q psy15323          6 GEGRECVNCGAISTPLWRRDGTGHYLCNACGL   37 (139)
Q Consensus         6 ~~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgl   37 (139)
                      +++.+|-.||.+ ...|-+ ..+.+.|++|.-
T Consensus        16 ~~g~~CP~Cg~~-~~~~~~-~~~~~~C~~C~~   45 (46)
T PF12760_consen   16 PDGFVCPHCGST-KHYRLK-TRGRYRCKACRK   45 (46)
T ss_pred             CCCCCCCCCCCe-eeEEeC-CCCeEECCCCCC
Confidence            345678888877 333333 356778888863


No 35 
>PF02318 FYVE_2:  FYVE-type zinc finger;  InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A. The small G protein Rab3A plays an important role in the regulation of neurotransmitter release. The crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A shows that the effector domain of rabphilin-3A contacts Rab3A in two distinct areas. The first interface involves the Rab3A switch I and switch II regions, which are sensitive to the nucleotide-binding state of Rab3A. The second interface consists of a deep pocket in Rab3A that interacts with a SGAWFF structural element of rabphilin-3A. Sequence and structure analysis, and biochemical data suggest that this pocket, or Rab complementarity-determining region (RabCDR), establishes a specific interaction between each Rab protein and its effectors. It has been suggested that RabCDRs could be major determinants of effector specificity during vesicle trafficking and fusion [].; GO: 0008270 zinc ion binding, 0017137 Rab GTPase binding, 0006886 intracellular protein transport; PDB: 2CSZ_A 2ZET_C 1ZBD_B 3BC1_B 2CJS_C 2A20_A.
Probab=66.94  E-value=2.9  Score=29.77  Aligned_cols=50  Identities=26%  Similarity=0.649  Sum_probs=29.7

Q ss_pred             CCCccccCCCCCCCceeecCCCCcccccccccccccCCCCCCCCCccchhhccccCcccccCCCCCCcceecCCCCCccc
Q psy15323          7 EGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVKPSKRLTATRRLGLCCTNCGTRMTTLWRRNNDGEPVC   86 (139)
Q Consensus         7 ~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~k~hg~nRP~~kpsKR~~atk~~~~~C~~C~t~~t~~Wr~~~~g~~lC   86 (139)
                      ....|..|+..-+-++.++    .+|..|..+                         +|..|++.      .......||
T Consensus        53 ~~~~C~~C~~~fg~l~~~~----~~C~~C~~~-------------------------VC~~C~~~------~~~~~~WlC   97 (118)
T PF02318_consen   53 GERHCARCGKPFGFLFNRG----RVCVDCKHR-------------------------VCKKCGVY------SKKEPIWLC   97 (118)
T ss_dssp             CCSB-TTTS-BCSCTSTTC----EEETTTTEE-------------------------EETTSEEE------TSSSCCEEE
T ss_pred             CCcchhhhCCcccccCCCC----CcCCcCCcc-------------------------ccCccCCc------CCCCCCEEC
Confidence            3567888886655554433    467777663                         68888875      122334789


Q ss_pred             chhhh
Q psy15323         87 NACGL   91 (139)
Q Consensus        87 naCgl   91 (139)
                      +.|.-
T Consensus        98 ~vC~k  102 (118)
T PF02318_consen   98 KVCQK  102 (118)
T ss_dssp             HHHHH
T ss_pred             hhhHH
Confidence            99964


No 36 
>PRK03988 translation initiation factor IF-2 subunit beta; Validated
Probab=66.89  E-value=2.3  Score=31.55  Aligned_cols=30  Identities=30%  Similarity=0.573  Sum_probs=22.8

Q ss_pred             CcccccCCCCCCcceecCCCCCcccchhhh
Q psy15323         62 GLCCTNCGTRMTTLWRRNNDGEPVCNACGL   91 (139)
Q Consensus        62 ~~~C~~C~t~~t~~Wr~~~~g~~lCnaCgl   91 (139)
                      =..|..|+..+|.+-+.+.--...|+|||-
T Consensus       102 yVlC~~C~spdT~l~k~~r~~~l~C~ACGa  131 (138)
T PRK03988        102 YVICPECGSPDTKLIKEGRIWVLKCEACGA  131 (138)
T ss_pred             cEECCCCCCCCcEEEEcCCeEEEEcccCCC
Confidence            467999999999997643322467999983


No 37 
>smart00653 eIF2B_5 domain present in translation initiation factor eIF2B and eIF5.
Probab=65.71  E-value=3.1  Score=29.73  Aligned_cols=28  Identities=32%  Similarity=0.672  Sum_probs=21.1

Q ss_pred             ccccCCCCCCCceeecCCCCcccccccc
Q psy15323         10 ECVNCGAISTPLWRRDGTGHYLCNACGL   37 (139)
Q Consensus        10 ~C~nC~~~~tp~WRr~~~g~~lCnaCgl   37 (139)
                      .|..|+..+|-+=..+..-...|+|||.
T Consensus        82 lC~~C~spdT~l~k~~r~~~l~C~aCGa  109 (110)
T smart00653       82 LCPECGSPDTELIKENRLFFLKCEACGA  109 (110)
T ss_pred             ECCCCCCCCcEEEEeCCeEEEEccccCC
Confidence            6999999999888763222457999985


No 38 
>smart00653 eIF2B_5 domain present in translation initiation factor eIF2B and eIF5.
Probab=65.53  E-value=2.7  Score=30.06  Aligned_cols=30  Identities=33%  Similarity=0.566  Sum_probs=22.5

Q ss_pred             CcccccCCCCCCcceecCCCCCcccchhhh
Q psy15323         62 GLCCTNCGTRMTTLWRRNNDGEPVCNACGL   91 (139)
Q Consensus        62 ~~~C~~C~t~~t~~Wr~~~~g~~lCnaCgl   91 (139)
                      =..|..|+..+|.+-..+..-...|+|||-
T Consensus        80 yVlC~~C~spdT~l~k~~r~~~l~C~aCGa  109 (110)
T smart00653       80 YVLCPECGSPDTELIKENRLFFLKCEACGA  109 (110)
T ss_pred             cEECCCCCCCCcEEEEeCCeEEEEccccCC
Confidence            468999999999997762222356999983


No 39 
>TIGR00311 aIF-2beta translation initiation factor aIF-2, beta subunit, putative.
Probab=64.54  E-value=2.9  Score=30.90  Aligned_cols=30  Identities=23%  Similarity=0.514  Sum_probs=22.3

Q ss_pred             CcccccCCCCCCcceecCCCCCcccchhhh
Q psy15323         62 GLCCTNCGTRMTTLWRRNNDGEPVCNACGL   91 (139)
Q Consensus        62 ~~~C~~C~t~~t~~Wr~~~~g~~lCnaCgl   91 (139)
                      -..|..|+..+|.+-..+.--...|+|||-
T Consensus        97 yVlC~~C~sPdT~l~k~~r~~~l~C~ACGa  126 (133)
T TIGR00311        97 YVICRECNRPDTRIIKEGRVSLLKCEACGA  126 (133)
T ss_pred             eEECCCCCCCCcEEEEeCCeEEEecccCCC
Confidence            467999999999987643222357999983


No 40 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=64.12  E-value=3.6  Score=24.17  Aligned_cols=15  Identities=27%  Similarity=0.919  Sum_probs=8.0

Q ss_pred             Cccccccc-ccccccC
Q psy15323         29 HYLCNACG-LYHKMNG   43 (139)
Q Consensus        29 ~~lCnaCg-ly~k~hg   43 (139)
                      +|.|.+|| .+..+..
T Consensus         5 ey~C~~Cg~~fe~~~~   20 (42)
T PF09723_consen    5 EYRCEECGHEFEVLQS   20 (42)
T ss_pred             EEEeCCCCCEEEEEEE
Confidence            35677777 3444433


No 41 
>smart00778 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase. This region represents the zinc binding domain. It is found in the N-terminal region of the bacteriophage P4 alpha protein, which is a multifunctional protein with origin recognition, helicase and primase activities.
Probab=63.47  E-value=6.4  Score=22.83  Aligned_cols=29  Identities=34%  Similarity=0.907  Sum_probs=20.3

Q ss_pred             CccccCCCCCCCceee-cCCCCcccccccc
Q psy15323          9 RECVNCGAISTPLWRR-DGTGHYLCNACGL   37 (139)
Q Consensus         9 ~~C~nC~~~~tp~WRr-~~~g~~lCnaCgl   37 (139)
                      --|.+|+.+..=.|.. ...|..+|+.|+.
T Consensus         4 ~pCP~CGG~DrFr~~d~~g~G~~~C~~Cg~   33 (37)
T smart00778        4 GPCPNCGGSDRFRFDDKDGRGTWFCSVCGA   33 (37)
T ss_pred             cCCCCCCCccccccccCCCCcCEEeCCCCC
Confidence            4588999866555543 3357899999974


No 42 
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=61.49  E-value=5.2  Score=28.14  Aligned_cols=35  Identities=26%  Similarity=0.547  Sum_probs=20.9

Q ss_pred             cCcccccCCCCCCcceecCCCCCcccchhhhhHHh
Q psy15323         61 LGLCCTNCGTRMTTLWRRNNDGEPVCNACGLYYKL   95 (139)
Q Consensus        61 ~~~~C~~C~t~~t~~Wr~~~~g~~lCnaCgly~~~   95 (139)
                      .-..|.+|+...-++-....-+..+|..||+|+-.
T Consensus        20 t~f~CP~Cge~~v~v~~~k~~~h~~C~~CG~y~~~   54 (99)
T PRK14892         20 KIFECPRCGKVSISVKIKKNIAIITCGNCGLYTEF   54 (99)
T ss_pred             cEeECCCCCCeEeeeecCCCcceEECCCCCCccCE
Confidence            45579999943222111112235899999998744


No 43 
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF. Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs.
Probab=60.18  E-value=4.4  Score=28.58  Aligned_cols=43  Identities=26%  Similarity=0.482  Sum_probs=33.3

Q ss_pred             CcccccCCCCCCcceecCCCCCcccchhhhhHHhhCC----CCCchhh
Q psy15323         62 GLCCTNCGTRMTTLWRRNNDGEPVCNACGLYYKLHNV----NRPLAMR  105 (139)
Q Consensus        62 ~~~C~~C~t~~t~~Wr~~~~g~~lCnaCgly~~~~~~----~Rp~~~~  105 (139)
                      ...|+.|+. ..|.|=.-+-|-.||-.|.-..+..+.    .|++++-
T Consensus         3 N~~CaDC~~-~~p~w~s~~~GifvC~~CsgiHR~lg~his~VkSl~md   49 (112)
T smart00105        3 NKKCFDCGA-PNPTWASVNLGVFLCIECSGIHRSLGVHISKVRSLTLD   49 (112)
T ss_pred             CCcccCCCC-CCCCcEEeccceeEhHHhHHHHHhcCCCcCeeeecccC
Confidence            457999998 668998888898999999887777664    3455443


No 44 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=59.97  E-value=8.6  Score=22.86  Aligned_cols=30  Identities=27%  Similarity=0.873  Sum_probs=19.1

Q ss_pred             CccccCCCCCCCceeecCC--CCcccccccccccc
Q psy15323          9 RECVNCGAISTPLWRRDGT--GHYLCNACGLYHKM   41 (139)
Q Consensus         9 ~~C~nC~~~~tp~WRr~~~--g~~lCnaCgly~k~   41 (139)
                      +.|..||..   +-.....  ..++|..||.....
T Consensus         1 ~FCp~Cg~~---l~~~~~~~~~~~vC~~Cg~~~~~   32 (52)
T smart00661        1 KFCPKCGNM---LIPKEGKEKRRFVCRKCGYEEPI   32 (52)
T ss_pred             CCCCCCCCc---cccccCCCCCEEECCcCCCeEEC
Confidence            368999963   3333332  26899999975433


No 45 
>PF01873 eIF-5_eIF-2B:  Domain found in IF2B/IF5;  InterPro: IPR002735 The beta subunit of archaeal and eukaryotic translation initiation factor 2 (IF2beta) and the N-terminal domain of translation initiation factor 5 (IF5) show significant sequence homology []. Archaeal IF2beta contains two independent structural domains: an N-terminal mixed alpha/beta core domain (topological similarity to the common core of ribosomal proteins L23 and L15e), and a C-terminal domain consisting of a zinc-binding C4 finger []. Archaeal IF2beta is a ribosome-dependent GTPase that stimulates the binding of initiator Met-tRNA(i)(Met) to the ribosomes, even in the absence of other factors []. The C-terminal domain of eukaryotic IF5 is involved in the formation of the multi-factor complex (MFC), an important intermediate for the 43S pre-initiation complex assembly []. IF5 interacts directly with IF1, IF2beta and IF3c, which together with IF2-bound Met-tRNA(i)(Met) form the MFC. This entry represents both the N-terminal and zinc-binding domains of IF2, as well as a domain in IF5.; GO: 0003743 translation initiation factor activity, 0006413 translational initiation; PDB: 2DCU_B 2D74_B 2E9H_A 2G2K_A 1NEE_A 3CW2_L 2QMU_C 3V11_C 2NXU_A 2QN6_C ....
Probab=57.17  E-value=5.9  Score=28.88  Aligned_cols=29  Identities=31%  Similarity=0.599  Sum_probs=22.9

Q ss_pred             cccccCCCCCCcceecCCCCCcccchhhh
Q psy15323         63 LCCTNCGTRMTTLWRRNNDGEPVCNACGL   91 (139)
Q Consensus        63 ~~C~~C~t~~t~~Wr~~~~g~~lCnaCgl   91 (139)
                      ..|..|+..+|-+-..+.--..-|+|||-
T Consensus        94 VlC~~C~spdT~l~k~~r~~~l~C~aCGa  122 (125)
T PF01873_consen   94 VLCPECGSPDTELIKEGRLIFLKCKACGA  122 (125)
T ss_dssp             SSCTSTSSSSEEEEEETTCCEEEETTTSC
T ss_pred             EEcCCCCCCccEEEEcCCEEEEEecccCC
Confidence            57999999999987774333467999983


No 46 
>PF01783 Ribosomal_L32p:  Ribosomal L32p protein family;  InterPro: IPR002677 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L32p is part of the 50S ribosomal subunit. This family is found in both prokaryotes and eukaryotes. Ribosomal protein L32 of yeast binds to and regulates the splicing and the translation of the transcript of its own gene [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0015934 large ribosomal subunit; PDB: 3PYT_2 3F1F_5 3PYV_2 3D5B_5 3MRZ_2 3D5D_5 3F1H_5 1VSP_Y 3PYR_2 3MS1_2 ....
Probab=56.15  E-value=6.8  Score=24.47  Aligned_cols=27  Identities=33%  Similarity=0.759  Sum_probs=17.8

Q ss_pred             CCCCCccccCCCCCCCceeecCCCCcccccccccc
Q psy15323          5 FGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYH   39 (139)
Q Consensus         5 ~~~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~   39 (139)
                      +.+.-.|.+||.     +..   .+.+|.+||.|.
T Consensus        23 ~~~l~~c~~cg~-----~~~---~H~vc~~cG~y~   49 (56)
T PF01783_consen   23 APNLVKCPNCGE-----PKL---PHRVCPSCGYYK   49 (56)
T ss_dssp             TTSEEESSSSSS-----EES---TTSBCTTTBBSS
T ss_pred             ccceeeeccCCC-----Eec---ccEeeCCCCeEC
Confidence            345567888984     222   246999999664


No 47 
>PRK12336 translation initiation factor IF-2 subunit beta; Provisional
Probab=55.76  E-value=5.4  Score=31.19  Aligned_cols=30  Identities=33%  Similarity=0.631  Sum_probs=23.1

Q ss_pred             ccccCCCCCCCceeecCCCCcccccccccc
Q psy15323         10 ECVNCGAISTPLWRRDGTGHYLCNACGLYH   39 (139)
Q Consensus        10 ~C~nC~~~~tp~WRr~~~g~~lCnaCgly~   39 (139)
                      .|..|+..+|-+=..+..-...|+|||...
T Consensus       100 ~C~~C~~pdT~l~k~~~~~~l~C~aCGa~~  129 (201)
T PRK12336        100 ICSECGLPDTRLVKEDRVLMLRCDACGAHR  129 (201)
T ss_pred             ECCCCCCCCcEEEEcCCeEEEEcccCCCCc
Confidence            699999999999765322246899999954


No 48 
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=55.34  E-value=9.7  Score=20.83  Aligned_cols=28  Identities=36%  Similarity=0.606  Sum_probs=13.4

Q ss_pred             CCccccCCCCCCCceeecCCCCccccccccc
Q psy15323          8 GRECVNCGAISTPLWRRDGTGHYLCNACGLY   38 (139)
Q Consensus         8 ~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly   38 (139)
                      .+.|..||+   |+-.....-..+|.+|+..
T Consensus         3 ~rfC~~CG~---~t~~~~~g~~r~C~~Cg~~   30 (32)
T PF09297_consen    3 HRFCGRCGA---PTKPAPGGWARRCPSCGHE   30 (32)
T ss_dssp             TSB-TTT-----BEEE-SSSS-EEESSSS-E
T ss_pred             CcccCcCCc---cccCCCCcCEeECCCCcCE
Confidence            467889994   3333222225689999873


No 49 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=55.17  E-value=8.9  Score=20.25  Aligned_cols=24  Identities=29%  Similarity=0.807  Sum_probs=15.2

Q ss_pred             cccCCCCCCCceeecCCCCcccccccc
Q psy15323         11 CVNCGAISTPLWRRDGTGHYLCNACGL   37 (139)
Q Consensus        11 C~nC~~~~tp~WRr~~~g~~lCnaCgl   37 (139)
                      |..|+....|.=+   .-.|.|..||.
T Consensus         1 C~sC~~~i~~r~~---~v~f~CPnCG~   24 (24)
T PF07754_consen    1 CTSCGRPIAPREQ---AVPFPCPNCGF   24 (24)
T ss_pred             CccCCCcccCccc---CceEeCCCCCC
Confidence            5667766665432   23688888873


No 50 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=54.76  E-value=9.2  Score=24.18  Aligned_cols=29  Identities=24%  Similarity=0.681  Sum_probs=19.7

Q ss_pred             CCCccccCCCCCCCceeecCCCCccccccccc
Q psy15323          7 EGRECVNCGAISTPLWRRDGTGHYLCNACGLY   38 (139)
Q Consensus         7 ~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly   38 (139)
                      ....|+.||.....   ......+.|..||+.
T Consensus        27 TSq~C~~CG~~~~~---~~~~r~~~C~~Cg~~   55 (69)
T PF07282_consen   27 TSQTCPRCGHRNKK---RRSGRVFTCPNCGFE   55 (69)
T ss_pred             CccCccCccccccc---ccccceEEcCCCCCE
Confidence            56789999975554   122235789999885


No 51 
>PLN03119 putative ADP-ribosylation factor GTPase-activating protein AGD14; Provisional
Probab=54.05  E-value=8.9  Score=35.00  Aligned_cols=34  Identities=26%  Similarity=0.683  Sum_probs=27.8

Q ss_pred             CCCCCccccCCCCCCCceeecCCCCcccccccccc
Q psy15323          5 FGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYH   39 (139)
Q Consensus         5 ~~~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~   39 (139)
                      .+..+.|++|+... |.|=.-.-|-|||-.|.=-.
T Consensus        20 lPgNk~CADCgs~~-P~WASiNlGIFICi~CSGIH   53 (648)
T PLN03119         20 LPPNRRCINCNSLG-PQYVCTTFWTFVCMACSGIH   53 (648)
T ss_pred             CcCCCccccCCCCC-CCceeeccceEEeccchhhh
Confidence            45568999999865 99998888999999997643


No 52 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=53.91  E-value=12  Score=34.47  Aligned_cols=46  Identities=35%  Similarity=0.720  Sum_probs=32.7

Q ss_pred             CCCCCccccCCCCCCCceeecCCCCcccccccccccccCCCCCCCCCccchhhccccCcccccCCCCCCcceec
Q psy15323          5 FGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVKPSKRLTATRRLGLCCTNCGTRMTTLWRR   78 (139)
Q Consensus         5 ~~~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~k~hg~nRP~~kpsKR~~atk~~~~~C~~C~t~~t~~Wr~   78 (139)
                      +..++.|.+||+.-+         ...|..||--       -|            .....|.+||+...+.|..
T Consensus        12 ~~~akFC~~CG~~l~---------~~~Cp~CG~~-------~~------------~~~~fC~~CG~~~~~~~~~   57 (645)
T PRK14559         12 PNNNRFCQKCGTSLT---------HKPCPQCGTE-------VP------------VDEAHCPNCGAETGTIWWA   57 (645)
T ss_pred             CCCCccccccCCCCC---------CCcCCCCCCC-------CC------------cccccccccCCcccchhhh
Confidence            456899999996543         1369999873       11            1234799999999888874


No 53 
>COG3529 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=53.18  E-value=4.2  Score=26.41  Aligned_cols=33  Identities=33%  Similarity=0.693  Sum_probs=25.5

Q ss_pred             cCcccccCCCCCCc-ceecCCCCCcccchhhhhH
Q psy15323         61 LGLCCTNCGTRMTT-LWRRNNDGEPVCNACGLYY   93 (139)
Q Consensus        61 ~~~~C~~C~t~~t~-~Wr~~~~g~~lCnaCgly~   93 (139)
                      .+..|..|.+..|- +|+.+.-...-|-+||.-.
T Consensus         9 AGA~CP~C~~~Dtl~mW~En~ve~vECV~CG~~~   42 (66)
T COG3529           9 AGAVCPACQAQDTLAMWRENNVEIVECVKCGHHM   42 (66)
T ss_pred             ccCCCcccchhhHHHHHHhcCCceEehhhcchHh
Confidence            46789999998886 7776555557899999754


No 54 
>PRK12336 translation initiation factor IF-2 subunit beta; Provisional
Probab=52.59  E-value=5.7  Score=31.07  Aligned_cols=30  Identities=30%  Similarity=0.581  Sum_probs=22.4

Q ss_pred             CcccccCCCCCCcceecCCCCCcccchhhh
Q psy15323         62 GLCCTNCGTRMTTLWRRNNDGEPVCNACGL   91 (139)
Q Consensus        62 ~~~C~~C~t~~t~~Wr~~~~g~~lCnaCgl   91 (139)
                      -..|..|+..+|.+-..+.--..-|+|||-
T Consensus        98 yV~C~~C~~pdT~l~k~~~~~~l~C~aCGa  127 (201)
T PRK12336         98 YVICSECGLPDTRLVKEDRVLMLRCDACGA  127 (201)
T ss_pred             eEECCCCCCCCcEEEEcCCeEEEEcccCCC
Confidence            468999999999996653222357999984


No 55 
>KOG3740|consensus
Probab=52.27  E-value=5.4  Score=36.62  Aligned_cols=34  Identities=24%  Similarity=0.637  Sum_probs=29.1

Q ss_pred             CCCCccccCCCCCCCceeecCCC----Ccccccccccc
Q psy15323          6 GEGRECVNCGAISTPLWRRDGTG----HYLCNACGLYH   39 (139)
Q Consensus         6 ~~~~~C~nC~~~~tp~WRr~~~g----~~lCnaCgly~   39 (139)
                      .++-.|.-|.+..||.|.....+    .++|.+|.-..
T Consensus       460 ~~P~~caqcktdftp~wk~ekstq~d~~i~cE~cvtSn  497 (706)
T KOG3740|consen  460 TEPYACAQCKTDFTPAWKKEKSTQADAAIVCENCVTSN  497 (706)
T ss_pred             CCchhhhhcccccccccccccccCcchHHHHHhhhhhc
Confidence            35678999999999999987776    68999998854


No 56 
>PLN03131 hypothetical protein; Provisional
Probab=51.43  E-value=10  Score=34.89  Aligned_cols=33  Identities=21%  Similarity=0.631  Sum_probs=27.2

Q ss_pred             CCCCCccccCCCCCCCceeecCCCCccccccccc
Q psy15323          5 FGEGRECVNCGAISTPLWRRDGTGHYLCNACGLY   38 (139)
Q Consensus         5 ~~~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly   38 (139)
                      .+..+.|++|++. -|.|=.-.-|.|||..|.--
T Consensus        20 ~PgNk~CADCga~-~P~WASiNlGIFICi~CSGI   52 (705)
T PLN03131         20 LPPNRRCINCNSL-GPQFVCTNFWTFICMTCSGI   52 (705)
T ss_pred             CcCCCccccCCCC-CCCeeEeccceEEchhchhh
Confidence            4567899999975 59999877899999999753


No 57 
>PF01412 ArfGap:  Putative GTPase activating protein for Arf;  InterPro: IPR001164  This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins []. The GTP-bound form of ARF is essential for the maintenance of normal Golgi morphology, it participates in recruitment of coat proteins which are required for budding and fission of membranes. Before the fusion with an acceptor compartment the membrane must be uncoated. This step required the hydrolysis of GTP associated to ARF. These proteins contain a characteristic zinc finger motif (Cys-x2-Cys-x(16,17)-x2-Cys) which displays some similarity to the C4-type GATA zinc finger. The ARFGAP domain display no obvious similarity to other GAP proteins.  The 3D structure of the ARFGAP domain of the PYK2-associated protein beta has been solved []. It consists of a three-stranded beta-sheet surrounded by 5 alpha helices. The domain is organised around a central zinc atom which is coordinated by 4 cysteines. The ARFGAP domain is clearly unrelated to the other GAP proteins structures which are exclusively helical. Classical GAP proteins accelerate GTPase activity by supplying an arginine finger to the active site. The crystal structure of ARFGAP bound to ARF revealed that the ARFGAP domain does not supply an arginine to the active site which suggests a more indirect role of the ARFGAP domain in the GTPase hydrolysis []. The Rev protein of human immunodeficiency virus type 1 (HIV-1) facilitates nuclear export of unspliced and partly-spliced viral RNAs []. Rev contains an RNA-binding domain and an effector domain; the latter is believed to interact with a cellular cofactor required for the Rev response and hence HIV-1 replication. Human Rev interacting protein (hRIP) specifically interacts with the Rev effector. The amino acid sequence of hRIP is characterised by an N-terminal, C-4 class zinc finger motif.; GO: 0008060 ARF GTPase activator activity, 0008270 zinc ion binding, 0032312 regulation of ARF GTPase activity; PDB: 2P57_A 2CRR_A 2OWA_B 3O47_B 3DWD_A 1DCQ_A 2CRW_A 3MDB_D 3FEH_A 3LJU_X ....
Probab=51.27  E-value=15  Score=25.96  Aligned_cols=37  Identities=22%  Similarity=0.438  Sum_probs=25.5

Q ss_pred             ccCcccccCCCCCCcceecCCCCCcccchhhhhHHhhC
Q psy15323         60 RLGLCCTNCGTRMTTLWRRNNDGEPVCNACGLYYKLHN   97 (139)
Q Consensus        60 ~~~~~C~~C~t~~t~~Wr~~~~g~~lCnaCgly~~~~~   97 (139)
                      .....|+.|+. .-|.|-.-+-|-.||-.|.--.+..+
T Consensus        11 ~~N~~CaDCg~-~~p~w~s~~~GiflC~~Cag~HR~lg   47 (116)
T PF01412_consen   11 PGNKVCADCGA-PNPTWASLNYGIFLCLECAGIHRSLG   47 (116)
T ss_dssp             TTCTB-TTT-S-BS--EEETTTTEEE-HHHHHHHHHHT
T ss_pred             cCcCcCCCCCC-CCCCEEEeecChhhhHHHHHHHHHhc
Confidence            45678999996 55699888888899999987777666


No 58 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=51.18  E-value=9.9  Score=22.74  Aligned_cols=24  Identities=25%  Similarity=0.591  Sum_probs=17.3

Q ss_pred             ccccCCCCCCCceeecCCCCcccccccc
Q psy15323         10 ECVNCGAISTPLWRRDGTGHYLCNACGL   37 (139)
Q Consensus        10 ~C~nC~~~~tp~WRr~~~g~~lCnaCgl   37 (139)
                      .|.+||++.+..    ..+..-|..||.
T Consensus         4 ~C~~Cg~~~~~~----~~~~irC~~CG~   27 (44)
T smart00659        4 ICGECGRENEIK----SKDVVRCRECGY   27 (44)
T ss_pred             ECCCCCCEeecC----CCCceECCCCCc
Confidence            689999866544    334578999987


No 59 
>PRK11827 hypothetical protein; Provisional
Probab=50.83  E-value=16  Score=23.50  Aligned_cols=33  Identities=21%  Similarity=0.603  Sum_probs=21.6

Q ss_pred             ccccCCCCCCCceeecCCCCcccccccc-cccccCCC
Q psy15323         10 ECVNCGAISTPLWRRDGTGHYLCNACGL-YHKMNGMN   45 (139)
Q Consensus        10 ~C~nC~~~~tp~WRr~~~g~~lCnaCgl-y~k~hg~n   45 (139)
                      .|-.|.   +++.-.....+.+|.+|++ |....|..
T Consensus        10 aCP~ck---g~L~~~~~~~~Lic~~~~laYPI~dgIP   43 (60)
T PRK11827         10 ACPVCN---GKLWYNQEKQELICKLDNLAFPLRDGIP   43 (60)
T ss_pred             ECCCCC---CcCeEcCCCCeEECCccCeeccccCCcc
Confidence            455554   7776544455799999999 55555543


No 60 
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=50.22  E-value=6.2  Score=24.96  Aligned_cols=56  Identities=27%  Similarity=0.634  Sum_probs=24.2

Q ss_pred             CCCccccCCCCCCCceeecCCCCcccccccccccccCCCCCCCCCccchhhccccCcccccCCCCCCcce--ecCCCC-C
Q psy15323          7 EGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVKPSKRLTATRRLGLCCTNCGTRMTTLW--RRNNDG-E   83 (139)
Q Consensus         7 ~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~k~hg~nRP~~kpsKR~~atk~~~~~C~~C~t~~t~~W--r~~~~g-~   83 (139)
                      +...|..|+..-+-+-|+     ..|-.||.                         .+|..|......+.  ..+... .
T Consensus         8 ~~~~C~~C~~~F~~~~rr-----hhCr~CG~-------------------------~vC~~Cs~~~~~~~~~~~~~~~~~   57 (69)
T PF01363_consen    8 EASNCMICGKKFSLFRRR-----HHCRNCGR-------------------------VVCSSCSSQRIPLPTPSSGSGEPV   57 (69)
T ss_dssp             G-SB-TTT--B-BSSS-E-----EE-TTT---------------------------EEECCCS-EEEEET--GGTESEEE
T ss_pred             CCCcCcCcCCcCCCceee-----EccCCCCC-------------------------EECCchhCCEEcccccccCCCCcC
Confidence            466788888766444333     45666665                         35666666665554  111111 2


Q ss_pred             cccchhhhh
Q psy15323         84 PVCNACGLY   92 (139)
Q Consensus        84 ~lCnaCgly   92 (139)
                      .+|+.|...
T Consensus        58 RvC~~C~~~   66 (69)
T PF01363_consen   58 RVCDSCYSK   66 (69)
T ss_dssp             EE-HHHHHH
T ss_pred             EECHHHHHH
Confidence            678888643


No 61 
>KOG2907|consensus
Probab=50.11  E-value=7.8  Score=28.08  Aligned_cols=82  Identities=20%  Similarity=0.374  Sum_probs=47.2

Q ss_pred             CCCccccCCCCCCCceeecCCCCccccccccccccc-CCC-----------CCCCCCccch----hhccccCcccccCCC
Q psy15323          7 EGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMN-GMN-----------RPLVKPSKRL----TATRRLGLCCTNCGT   70 (139)
Q Consensus         7 ~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~k~h-g~n-----------RP~~kpsKR~----~atk~~~~~C~~C~t   70 (139)
                      ....|+.||+.   |--.+....++|-.|..-+-.. -.+           .+.....+..    .....+...|..|+-
T Consensus         6 ~~~FC~~CG~l---l~~~~~~~~~~C~~Ck~~~~v~~~~~~~v~~~~~~~~~~~A~~~~ve~~~~~~ga~I~~kCpkCgh   82 (116)
T KOG2907|consen    6 DLDFCSDCGSL---LEEPSAQSTVLCIRCKIEYPVSQFSGLVVETKSLFDEFTSALAEKVENESSADGAVIKHKCPKCGH   82 (116)
T ss_pred             Ccchhhhhhhh---cccccccCceEeccccccCCHHHhCCeeEEEEEeecccchhhhhhhcccccccccchhccCcccCC
Confidence            67789999963   2222333446799999844221 111           1111111110    112345678999998


Q ss_pred             CC----CcceecCCCCC---cccchhhh
Q psy15323         71 RM----TTLWRRNNDGE---PVCNACGL   91 (139)
Q Consensus        71 ~~----t~~Wr~~~~g~---~lCnaCgl   91 (139)
                      .+    |-.-|..++|+   +.|-.|+.
T Consensus        83 e~m~Y~T~QlRSADEGQTVFYTC~kC~~  110 (116)
T KOG2907|consen   83 EEMSYHTLQLRSADEGQTVFYTCPKCKY  110 (116)
T ss_pred             chhhhhhhhcccccCCceEEEEcCccce
Confidence            77    55677788887   56888875


No 62 
>PRK08351 DNA-directed RNA polymerase subunit E''; Validated
Probab=49.22  E-value=11  Score=24.24  Aligned_cols=16  Identities=25%  Similarity=0.690  Sum_probs=12.2

Q ss_pred             CCccccCCCCC-CCcee
Q psy15323          8 GRECVNCGAIS-TPLWR   23 (139)
Q Consensus         8 ~~~C~nC~~~~-tp~WR   23 (139)
                      ...|.|||.+. |.-|.
T Consensus        15 ~~~CP~Cgs~~~T~~W~   31 (61)
T PRK08351         15 EDRCPVCGSRDLSDEWF   31 (61)
T ss_pred             CCcCCCCcCCccccccc
Confidence            44788888877 77887


No 63 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=48.53  E-value=10  Score=22.72  Aligned_cols=27  Identities=22%  Similarity=0.539  Sum_probs=11.2

Q ss_pred             ccccCCCCCCCceeecC-CCCcccccccc
Q psy15323         10 ECVNCGAISTPLWRRDG-TGHYLCNACGL   37 (139)
Q Consensus        10 ~C~nC~~~~tp~WRr~~-~g~~lCnaCgl   37 (139)
                      .|.+|+.+-+ .|+... +....|..||-
T Consensus         7 ~C~~Cg~~fe-~~~~~~~~~~~~CP~Cg~   34 (52)
T TIGR02605         7 RCTACGHRFE-VLQKMSDDPLATCPECGG   34 (52)
T ss_pred             EeCCCCCEeE-EEEecCCCCCCCCCCCCC
Confidence            3555554333 333322 12334555554


No 64 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=48.24  E-value=15  Score=23.57  Aligned_cols=31  Identities=29%  Similarity=0.662  Sum_probs=21.1

Q ss_pred             CCCCCccccCCCCCCCceeecCCCCccccccccc
Q psy15323          5 FGEGRECVNCGAISTPLWRRDGTGHYLCNACGLY   38 (139)
Q Consensus         5 ~~~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly   38 (139)
                      .....+|.-|+...+|.=+   .-.|.|..||-.
T Consensus         4 ~~~~~~CtSCg~~i~~~~~---~~~F~CPnCG~~   34 (59)
T PRK14890          4 MMEPPKCTSCGIEIAPREK---AVKFLCPNCGEV   34 (59)
T ss_pred             cccCccccCCCCcccCCCc---cCEeeCCCCCCe
Confidence            3456689999977665422   236899999864


No 65 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=48.07  E-value=11  Score=24.39  Aligned_cols=27  Identities=26%  Similarity=0.576  Sum_probs=19.4

Q ss_pred             CCccccCCCCCCCceeecCCCCcccccccc
Q psy15323          8 GRECVNCGAISTPLWRRDGTGHYLCNACGL   37 (139)
Q Consensus         8 ~~~C~nC~~~~tp~WRr~~~g~~lCnaCgl   37 (139)
                      ..+|..||...+|.=+   ...|+|..||-
T Consensus         9 ~~~CtSCg~~i~p~e~---~v~F~CPnCGe   35 (61)
T COG2888           9 PPVCTSCGREIAPGET---AVKFPCPNCGE   35 (61)
T ss_pred             CceeccCCCEeccCCc---eeEeeCCCCCc
Confidence            6799999977665322   23689999994


No 66 
>TIGR01031 rpmF_bact ribosomal protein L32. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus.
Probab=47.63  E-value=14  Score=23.05  Aligned_cols=28  Identities=32%  Similarity=0.724  Sum_probs=18.0

Q ss_pred             CCCCCCccccCCCCCCCceeecCCCCcccccccccc
Q psy15323          4 QFGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYH   39 (139)
Q Consensus         4 ~~~~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~   39 (139)
                      .++..-.|.+||...     .   -+.+|..||.|.
T Consensus        22 ~~p~l~~C~~cG~~~-----~---~H~vc~~cG~Y~   49 (55)
T TIGR01031        22 TAPTLVVCPNCGEFK-----L---PHRVCPSCGYYK   49 (55)
T ss_pred             cCCcceECCCCCCcc-----c---CeeECCccCeEC
Confidence            345556788888422     1   246899999764


No 67 
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=47.29  E-value=9  Score=22.14  Aligned_cols=30  Identities=23%  Similarity=0.672  Sum_probs=17.4

Q ss_pred             ccccCCCCCCCceee----cCCC---Ccccccccccc
Q psy15323         10 ECVNCGAISTPLWRR----DGTG---HYLCNACGLYH   39 (139)
Q Consensus        10 ~C~nC~~~~tp~WRr----~~~g---~~lCnaCgly~   39 (139)
                      .|.+|+..++-.|..    ++++   -+.|..|+-.+
T Consensus         2 ~Cp~Cg~~~a~~~~~Q~rsaDE~~T~fy~C~~C~~~w   38 (39)
T PF01096_consen    2 KCPKCGHNEAVFFQIQTRSADEPMTLFYVCCNCGHRW   38 (39)
T ss_dssp             --SSS-SSEEEEEEESSSSSSSSSEEEEEESSSTEEE
T ss_pred             CCcCCCCCeEEEEEeeccCCCCCCeEEEEeCCCCCee
Confidence            588899888777642    2233   25888888644


No 68 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=47.03  E-value=11  Score=21.27  Aligned_cols=8  Identities=50%  Similarity=1.410  Sum_probs=3.7

Q ss_pred             cccccccc
Q psy15323         30 YLCNACGL   37 (139)
Q Consensus        30 ~lCnaCgl   37 (139)
                      |.|..||.
T Consensus         6 y~C~~Cg~   13 (41)
T smart00834        6 YRCEDCGH   13 (41)
T ss_pred             EEcCCCCC
Confidence            34444444


No 69 
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=46.90  E-value=13  Score=23.14  Aligned_cols=30  Identities=20%  Similarity=0.392  Sum_probs=17.5

Q ss_pred             CCccccCCCCCCCceeecCCC-Ccccccccc
Q psy15323          8 GRECVNCGAISTPLWRRDGTG-HYLCNACGL   37 (139)
Q Consensus         8 ~~~C~nC~~~~tp~WRr~~~g-~~lCnaCgl   37 (139)
                      +.+|.+|..-..-.-...... .|.|-.||.
T Consensus        22 aLIC~~C~~hNGla~~~~~~~i~y~C~~Cg~   52 (54)
T PF10058_consen   22 ALICSKCFSHNGLAPKEEFEEIQYRCPYCGA   52 (54)
T ss_pred             eEECcccchhhcccccccCCceEEEcCCCCC
Confidence            667777776544433333322 567777765


No 70 
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=46.52  E-value=13  Score=21.58  Aligned_cols=30  Identities=23%  Similarity=0.733  Sum_probs=19.1

Q ss_pred             ccccCCCCCCCcee----ecCCC---Ccccccccccc
Q psy15323         10 ECVNCGAISTPLWR----RDGTG---HYLCNACGLYH   39 (139)
Q Consensus        10 ~C~nC~~~~tp~WR----r~~~g---~~lCnaCgly~   39 (139)
                      .|.+|+-.+.-.|.    .++++   -+.|..|+..+
T Consensus         2 ~Cp~C~~~~a~~~q~Q~RsaDE~mT~fy~C~~C~~~w   38 (40)
T smart00440        2 PCPKCGNREATFFQLQTRSADEPMTVFYVCTKCGHRW   38 (40)
T ss_pred             cCCCCCCCeEEEEEEcccCCCCCCeEEEEeCCCCCEe
Confidence            58888877766664    23333   25888888654


No 71 
>PHA00626 hypothetical protein
Probab=45.18  E-value=9.9  Score=24.31  Aligned_cols=32  Identities=25%  Similarity=0.538  Sum_probs=20.1

Q ss_pred             ccccCCCCCCccee--cCCCCCcccchhhhhHHh
Q psy15323         64 CCTNCGTRMTTLWR--RNNDGEPVCNACGLYYKL   95 (139)
Q Consensus        64 ~C~~C~t~~t~~Wr--~~~~g~~lCnaCgly~~~   95 (139)
                      .|++|+..+-.+--  +.+...++|..||.++.+
T Consensus         2 ~CP~CGS~~Ivrcg~cr~~snrYkCkdCGY~ft~   35 (59)
T PHA00626          2 SCPKCGSGNIAKEKTMRGWSDDYVCCDCGYNDSK   35 (59)
T ss_pred             CCCCCCCceeeeeceecccCcceEcCCCCCeech
Confidence            58888885322111  234456999999987743


No 72 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=45.00  E-value=13  Score=19.13  Aligned_cols=6  Identities=83%  Similarity=1.885  Sum_probs=2.8

Q ss_pred             cccCCC
Q psy15323         11 CVNCGA   16 (139)
Q Consensus        11 C~nC~~   16 (139)
                      |.+||.
T Consensus         2 Cp~CG~    7 (23)
T PF13240_consen    2 CPNCGA    7 (23)
T ss_pred             CcccCC
Confidence            445553


No 73 
>PF09526 DUF2387:  Probable metal-binding protein (DUF2387);  InterPro: IPR012658 Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various proteobacteria.
Probab=44.38  E-value=15  Score=24.28  Aligned_cols=37  Identities=24%  Similarity=0.485  Sum_probs=27.1

Q ss_pred             CCccccCCCCCCCceeecCCC-CcccccccccccccCC
Q psy15323          8 GRECVNCGAISTPLWRRDGTG-HYLCNACGLYHKMNGM   44 (139)
Q Consensus         8 ~~~C~nC~~~~tp~WRr~~~g-~~lCnaCgly~k~hg~   44 (139)
                      +-+|-.|++..|=.|.+..+. ..-|.+||....+...
T Consensus         8 Ga~CP~C~~~D~i~~~~e~~ve~vECV~CGy~e~~~~~   45 (71)
T PF09526_consen    8 GAVCPKCQAMDTIMMWRENGVEYVECVECGYTERQPDQ   45 (71)
T ss_pred             CccCCCCcCccEEEEEEeCCceEEEecCCCCeeccCCc
Confidence            558999999888755544434 5689999997766544


No 74 
>KOG3740|consensus
Probab=43.98  E-value=8.8  Score=35.30  Aligned_cols=32  Identities=25%  Similarity=0.675  Sum_probs=27.0

Q ss_pred             ccCcccccCCCCCCcceecCCCC----Ccccchhhh
Q psy15323         60 RLGLCCTNCGTRMTTLWRRNNDG----EPVCNACGL   91 (139)
Q Consensus        60 ~~~~~C~~C~t~~t~~Wr~~~~g----~~lCnaCgl   91 (139)
                      ...-.|..|.|..||.|+.-..+    .++|..|.-
T Consensus       460 ~~P~~caqcktdftp~wk~ekstq~d~~i~cE~cvt  495 (706)
T KOG3740|consen  460 TEPYACAQCKTDFTPAWKKEKSTQADAAIVCENCVT  495 (706)
T ss_pred             CCchhhhhcccccccccccccccCcchHHHHHhhhh
Confidence            34668999999999999987776    589999963


No 75 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=43.57  E-value=20  Score=20.02  Aligned_cols=24  Identities=29%  Similarity=0.578  Sum_probs=12.1

Q ss_pred             ccccCCCCCCCceeecCCCCcccccccc
Q psy15323         10 ECVNCGAISTPLWRRDGTGHYLCNACGL   37 (139)
Q Consensus        10 ~C~nC~~~~tp~WRr~~~g~~lCnaCgl   37 (139)
                      .|.+|+++..    -......-|..||.
T Consensus         2 ~C~~Cg~~~~----~~~~~~irC~~CG~   25 (32)
T PF03604_consen    2 ICGECGAEVE----LKPGDPIRCPECGH   25 (32)
T ss_dssp             BESSSSSSE-----BSTSSTSSBSSSS-
T ss_pred             CCCcCCCeeE----cCCCCcEECCcCCC
Confidence            4677776555    11222456777765


No 76 
>PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated
Probab=43.54  E-value=16  Score=23.79  Aligned_cols=16  Identities=25%  Similarity=0.470  Sum_probs=12.1

Q ss_pred             CCccccCCCCC-CCcee
Q psy15323          8 GRECVNCGAIS-TPLWR   23 (139)
Q Consensus         8 ~~~C~nC~~~~-tp~WR   23 (139)
                      ...|.+||.+. |+.|.
T Consensus        17 ~~~Cp~Cgs~~~S~~w~   33 (64)
T PRK06393         17 EKTCPVHGDEKTTTEWF   33 (64)
T ss_pred             CCcCCCCCCCcCCcCcc
Confidence            45788888877 66776


No 77 
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=43.22  E-value=17  Score=20.96  Aligned_cols=32  Identities=31%  Similarity=0.728  Sum_probs=19.6

Q ss_pred             CCccccCCCCCCCceeecCCC-Ccccccccccc
Q psy15323          8 GRECVNCGAISTPLWRRDGTG-HYLCNACGLYH   39 (139)
Q Consensus         8 ~~~C~nC~~~~tp~WRr~~~g-~~lCnaCgly~   39 (139)
                      +..|.+|++-.-|.=.-+..+ ...||-|+...
T Consensus         2 p~rC~~C~aylNp~~~~~~~~~~w~C~~C~~~N   34 (40)
T PF04810_consen    2 PVRCRRCRAYLNPFCQFDDGGKTWICNFCGTKN   34 (40)
T ss_dssp             S-B-TTT--BS-TTSEEETTTTEEEETTT--EE
T ss_pred             ccccCCCCCEECCcceEcCCCCEEECcCCCCcC
Confidence            457999999999988877765 57999998743


No 78 
>COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription]
Probab=43.10  E-value=16  Score=30.31  Aligned_cols=29  Identities=28%  Similarity=0.708  Sum_probs=20.1

Q ss_pred             CccccCCCCCCCceeecCCCCcccccccccc
Q psy15323          9 RECVNCGAISTPLWRRDGTGHYLCNACGLYH   39 (139)
Q Consensus         9 ~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~   39 (139)
                      ..|.+|+.+  -+=..-..|+.+|-.||+--
T Consensus         2 ~~CpeCg~~--~~~~d~~~ge~VC~~CG~Vi   30 (285)
T COG1405           2 MSCPECGST--NIITDYERGEIVCADCGLVL   30 (285)
T ss_pred             CCCCCCCCc--cceeeccCCeEEeccCCEEe
Confidence            479999987  22222236899999999953


No 79 
>PF06689 zf-C4_ClpX:  ClpX C4-type zinc finger;  InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The ClpX heat shock protein of Escherichia coli is a member of the universally conserved Hsp100 family of proteins, and possesses a putative zinc finger motif of the C4 type []. This presumed zinc binding domain (ZBD) is found at the N terminus of the ClpX protein. ClpX is an ATPase which functions both as a substrate specificity component of the ClpXP protease and as a molecular chaperone. ZBD is a member of the treble clef zinc finger family, a motif known to facilitate protein-ligand, protein-DNA, and protein-protein interactions and forms a constitutive dimer that is essential for the degradation of some, but not all, ClpX substrates []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0016887 ATPase activity, 0046983 protein dimerization activity, 0006200 ATP catabolic process, 0019538 protein metabolic process; PDB: 2DS8_B 2DS6_B 2DS5_A 1OVX_A 2DS7_A.
Probab=43.04  E-value=8.4  Score=22.54  Aligned_cols=29  Identities=28%  Similarity=0.729  Sum_probs=17.7

Q ss_pred             CccccCCCCCCCcee--ecCCCCcccccccc
Q psy15323          9 RECVNCGAISTPLWR--RDGTGHYLCNACGL   37 (139)
Q Consensus         9 ~~C~nC~~~~tp~WR--r~~~g~~lCnaCgl   37 (139)
                      +.|+=||.+.+..=+  .++++.++|+.|-.
T Consensus         2 ~~CSFCgr~~~~v~~li~g~~~~~IC~~Cv~   32 (41)
T PF06689_consen    2 KRCSFCGRPESEVGRLISGPNGAYICDECVE   32 (41)
T ss_dssp             -B-TTT--BTTTSSSEEEES-SEEEEHHHHH
T ss_pred             CCccCCCCCHHHHhceecCCCCcEECHHHHH
Confidence            478999998875433  56667889999865


No 80 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=42.77  E-value=18  Score=25.77  Aligned_cols=31  Identities=35%  Similarity=0.722  Sum_probs=17.0

Q ss_pred             CCCCCccccCCCCCCCceeecCCCCcccccccccc
Q psy15323          5 FGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYH   39 (139)
Q Consensus         5 ~~~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~   39 (139)
                      .|..++|.+||+...-|=+ .|   .+|.-||--+
T Consensus         6 lGtKR~Cp~CG~kFYDLnk-~P---ivCP~CG~~~   36 (108)
T PF09538_consen    6 LGTKRTCPSCGAKFYDLNK-DP---IVCPKCGTEF   36 (108)
T ss_pred             cCCcccCCCCcchhccCCC-CC---ccCCCCCCcc
Confidence            4556666666655554444 22   4566666643


No 81 
>KOG1598|consensus
Probab=42.15  E-value=16  Score=32.84  Aligned_cols=28  Identities=39%  Similarity=0.873  Sum_probs=20.4

Q ss_pred             CccccCCCCCCCceeecCCCCccccccccc
Q psy15323          9 RECVNCGAISTPLWRRDGTGHYLCNACGLY   38 (139)
Q Consensus         9 ~~C~nC~~~~tp~WRr~~~g~~lCnaCgly   38 (139)
                      ..|.||+.+.  +=++..+|...|.+||.-
T Consensus         1 ~~C~~C~~s~--fe~d~a~g~~~C~~CG~v   28 (521)
T KOG1598|consen    1 MVCKNCGGSN--FERDEATGNLYCTACGTV   28 (521)
T ss_pred             CcCCCCCCCC--cccccccCCceeccccce
Confidence            3699999543  233445789999999984


No 82 
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=42.11  E-value=23  Score=35.20  Aligned_cols=21  Identities=38%  Similarity=0.787  Sum_probs=13.9

Q ss_pred             CccccCCCCCCCceeecCCCCccccccccc
Q psy15323          9 RECVNCGAISTPLWRRDGTGHYLCNACGLY   38 (139)
Q Consensus         9 ~~C~nC~~~~tp~WRr~~~g~~lCnaCgly   38 (139)
                      +.|-+||+. |+.        ..|..||-.
T Consensus       668 rkCPkCG~~-t~~--------~fCP~CGs~  688 (1337)
T PRK14714        668 RRCPSCGTE-TYE--------NRCPDCGTH  688 (1337)
T ss_pred             EECCCCCCc-ccc--------ccCcccCCc
Confidence            688899874 222        267778764


No 83 
>PF09526 DUF2387:  Probable metal-binding protein (DUF2387);  InterPro: IPR012658 Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various proteobacteria.
Probab=41.17  E-value=15  Score=24.22  Aligned_cols=35  Identities=29%  Similarity=0.526  Sum_probs=25.9

Q ss_pred             cCcccccCCCCCCcceecCCCCC-cccchhhhhHHh
Q psy15323         61 LGLCCTNCGTRMTTLWRRNNDGE-PVCNACGLYYKL   95 (139)
Q Consensus        61 ~~~~C~~C~t~~t~~Wr~~~~g~-~lCnaCgly~~~   95 (139)
                      .+..|..|....+..|-+.++-+ .-|=+||.....
T Consensus         7 AGa~CP~C~~~D~i~~~~e~~ve~vECV~CGy~e~~   42 (71)
T PF09526_consen    7 AGAVCPKCQAMDTIMMWRENGVEYVECVECGYTERQ   42 (71)
T ss_pred             cCccCCCCcCccEEEEEEeCCceEEEecCCCCeecc
Confidence            47789999999998655544454 679999965443


No 84 
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=40.63  E-value=21  Score=21.88  Aligned_cols=26  Identities=23%  Similarity=0.635  Sum_probs=17.2

Q ss_pred             CCccccCCCCCCCceeecCCCCcccccccc
Q psy15323          8 GRECVNCGAISTPLWRRDGTGHYLCNACGL   37 (139)
Q Consensus         8 ~~~C~nC~~~~tp~WRr~~~g~~lCnaCgl   37 (139)
                      .+.|.+||.+  =+..  ..+.+.|..||.
T Consensus        20 ~~fCP~Cg~~--~m~~--~~~r~~C~~Cgy   45 (50)
T PRK00432         20 NKFCPRCGSG--FMAE--HLDRWHCGKCGY   45 (50)
T ss_pred             cCcCcCCCcc--hhec--cCCcEECCCcCC
Confidence            4588888863  2222  236788888887


No 85 
>PRK11823 DNA repair protein RadA; Provisional
Probab=39.66  E-value=17  Score=31.59  Aligned_cols=29  Identities=31%  Similarity=0.850  Sum_probs=21.6

Q ss_pred             CCccccCCCCCCCceeecCCCCcccccccccccccC
Q psy15323          8 GRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNG   43 (139)
Q Consensus         8 ~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~k~hg   43 (139)
                      .-+|.+||.+ ++.|.-      .|++|+-|..+..
T Consensus         7 ~y~C~~Cg~~-~~~~~g------~Cp~C~~w~t~~e   35 (446)
T PRK11823          7 AYVCQECGAE-SPKWLG------RCPECGAWNTLVE   35 (446)
T ss_pred             eEECCcCCCC-CcccCe------eCcCCCCccceee
Confidence            4589999965 566653      6999999876654


No 86 
>TIGR02443 conserved hypothetical metal-binding protein. Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N-terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various Proteobacteria.
Probab=38.64  E-value=20  Score=23.03  Aligned_cols=34  Identities=26%  Similarity=0.674  Sum_probs=24.4

Q ss_pred             CCccccCCCCCCC-ceeecCCCCcccccccccccc
Q psy15323          8 GRECVNCGAISTP-LWRRDGTGHYLCNACGLYHKM   41 (139)
Q Consensus         8 ~~~C~nC~~~~tp-~WRr~~~g~~lCnaCgly~k~   41 (139)
                      +-+|-.|++-.|= +|+.+.....-|.+||....+
T Consensus         9 GA~CP~C~~~Dtl~~~~e~~~e~vECv~Cg~~~~~   43 (59)
T TIGR02443         9 GAVCPACSAQDTLAMWKENNIELVECVECGYQEQQ   43 (59)
T ss_pred             cccCCCCcCccEEEEEEeCCceEEEeccCCCcccc
Confidence            4589999997776 555444445789999996543


No 87 
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=37.93  E-value=21  Score=30.48  Aligned_cols=27  Identities=30%  Similarity=0.931  Sum_probs=20.7

Q ss_pred             ccccCCCCCCCceeecCCCCcccccccccccccC
Q psy15323         10 ECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNG   43 (139)
Q Consensus        10 ~C~nC~~~~tp~WRr~~~g~~lCnaCgly~k~hg   43 (139)
                      +|.+||.+ ++.|.-      -|.+|+-|..+..
T Consensus         2 ~c~~cg~~-~~~~~g------~cp~c~~w~~~~e   28 (372)
T cd01121           2 VCSECGYV-SPKWLG------KCPECGEWNTLVE   28 (372)
T ss_pred             CCCCCCCC-CCCccE------ECcCCCCceeeee
Confidence            69999965 566663      6999999876654


No 88 
>PRK00423 tfb transcription initiation factor IIB; Reviewed
Probab=37.90  E-value=17  Score=29.98  Aligned_cols=17  Identities=29%  Similarity=0.907  Sum_probs=10.1

Q ss_pred             CcccccCCC-------CCCcceec
Q psy15323         62 GLCCTNCGT-------RMTTLWRR   78 (139)
Q Consensus        62 ~~~C~~C~t-------~~t~~Wr~   78 (139)
                      ..+|.+||+       .+.|.||.
T Consensus        30 e~vC~~CG~Vl~e~~iD~g~EWR~   53 (310)
T PRK00423         30 EIVCADCGLVIEENIIDQGPEWRA   53 (310)
T ss_pred             eEeecccCCcccccccccCCCccC
Confidence            456777766       23566664


No 89 
>PRK01110 rpmF 50S ribosomal protein L32; Validated
Probab=36.96  E-value=21  Score=22.70  Aligned_cols=26  Identities=19%  Similarity=0.176  Sum_probs=16.2

Q ss_pred             CCCCCccccCCCCCCCceeecCCCCcccccccccc
Q psy15323          5 FGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYH   39 (139)
Q Consensus         5 ~~~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~   39 (139)
                      ++..-+|.+||...-|        +.+|. ||+|.
T Consensus        24 ~~~~~~c~~cg~~~~p--------H~vc~-cG~Y~   49 (60)
T PRK01110         24 APTLSVDKTTGEYHLP--------HHVSP-KGYYK   49 (60)
T ss_pred             CCceeEcCCCCceecc--------ceecC-CcccC
Confidence            3445678888843322        35788 88875


No 90 
>PF08273 Prim_Zn_Ribbon:  Zinc-binding domain of primase-helicase;  InterPro: IPR013237 This entry is represented by bacteriophage T7 Gp4. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry represents a zinc binding domain found in the N-terminal region of the bacteriophage T7 Gp4 and P4 alpha protein. P4 is a multifunctional protein with origin recognition, helicase and primase activities [, , ].; GO: 0003896 DNA primase activity, 0004386 helicase activity, 0008270 zinc ion binding; PDB: 1NUI_B.
Probab=36.87  E-value=30  Score=20.32  Aligned_cols=26  Identities=31%  Similarity=0.866  Sum_probs=12.7

Q ss_pred             ccccCCCCCCCc-eee-cCCCCcccccc
Q psy15323         10 ECVNCGAISTPL-WRR-DGTGHYLCNAC   35 (139)
Q Consensus        10 ~C~nC~~~~tp~-WRr-~~~g~~lCnaC   35 (139)
                      .|-.|+.+.-=. |.. ...|..+|+.|
T Consensus         5 pCP~CGG~DrFri~~d~~~~G~~~C~~C   32 (40)
T PF08273_consen    5 PCPICGGKDRFRIFDDKDGRGTWICRQC   32 (40)
T ss_dssp             --TTTT-TTTEEEETT----S-EEETTT
T ss_pred             CCCCCcCccccccCcCcccCCCEECCCC
Confidence            488888744332 332 23478999999


No 91 
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=34.59  E-value=23  Score=30.93  Aligned_cols=29  Identities=31%  Similarity=0.814  Sum_probs=21.9

Q ss_pred             CCccccCCCCCCCceeecCCCCcccccccccccccC
Q psy15323          8 GRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNG   43 (139)
Q Consensus         8 ~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~k~hg   43 (139)
                      .-+|.+||.+ ++.|.-      .|.+|+-|..+..
T Consensus         7 ~y~C~~Cg~~-~~~~~g------~Cp~C~~w~t~~~   35 (454)
T TIGR00416         7 KFVCQHCGAD-SPKWQG------KCPACHAWNTITE   35 (454)
T ss_pred             eEECCcCCCC-CccccE------ECcCCCCccccch
Confidence            4689999965 566663      6999999976654


No 93 
>COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion]
Probab=33.56  E-value=28  Score=29.37  Aligned_cols=35  Identities=23%  Similarity=0.484  Sum_probs=29.2

Q ss_pred             cccCcccccCCCCCCcceecCCCCCcccchhhhhHH
Q psy15323         59 RRLGLCCTNCGTRMTTLWRRNNDGEPVCNACGLYYK   94 (139)
Q Consensus        59 k~~~~~C~~C~t~~t~~Wr~~~~g~~lCnaCgly~~   94 (139)
                      ......|..|++.. |.|=.-+-|..||-.|.--.|
T Consensus        17 ~~~Nk~CaDCga~~-P~W~S~nlGvfiCi~CagvHR   51 (319)
T COG5347          17 DSSNKKCADCGAPN-PTWASVNLGVFLCIDCAGVHR   51 (319)
T ss_pred             ccccCccccCCCCC-CceEecccCeEEEeecchhhh
Confidence            35677899999988 999998889999999974333


No 94 
>COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription]
Probab=33.39  E-value=20  Score=29.74  Aligned_cols=26  Identities=38%  Similarity=0.949  Sum_probs=15.4

Q ss_pred             ccccCCCCCCcceecCCCCCcccchhhh
Q psy15323         64 CCTNCGTRMTTLWRRNNDGEPVCNACGL   91 (139)
Q Consensus        64 ~C~~C~t~~t~~Wr~~~~g~~lCnaCgl   91 (139)
                      .|++|+.+ .-.++ -..|+++|-.||+
T Consensus         3 ~CpeCg~~-~~~~d-~~~ge~VC~~CG~   28 (285)
T COG1405           3 SCPECGST-NIITD-YERGEIVCADCGL   28 (285)
T ss_pred             CCCCCCCc-cceee-ccCCeEEeccCCE
Confidence            57777776 22221 2356777888875


No 95 
>PRK04023 DNA polymerase II large subunit; Validated
Probab=33.12  E-value=37  Score=33.17  Aligned_cols=42  Identities=31%  Similarity=0.681  Sum_probs=0.0

Q ss_pred             CCcccccccccccccCCCCCCCCCccchhhccccCcccccCCCCCCccee----cCCCCCcccchhh
Q psy15323         28 GHYLCNACGLYHKMNGMNRPLVKPSKRLTATRRLGLCCTNCGTRMTTLWR----RNNDGEPVCNACG   90 (139)
Q Consensus        28 g~~lCnaCgly~k~hg~nRP~~kpsKR~~atk~~~~~C~~C~t~~t~~Wr----~~~~g~~lCnaCg   90 (139)
                      +...|+.||...                     ....|.+||+...+.|+    ....+.+.|..||
T Consensus       625 g~RfCpsCG~~t---------------------~~frCP~CG~~Te~i~fCP~CG~~~~~y~CPKCG  670 (1121)
T PRK04023        625 GRRKCPSCGKET---------------------FYRRCPFCGTHTEPVYRCPRCGIEVEEDECEKCG  670 (1121)
T ss_pred             cCccCCCCCCcC---------------------CcccCCCCCCCCCcceeCccccCcCCCCcCCCCC


No 96 
>COG2835 Uncharacterized conserved protein [Function unknown]
Probab=32.95  E-value=33  Score=22.06  Aligned_cols=32  Identities=22%  Similarity=0.515  Sum_probs=24.3

Q ss_pred             CCCCCCCceeecCCCCccccccccccccc-CCC
Q psy15323         14 CGAISTPLWRRDGTGHYLCNACGLYHKMN-GMN   45 (139)
Q Consensus        14 C~~~~tp~WRr~~~g~~lCnaCgly~k~h-g~n   45 (139)
                      |-.++.|++-....+..+|..|++.|... |..
T Consensus        11 CP~~kg~L~~~~~~~~L~c~~~~~aYpI~dGIP   43 (60)
T COG2835          11 CPVCKGPLVYDEEKQELICPRCKLAYPIRDGIP   43 (60)
T ss_pred             ccCcCCcceEeccCCEEEecccCceeecccCcc
Confidence            66677889987777789999999966443 443


No 97 
>KOG1729|consensus
Probab=32.16  E-value=19  Score=29.93  Aligned_cols=26  Identities=42%  Similarity=0.754  Sum_probs=18.2

Q ss_pred             CCCccccCCC-CCCCceeecCCCCcccccccc
Q psy15323          7 EGRECVNCGA-ISTPLWRRDGTGHYLCNACGL   37 (139)
Q Consensus         7 ~~~~C~nC~~-~~tp~WRr~~~g~~lCnaCgl   37 (139)
                      ++.+|..|+. ..|-.|||-     .|-+||.
T Consensus       167 ea~~C~~C~~~~Ftl~~RRH-----HCR~CG~  193 (288)
T KOG1729|consen  167 EATECMVCGCTEFTLSERRH-----HCRNCGD  193 (288)
T ss_pred             cceecccCCCccccHHHHHH-----HHHhcch
Confidence            4778999998 666677764     3666655


No 98 
>KOG1598|consensus
Probab=32.06  E-value=26  Score=31.54  Aligned_cols=26  Identities=35%  Similarity=0.783  Sum_probs=19.2

Q ss_pred             ccccCCCCCCcceecCCCCCcccchhhh
Q psy15323         64 CCTNCGTRMTTLWRRNNDGEPVCNACGL   91 (139)
Q Consensus        64 ~C~~C~t~~t~~Wr~~~~g~~lCnaCgl   91 (139)
                      .|.||+-+..-.  ....|...|++||.
T Consensus         2 ~C~~C~~s~fe~--d~a~g~~~C~~CG~   27 (521)
T KOG1598|consen    2 VCKNCGGSNFER--DEATGNLYCTACGT   27 (521)
T ss_pred             cCCCCCCCCccc--ccccCCceeccccc
Confidence            699999876544  22457789999995


No 99 
>KOG0706|consensus
Probab=30.10  E-value=28  Score=30.72  Aligned_cols=41  Identities=20%  Similarity=0.455  Sum_probs=32.8

Q ss_pred             ccccCcccccCCCCCCcceecCCCCCcccchhhhhHHhhCCC
Q psy15323         58 TRRLGLCCTNCGTRMTTLWRRNNDGEPVCNACGLYYKLHNVN   99 (139)
Q Consensus        58 tk~~~~~C~~C~t~~t~~Wr~~~~g~~lCnaCgly~~~~~~~   99 (139)
                      ......+|..|+. ..|.|-.-+-|..||-.|.--.|--|++
T Consensus        19 s~~~NKvCFDCgA-knPtWaSVTYGIFLCiDCSAvHRnLGVH   59 (454)
T KOG0706|consen   19 SQSENKVCFDCGA-KNPTWASVTYGIFLCIDCSAVHRNLGVH   59 (454)
T ss_pred             cCCCCceecccCC-CCCCceeecceEEEEEecchhhhccccc
Confidence            3456779999998 8899999999999999998655544443


No 100
>PRK00085 recO DNA repair protein RecO; Reviewed
Probab=29.70  E-value=40  Score=26.25  Aligned_cols=31  Identities=26%  Similarity=0.565  Sum_probs=24.7

Q ss_pred             CCCCccccCCCCCCCceeecCCCCccccccc
Q psy15323          6 GEGRECVNCGAISTPLWRRDGTGHYLCNACG   36 (139)
Q Consensus         6 ~~~~~C~nC~~~~tp~WRr~~~g~~lCnaCg   36 (139)
                      +.-..|..||......+-.-.+|.++|..|.
T Consensus       147 p~l~~C~~Cg~~~~~~~f~~~~gg~~c~~c~  177 (247)
T PRK00085        147 LDLDHCAVCGAPGDHRYFSPKEGGAVCSECG  177 (247)
T ss_pred             cchhhHhcCCCCCCceEEecccCCccccccc
Confidence            3456899999877766666678899999997


No 101
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair]
Probab=29.58  E-value=33  Score=28.49  Aligned_cols=28  Identities=36%  Similarity=0.756  Sum_probs=19.8

Q ss_pred             CCccccCCCCCCCceeecCCCCccccccccc
Q psy15323          8 GRECVNCGAISTPLWRRDGTGHYLCNACGLY   38 (139)
Q Consensus         8 ~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly   38 (139)
                      -+.|..||+...+   +...-..+|+.|+..
T Consensus       111 ~RFCg~CG~~~~~---~~~g~~~~C~~cg~~  138 (279)
T COG2816         111 HRFCGRCGTKTYP---REGGWARVCPKCGHE  138 (279)
T ss_pred             CcCCCCCCCcCcc---ccCceeeeCCCCCCc
Confidence            5789999954443   333336799999984


No 102
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=29.48  E-value=56  Score=18.26  Aligned_cols=28  Identities=21%  Similarity=0.451  Sum_probs=16.6

Q ss_pred             CCccccCCCCCCCceeecCCCCccccccccc
Q psy15323          8 GRECVNCGAISTPLWRRDGTGHYLCNACGLY   38 (139)
Q Consensus         8 ~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly   38 (139)
                      .+.|..|+.   +.--...++.++|.-|+.-
T Consensus         3 ~~~C~~C~~---~~i~~~~~~~~~C~~Cg~~   30 (33)
T PF08792_consen    3 LKKCSKCGG---NGIVNKEDDYEVCIFCGSS   30 (33)
T ss_pred             ceEcCCCCC---CeEEEecCCeEEcccCCcE
Confidence            456777773   3222234556788888763


No 103
>PF15396 FAM60A:  Protein Family FAM60A
Probab=29.22  E-value=27  Score=27.89  Aligned_cols=16  Identities=38%  Similarity=0.578  Sum_probs=12.4

Q ss_pred             cccchhhhhHHhhCCC
Q psy15323         84 PVCNACGLYYKLHNVN   99 (139)
Q Consensus        84 ~lCnaCgly~~~~~~~   99 (139)
                      -+||||.|..++-++.
T Consensus        50 eICNACVLLVKRwKKL   65 (213)
T PF15396_consen   50 EICNACVLLVKRWKKL   65 (213)
T ss_pred             hhhHHHHHHHHHHhhC
Confidence            5899999988765543


No 104
>cd06955 NR_DBD_VDR DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers. DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. VDR interacts with a VDR response element, a direct repeat of GGTTCA DNA site with 3 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation.  VDR is a member of the nuclear receptor (NR) superfamily that functions as classical endocrine receptors. VDR controls a wide range of biological activities including calcium metabolism, cell proliferation and differentiation, and immunomodulation. VDR is a high-affinity receptor for the biologically most active Vitamin D metabolite, 1alpha,25-dihydroxyvitamin D3 (1alpha,25(OH)2D3). The binding of the ligand to the receptor induces a conformational change of the ligand binding domain (LBD) with consequent dissociation of core
Probab=28.90  E-value=50  Score=23.37  Aligned_cols=33  Identities=21%  Similarity=0.408  Sum_probs=23.8

Q ss_pred             CCCccccCCCCCCCceeecCCCCcccccccccccccC
Q psy15323          7 EGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNG   43 (139)
Q Consensus         7 ~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~k~hg   43 (139)
                      .+..|..|+...+-.+-    |.+-|+||..+++..-
T Consensus         5 ~~~~C~VCg~~a~g~hy----Gv~sC~aCk~FFRR~v   37 (107)
T cd06955           5 VPRICGVCGDRATGFHF----NAMTCEGCKGFFRRSM   37 (107)
T ss_pred             CCCCCeecCCcCcccEE----Ccceeeeecceeccee
Confidence            45779999975554433    4568999999887643


No 105
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=28.82  E-value=26  Score=24.98  Aligned_cols=32  Identities=22%  Similarity=0.699  Sum_probs=23.7

Q ss_pred             cccccCCCCCCcceec----CCCC---CcccchhhhhHH
Q psy15323         63 LCCTNCGTRMTTLWRR----NNDG---EPVCNACGLYYK   94 (139)
Q Consensus        63 ~~C~~C~t~~t~~Wr~----~~~g---~~lCnaCgly~~   94 (139)
                      ..|..|+-.+-..|-.    ++++   ++.|-.||..|+
T Consensus        73 ~~CpkCg~~ea~y~~~QtRsaDEp~T~Fy~C~~Cg~~wr  111 (113)
T COG1594          73 EKCPKCGNKEAYYWQLQTRSADEPETRFYKCTRCGYRWR  111 (113)
T ss_pred             ccCCCCCCceeEEEeeehhccCCCceEEEEecccCCEee
Confidence            4699999999777753    3333   378999998765


No 106
>COG5525 Bacteriophage tail assembly protein [General function prediction only]
Probab=28.61  E-value=39  Score=30.96  Aligned_cols=60  Identities=18%  Similarity=0.265  Sum_probs=36.5

Q ss_pred             cccccccccccccC--CCCCCCCCccchhhccccCcccccCCCCCCcceecCCCCCcccchhhhhHHhhCCCCCc
Q psy15323         30 YLCNACGLYHKMNG--MNRPLVKPSKRLTATRRLGLCCTNCGTRMTTLWRRNNDGEPVCNACGLYYKLHNVNRPL  102 (139)
Q Consensus        30 ~lCnaCgly~k~hg--~nRP~~kpsKR~~atk~~~~~C~~C~t~~t~~Wr~~~~g~~lCnaCgly~~~~~~~Rp~  102 (139)
                      .+|+.||-++.+.-  +.-|.-.+.-  .. ...-.+|.||+...-+          ++|++++.++.+...|+.
T Consensus       228 vpCPHCGe~q~l~~~e~~~~~g~~~~--~~-~~~~~~c~h~~~~i~~----------~~~~~gv~~~~g~~~~dg  289 (611)
T COG5525         228 VPCPHCGEEQQLKFGEKSGPRGLKDT--PA-EAAFIQCEHCGCVIRP----------KLNGRGVCLRTGEWIRDG  289 (611)
T ss_pred             eeCCCCCchhhccccccCCCcCcccc--hh-hhhhhhccccCceeee----------eccCccchhccCCcCCCc
Confidence            49999999876653  1112211111  11 3345689999997766          267777777766665554


No 107
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=28.34  E-value=26  Score=19.36  Aligned_cols=25  Identities=28%  Similarity=0.648  Sum_probs=11.2

Q ss_pred             CccccCCCCCCCceeecCCCCcccccccc
Q psy15323          9 RECVNCGAISTPLWRRDGTGHYLCNACGL   37 (139)
Q Consensus         9 ~~C~nC~~~~tp~WRr~~~g~~lCnaCgl   37 (139)
                      ..|..|+++.|=    .+...++|..|+.
T Consensus         3 p~Cp~C~se~~y----~D~~~~vCp~C~~   27 (30)
T PF08274_consen    3 PKCPLCGSEYTY----EDGELLVCPECGH   27 (30)
T ss_dssp             ---TTT-----E----E-SSSEEETTTTE
T ss_pred             CCCCCCCCccee----ccCCEEeCCcccc
Confidence            368888876653    2233688988875


No 108
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=27.76  E-value=43  Score=24.74  Aligned_cols=32  Identities=28%  Similarity=0.317  Sum_probs=21.6

Q ss_pred             CCCCCCccccCCCCCCCceeecCCCCcccccccccc
Q psy15323          4 QFGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYH   39 (139)
Q Consensus         4 ~~~~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~   39 (139)
                      ..|..++|.+||+...-|=+.    ..+|..||--+
T Consensus         5 elGtKr~Cp~cg~kFYDLnk~----p~vcP~cg~~~   36 (129)
T TIGR02300         5 DLGTKRICPNTGSKFYDLNRR----PAVSPYTGEQF   36 (129)
T ss_pred             hhCccccCCCcCccccccCCC----CccCCCcCCcc
Confidence            346678888888766655542    35888888754


No 109
>PF02701 zf-Dof:  Dof domain, zinc finger;  InterPro: IPR003851 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry consists of proteins containing a Dof domain, which is a zinc finger DNA-binding domain that shows resemblance to the Cys2 zinc finger, although it has a longer putative loop where an extra Cys residue is conserved []. AOBP, a DNA-binding protein in pumpkin (Cucurbita maxima), contains a 52 amino acid Dof domain, which is highly conserved in several DNA-binding proteins of higher plants. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent
Probab=27.56  E-value=70  Score=20.76  Aligned_cols=41  Identities=24%  Similarity=0.472  Sum_probs=30.8

Q ss_pred             CcccccCCCCCCcceecCC--CCC--cccchhhhhHHhhCCCCCc
Q psy15323         62 GLCCTNCGTRMTTLWRRNN--DGE--PVCNACGLYYKLHNVNRPL  102 (139)
Q Consensus        62 ~~~C~~C~t~~t~~Wr~~~--~g~--~lCnaCgly~~~~~~~Rp~  102 (139)
                      ...|..|....|-.--=++  ..+  ++|-+|--||..-+..|-+
T Consensus         5 ~~~CPRC~S~nTKFcYyNNy~~~QPR~~Ck~C~rywT~GG~lRnV   49 (63)
T PF02701_consen    5 PLPCPRCDSTNTKFCYYNNYNLSQPRYFCKSCRRYWTHGGTLRNV   49 (63)
T ss_pred             CCCCCCcCCCCCEEEeecCCCCCCcchhhHHHHHHHHhcceecCC
Confidence            4679999998877544222  233  8999999999998888766


No 110
>PF04981 NMD3:  NMD3 family ;  InterPro: IPR007064 The NMD3 protein is involved in nonsense mediated mRNA decay. This N-terminal region contains four conserved CXXC motifs that could be metal binding. NMD3 is involved in export of the 60S ribosomal subunit is mediated by the adapter protein Nmd3p in a Crm1p-dependent pathway [].
Probab=27.34  E-value=51  Score=26.06  Aligned_cols=52  Identities=27%  Similarity=0.522  Sum_probs=33.2

Q ss_pred             cccCCCCCCCceeecCCCCcccccccccccccCCCCCCCCCccchhhccccCcccccCCCCCCc-ceecC
Q psy15323         11 CVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVKPSKRLTATRRLGLCCTNCGTRMTT-LWRRN   79 (139)
Q Consensus        11 C~nC~~~~tp~WRr~~~g~~lCnaCgly~k~hg~nRP~~kpsKR~~atk~~~~~C~~C~t~~t~-~Wr~~   79 (139)
                      |..||....|+-.      -||..|.+...      ++....     ....-.+|..|+.-..+ .|...
T Consensus         1 C~~CG~~~~~~~~------~lC~~C~~~~~------~i~ei~-----~~i~v~~C~~Cg~~~~~~~W~~~   53 (236)
T PF04981_consen    1 CPRCGREIEPLID------GLCPDCYLKRF------DIIEIP-----DRIEVTICPKCGRYRIGGRWVDP   53 (236)
T ss_pred             CCCCCCCCCCccc------ccChHHhcccC------CeeecC-----CccCceECCCCCCEECCCEeeec
Confidence            7889975555433      39999998431      111111     11234589999998876 89877


No 111
>PRK11788 tetratricopeptide repeat protein; Provisional
Probab=26.95  E-value=54  Score=26.55  Aligned_cols=20  Identities=30%  Similarity=0.396  Sum_probs=12.7

Q ss_pred             cccccCCCCCCcceecCCCC
Q psy15323         63 LCCTNCGTRMTTLWRRNNDG   82 (139)
Q Consensus        63 ~~C~~C~t~~t~~Wr~~~~g   82 (139)
                      ..|.+|++..|-..++|-+|
T Consensus       369 ~~c~~c~~~~~~~~~~~~~~  388 (389)
T PRK11788        369 WHCPSCKAWETIKPIRGLDG  388 (389)
T ss_pred             eECcCCCCccCcCCcccCCC
Confidence            35777777666666666554


No 112
>PHA02942 putative transposase; Provisional
Probab=26.40  E-value=50  Score=28.25  Aligned_cols=28  Identities=21%  Similarity=0.628  Sum_probs=19.7

Q ss_pred             CCCccccCCCCCCCceeecCCCCccccccccc
Q psy15323          7 EGRECVNCGAISTPLWRRDGTGHYLCNACGLY   38 (139)
Q Consensus         7 ~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly   38 (139)
                      ....|+.||.....+    ....+.|..||..
T Consensus       324 TSq~Cs~CG~~~~~l----~~r~f~C~~CG~~  351 (383)
T PHA02942        324 SSVSCPKCGHKMVEI----AHRYFHCPSCGYE  351 (383)
T ss_pred             CCccCCCCCCccCcC----CCCEEECCCCCCE
Confidence            567899999765432    1225899999984


No 113
>PF01258 zf-dskA_traR:  Prokaryotic dksA/traR C4-type zinc finger;  InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents domains identified in zinc finger-containing members of the DksA/TraR family. DksA is a critical component of the rRNA transcription initiation machinery that potentiates the regulation of rRNA promoters by ppGpp and the initiating NTP. In delta-dksA mutants, rRNA promoters are unresponsive to changes in amino acid availability, growth rate, or growth phase. In vitro, DksA binds to RNAP, reduces open complex lifetime, inhibits rRNA promoter activity, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription [, ]. The dksA gene product suppresses the temperature-sensitive growth and filamentation of a dnaK deletion mutant of Escherichia coli. Gene knockout [] and deletion [] experiments have shown the gene to be non-essential, mutations causing a mild sensitivity to UV light, but not affecting DNA recombination []. In Pseudomonas aeruginosa, dksA is a novel regulator involved in the post-transcriptional control of extracellular virulence factor production [].  The proteins contain a C-terminal region thought to fold into a 4-cysteine zinc finger. Other proteins found to contain a similar zinc finger domain include:  the traR gene products encoded on the E. coli F and R100 plasmids [, ]  the traR gene products encoded on Salmonella spp. plasmids pED208 and pSLT  the dnaK suppressor  hypothetical proteins from bacteria and bacteriophage  FHL4, LIM proteins from Homo sapiens (Human) and Mus musculus (Mouse) []  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2GVI_A 2KQ9_A 2KGO_A 1TJL_I.
Probab=26.35  E-value=8.1  Score=21.71  Aligned_cols=28  Identities=25%  Similarity=0.442  Sum_probs=15.5

Q ss_pred             CccccCCCCCCCceeecCCCCccccccc
Q psy15323          9 RECVNCGAISTPLWRRDGTGHYLCNACG   36 (139)
Q Consensus         9 ~~C~nC~~~~tp~WRr~~~g~~lCnaCg   36 (139)
                      .+|..||-..-......-.+..+|-.|.
T Consensus         4 g~C~~CGe~I~~~Rl~~~p~~~~C~~C~   31 (36)
T PF01258_consen    4 GICEDCGEPIPEERLVAVPGATLCVECQ   31 (36)
T ss_dssp             SB-TTTSSBEEHHHHHHCTTECS-HHHH
T ss_pred             CCccccCChHHHHHHHhCCCcEECHHHh
Confidence            4588888655544444445666776664


No 114
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=25.90  E-value=52  Score=19.24  Aligned_cols=26  Identities=23%  Similarity=0.475  Sum_probs=14.5

Q ss_pred             ccccCCCCCCCceeecCCCCccccccccc
Q psy15323         10 ECVNCGAISTPLWRRDGTGHYLCNACGLY   38 (139)
Q Consensus        10 ~C~nC~~~~tp~WRr~~~g~~lCnaCgly   38 (139)
                      .|.+||+..+-.   .....+.|..||-.
T Consensus         5 ~C~~CG~~~~~~---~~~~~~~Cp~CG~~   30 (46)
T PRK00398          5 KCARCGREVELD---EYGTGVRCPYCGYR   30 (46)
T ss_pred             ECCCCCCEEEEC---CCCCceECCCCCCe
Confidence            578888643221   11125678888764


No 115
>TIGR00613 reco DNA repair protein RecO. All proteins in this family for which functions are known are DNA binding proteins that are involved in the initiation of recombination or recombinational repair.
Probab=25.81  E-value=56  Score=25.33  Aligned_cols=32  Identities=25%  Similarity=0.528  Sum_probs=22.2

Q ss_pred             CCCCccccCCCCCCCceeecCCCCcccccccc
Q psy15323          6 GEGRECVNCGAISTPLWRRDGTGHYLCNACGL   37 (139)
Q Consensus         6 ~~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgl   37 (139)
                      +.-..|..||......+-.-.+|.++|..|.-
T Consensus       145 p~l~~C~~cg~~~~~~~fs~~~gg~~C~~c~~  176 (241)
T TIGR00613       145 LDLDKCAVCGSKEDLIYFSMTYGGALCRQCGE  176 (241)
T ss_pred             cccCccCCCCCcCCCceEchhcCeEEChhhCc
Confidence            44568999998433344344468899999975


No 116
>PF04161 Arv1:  Arv1-like family ;  InterPro: IPR007290 Arv1 is a transmembrane protein, with potential zinc-binding motifs, that mediates sterol homeostasis. Its action is important in lipid homeostasis, which prevents free sterol toxicity []. Arv1 contains a homology domain (AHD), which consists of an N-terminal cysteine-rich subdomain with a putative zinc-binding motif, followed by a C-terminal subdomain of 33 amino acids. The C-terminal subdomain of the AHD is critical for the protein's function []. In yeast, Arv1p is important for the delivery of an early glycosylphosphatidylinositol GPI intermediate, GlcN-acylPI, to the first mannosyltransferase of GPI synthesis in the ER lumen []. It is important for the traffic of sterol in yeast and in humans. In eukaryotic cells, it may fuction in the sphingolipid metabolic pathway as a transporter of ceramides between the ER and Golgi []. 
Probab=25.75  E-value=34  Score=26.63  Aligned_cols=29  Identities=31%  Similarity=0.781  Sum_probs=23.5

Q ss_pred             ccccCCCCCCCceeecCCCC---ccccccccc
Q psy15323         10 ECVNCGAISTPLWRRDGTGH---YLCNACGLY   38 (139)
Q Consensus        10 ~C~nC~~~~tp~WRr~~~g~---~lCnaCgly   38 (139)
                      .|.+||..-..++++-..+.   +.|..|+-.
T Consensus         2 iCIeCg~~v~~Ly~~Ys~~~irLt~C~~C~~v   33 (208)
T PF04161_consen    2 ICIECGHPVKSLYRQYSPGNIRLTKCPNCGKV   33 (208)
T ss_pred             EeccCCCcchhhhhccCCCcEEEeeccccCCc
Confidence            69999999888999865552   689999874


No 117
>cd02337 ZZ_CBP Zinc finger, ZZ type. Zinc finger present in CBP/p300 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. CREB-binding protein (CBP) is a large multidomain protein that provides binding sites for transcriptional coactivators, the role of the ZZ domain in CBP/p300 is unclear.
Probab=25.45  E-value=41  Score=19.64  Aligned_cols=29  Identities=21%  Similarity=0.413  Sum_probs=19.9

Q ss_pred             ccccCCCCCCCceeecCCCC-ccccccccc
Q psy15323         10 ECVNCGAISTPLWRRDGTGH-YLCNACGLY   38 (139)
Q Consensus        10 ~C~nC~~~~tp~WRr~~~g~-~lCnaCgly   38 (139)
                      .|..|....++.|+=..-.. -||.+|...
T Consensus         2 ~C~~C~~~~~~r~~C~~C~dfDLC~~C~~~   31 (41)
T cd02337           2 TCNECKHHVETRWHCTVCEDYDLCITCYNT   31 (41)
T ss_pred             cCCCCCCcCCCceECCCCcchhhHHHHhCC
Confidence            47778777778888554333 388888764


No 118
>COG3183 Predicted restriction endonuclease [Defense mechanisms]
Probab=25.36  E-value=21  Score=29.44  Aligned_cols=41  Identities=22%  Similarity=0.568  Sum_probs=22.9

Q ss_pred             cccccccc-cccccCC----------CCCCCCCc--cchhhccccCcccccCCC
Q psy15323         30 YLCNACGL-YHKMNGM----------NRPLVKPS--KRLTATRRLGLCCTNCGT   70 (139)
Q Consensus        30 ~lCnaCgl-y~k~hg~----------nRP~~kps--KR~~atk~~~~~C~~C~t   70 (139)
                      .+|-.|++ +++..|.          ..|+....  ..........+.|+||+.
T Consensus       196 ~vC~vC~fdF~k~YGe~gKgyIeVHH~~piae~e~~~~vnp~tDL~plCpNCH~  249 (272)
T COG3183         196 TVCDVCEFDFQKKYGEIGKGYIEVHHKIPIAEFEGEYHVNPLTDLAPLCPNCHK  249 (272)
T ss_pred             ceeeecCccHHHHhhhhccCeEEEeeccchhhhcCccccCchhhhhhcCccHHH
Confidence            79999999 6666662          23443322  222333445556666654


No 119
>KOG0703|consensus
Probab=25.27  E-value=36  Score=28.37  Aligned_cols=29  Identities=28%  Similarity=0.693  Sum_probs=25.8

Q ss_pred             cCcccccCCCCCCcceecCCCCCcccchhh
Q psy15323         61 LGLCCTNCGTRMTTLWRRNNDGEPVCNACG   90 (139)
Q Consensus        61 ~~~~C~~C~t~~t~~Wr~~~~g~~lCnaCg   90 (139)
                      ....|+.|++. .|.|-.-+-|-.+|--|.
T Consensus        24 ~N~~CADC~a~-~P~WaSwnlGvFiC~~C~   52 (287)
T KOG0703|consen   24 DNKVCADCGAK-GPRWASWNLGVFICLRCA   52 (287)
T ss_pred             ccCcccccCCC-CCCeEEeecCeEEEeecc
Confidence            37789999997 999988888988999997


No 120
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=25.08  E-value=58  Score=17.22  Aligned_cols=8  Identities=38%  Similarity=1.157  Sum_probs=3.9

Q ss_pred             cccccccc
Q psy15323         30 YLCNACGL   37 (139)
Q Consensus        30 ~lCnaCgl   37 (139)
                      ..|..||.
T Consensus        15 ~~Cp~CG~   22 (26)
T PF10571_consen   15 KFCPHCGY   22 (26)
T ss_pred             CcCCCCCC
Confidence            34555554


No 121
>PRK12495 hypothetical protein; Provisional
Probab=24.61  E-value=40  Score=27.15  Aligned_cols=31  Identities=26%  Similarity=0.683  Sum_probs=23.9

Q ss_pred             CCCCCccccCCCCCCCceeecCCCCccccccccccc
Q psy15323          5 FGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHK   40 (139)
Q Consensus         5 ~~~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~k   40 (139)
                      .+....|..||   .||.+.  .|..+|..|+-..-
T Consensus        39 tmsa~hC~~CG---~PIpa~--pG~~~Cp~CQ~~~~   69 (226)
T PRK12495         39 TMTNAHCDECG---DPIFRH--DGQEFCPTCQQPVT   69 (226)
T ss_pred             ccchhhccccc---CcccCC--CCeeECCCCCCccc
Confidence            34577899999   777743  78899999997643


No 122
>cd07169 NR_DBD_GCNF_like DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers. DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. GCNF is a transcription factor expressed in post-meiotic stages of developing male germ cells. In vitro, GCNF has the ability to bind to direct repeat elements of  5'-AGGTCA.AGGTCA-3', as well as to an extended half-site sequence 5'-TCA.AGGTCA-3'. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, GCNF has  a central well conserved DNA-binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Probab=24.15  E-value=39  Score=23.00  Aligned_cols=34  Identities=32%  Similarity=0.605  Sum_probs=24.6

Q ss_pred             CCCCCccccCCCCCCCceeecCCCCccccccccccccc
Q psy15323          5 FGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMN   42 (139)
Q Consensus         5 ~~~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~k~h   42 (139)
                      -++...|..|+...+-.+-    |...|+||..+++..
T Consensus         3 ~~~~~~C~VCg~~a~g~hy----Gv~sC~aCk~FFRR~   36 (90)
T cd07169           3 RAEQRTCLICGDRATGLHY----GIISCEGCKGFFKRS   36 (90)
T ss_pred             cccCCCCeecCCcCcceEE----CcceehhhHHHHHHH
Confidence            3567789999975554443    456899999988654


No 123
>TIGR03573 WbuX N-acetyl sugar amidotransferase. This enzyme has been implicated in the formation of the acetamido moiety (sugar-NC(=NH)CH3) which is found on some exopolysaccharides and is positively charged at neutral pH. The reaction involves ligation of ammonia with a sugar N-acetyl group, displacing water. In E. coli (O145 strain) and Pseudomonas aeruginosa (O12 strain) this gene is known as wbuX and ifnA respectively and likely acts on sialic acid. In Campylobacter jejuni, the gene is known as pseA and acts on pseudaminic acid in the process of flagellin glycosylation. In other Pseudomonas strains and various organisms it is unclear what the identity of the sugar substrate is, and in fact, the phylogenetic tree of this family sports a considerably deep branching suggestive of possible major differences in substrate structure. Nevertheless, the family is characterized by a conserved tetracysteine motif (CxxC.....[GN]xCxxC) possibly indicative of a metal binding site, as well as an 
Probab=23.84  E-value=48  Score=27.70  Aligned_cols=32  Identities=19%  Similarity=0.324  Sum_probs=22.2

Q ss_pred             CccccCCCCCCCceeecCCCCcccccccccccc
Q psy15323          9 RECVNCGAISTPLWRRDGTGHYLCNACGLYHKM   41 (139)
Q Consensus         9 ~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~k~   41 (139)
                      +.|.+|...+|-- .-.-+.+-+||+|-.+..+
T Consensus         2 ~~C~~C~~~~t~p-~i~fd~~GvC~~C~~~~~~   33 (343)
T TIGR03573         2 KFCKRCVMPTTRP-GITFDEDGVCSACRNFEEK   33 (343)
T ss_pred             CcCCCCCCCCCCC-CeeECCCCCchhhhhHHhh
Confidence            5799999876543 2223445699999998744


No 124
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=23.56  E-value=36  Score=24.23  Aligned_cols=30  Identities=33%  Similarity=0.837  Sum_probs=20.9

Q ss_pred             ccccCCCCCCc---ceecCCCCCcccchhhhhH
Q psy15323         64 CCTNCGTRMTT---LWRRNNDGEPVCNACGLYY   93 (139)
Q Consensus        64 ~C~~C~t~~t~---~Wr~~~~g~~lCnaCgly~   93 (139)
                      -|..|+-....   +--.+.-|...|..||+++
T Consensus        24 tCp~Cghe~vs~ctvkk~~~~g~~~Cg~CGls~   56 (104)
T COG4888          24 TCPRCGHEKVSSCTVKKTVNIGTAVCGNCGLSF   56 (104)
T ss_pred             ecCccCCeeeeEEEEEecCceeEEEcccCcceE
Confidence            48888876655   5444444667899999876


No 125
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=23.52  E-value=55  Score=18.68  Aligned_cols=28  Identities=18%  Similarity=0.610  Sum_probs=17.3

Q ss_pred             cCcccccCCCCCCcceec--CCCCC--cccchh
Q psy15323         61 LGLCCTNCGTRMTTLWRR--NNDGE--PVCNAC   89 (139)
Q Consensus        61 ~~~~C~~C~t~~t~~Wr~--~~~g~--~lCnaC   89 (139)
                      +.+.|..|+.++. +-+.  +++|.  ++|-.|
T Consensus         4 i~v~CP~C~s~~~-v~k~G~~~~G~qryrC~~C   35 (36)
T PF03811_consen    4 IDVHCPRCQSTEG-VKKNGKSPSGHQRYRCKDC   35 (36)
T ss_pred             EeeeCCCCCCCCc-ceeCCCCCCCCEeEecCcC
Confidence            3457888888653 3343  44563  788777


No 126
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=23.37  E-value=36  Score=25.00  Aligned_cols=8  Identities=38%  Similarity=1.016  Sum_probs=4.0

Q ss_pred             cccccccc
Q psy15323         30 YLCNACGL   37 (139)
Q Consensus        30 ~lCnaCgl   37 (139)
                      |+|+.|+.
T Consensus       100 Y~Cp~C~~  107 (147)
T smart00531      100 YKCPNCQS  107 (147)
T ss_pred             EECcCCCC
Confidence            45555554


No 127
>cd06966 NR_DBD_CAR DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers. DNA-binding domain (DBD) of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. CAR DBD interacts with CAR response element, a perfect repeat of two AGTTCA motifs with a 4 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation. The constitutive androstane receptor (CAR) is a ligand-regulated transcription factor that responds to a diverse array of chemically distinct ligands, including many endogenous compounds and clinical drugs. It functions as a heterodimer with RXR. The CAR/RXR heterodimer binds many common response elements in the promoter regions of a diverse set of target genes involved in the metabolism, transport, and ultimately, elimination of these molecules from the body. CAR is a closest mammalian 
Probab=23.26  E-value=52  Score=22.58  Aligned_cols=31  Identities=19%  Similarity=0.471  Sum_probs=21.2

Q ss_pred             CccccCCCCCCCceeecCCCCcccccccccccccC
Q psy15323          9 RECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNG   43 (139)
Q Consensus         9 ~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~k~hg   43 (139)
                      +.|..|+...+-.+-    |.+-|+||..+++..-
T Consensus         1 ~~C~VCg~~a~g~hy----Gv~sC~aC~~FFRR~v   31 (94)
T cd06966           1 KICGVCGDKALGYNF----NAITCESCKAFFRRNA   31 (94)
T ss_pred             CCCeeCCCcCcceEE----Ccceeeeehheehhcc
Confidence            368889865444433    4568999999886543


No 128
>cd06964 NR_DBD_RAR DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers. DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. RAR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. RARs mediate the biological effect of retinoids, including both natural dietary vitamin A (retinol) metabolites and active synthetic analogs. Retinoids play key roles in a wide variety of essential biological processes, such as vertebrate embryonic morphogenesis and organogenesis, differentiation and apoptosis, and homeostasis. RAR function as a heterodimer with retinoic X receptor by binding to specific RAR response elements (RAREs), which are composed of two direct repeats of the consensus sequence 5'-AGGTCA-3' separated by one to five base pair and found in the promoter reg
Probab=23.15  E-value=67  Score=21.57  Aligned_cols=32  Identities=19%  Similarity=0.416  Sum_probs=22.6

Q ss_pred             CCCccccCCCCCCCceeecCCCCccccccccccccc
Q psy15323          7 EGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMN   42 (139)
Q Consensus         7 ~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~k~h   42 (139)
                      ....|..|+...+-.+-    |..-|+||..+++..
T Consensus         3 ~~~~C~VCg~~~~g~hy----Gv~sC~aC~~FFRR~   34 (85)
T cd06964           3 IYKPCFVCQDKSSGYHY----GVSACEGCKGFFRRS   34 (85)
T ss_pred             cCCCCcccCCcCcccEE----CcceeeeeeeEEeee
Confidence            34579999975554433    456899999988654


No 129
>PF13695 zf-3CxxC:  Zinc-binding domain
Probab=22.96  E-value=34  Score=23.49  Aligned_cols=18  Identities=17%  Similarity=0.488  Sum_probs=12.2

Q ss_pred             ccCcccccCCCCCCccee
Q psy15323         60 RLGLCCTNCGTRMTTLWR   77 (139)
Q Consensus        60 ~~~~~C~~C~t~~t~~Wr   77 (139)
                      .....|..|++.+.|.|.
T Consensus        36 v~~Q~C~~C~~~~~P~~~   53 (98)
T PF13695_consen   36 VFGQRCKKCNPLERPYFS   53 (98)
T ss_pred             EECCCCCCCCCCCCccCc
Confidence            345567777777777775


No 130
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=22.92  E-value=40  Score=23.92  Aligned_cols=8  Identities=25%  Similarity=0.746  Sum_probs=3.7

Q ss_pred             cccccccc
Q psy15323         30 YLCNACGL   37 (139)
Q Consensus        30 ~lCnaCgl   37 (139)
                      ..|+.|+-
T Consensus        71 ~~C~~Cg~   78 (115)
T TIGR00100        71 CECEDCSE   78 (115)
T ss_pred             EEcccCCC
Confidence            34444443


No 131
>COG1499 NMD3 NMD protein affecting ribosome stability and mRNA decay [Translation, ribosomal structure and biogenesis]
Probab=22.90  E-value=50  Score=28.27  Aligned_cols=62  Identities=24%  Similarity=0.488  Sum_probs=36.8

Q ss_pred             CCCCCccccCCCCCCCceeecCCCCcccccccccccccCCCCCCCCCccchhhccccCcccccCCCCCCc-ceecCCCCC
Q psy15323          5 FGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVKPSKRLTATRRLGLCCTNCGTRMTT-LWRRNNDGE   83 (139)
Q Consensus         5 ~~~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~k~hg~nRP~~kpsKR~~atk~~~~~C~~C~t~~t~-~Wr~~~~g~   83 (139)
                      +.....|..||...-|+-      .-||..|.+-.      -+.....     ....-..|.+|+.-..+ .|-..+.+.
T Consensus         3 ~~~~~~C~~CGr~~~~~~------~~lC~dC~~~~------~~~~~ip-----~~~~v~~C~~Cga~~~~~~W~~~~~~~   65 (355)
T COG1499           3 DASTILCVRCGRSVDPLI------DGLCGDCYVET------TPLIEIP-----DEVNVEVCRHCGAYRIRGRWVDEEGAN   65 (355)
T ss_pred             CCcccEeccCCCcCchhh------ccccHHHHhcc------CccccCC-----CceEEEECCcCCCccCCCcceeccccc
Confidence            345678999997665433      34999999841      1111100     01224579999955544 888744343


No 132
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=22.90  E-value=42  Score=22.21  Aligned_cols=55  Identities=31%  Similarity=0.659  Sum_probs=28.0

Q ss_pred             ccccCCCCCCCceeecCCCCcccccccccccccCCCCCCCCCccchhhccccCcccccCCCCCCcceecCCCCCcccchh
Q psy15323         10 ECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVKPSKRLTATRRLGLCCTNCGTRMTTLWRRNNDGEPVCNAC   89 (139)
Q Consensus        10 ~C~nC~~~~tp~WRr~~~g~~lCnaCgly~k~hg~nRP~~kpsKR~~atk~~~~~C~~C~t~~t~~Wr~~~~g~~lCnaC   89 (139)
                      .|-.|+   ++|=+.+  +.+.|.+|...+.+                    ...|.+|+..-.-|--=|.. .++||.|
T Consensus         3 ~CP~C~---~~L~~~~--~~~~C~~C~~~~~~--------------------~a~CPdC~~~Le~LkACGAv-dYFC~~c   56 (70)
T PF07191_consen    3 TCPKCQ---QELEWQG--GHYHCEACQKDYKK--------------------EAFCPDCGQPLEVLKACGAV-DYFCNHC   56 (70)
T ss_dssp             B-SSS----SBEEEET--TEEEETTT--EEEE--------------------EEE-TTT-SB-EEEEETTEE-EEE-TTT
T ss_pred             cCCCCC---CccEEeC--CEEECcccccccee--------------------cccCCCcccHHHHHHHhccc-ceeeccC
Confidence            467777   4443333  78999999985533                    23688888755555322222 2788888


Q ss_pred             h
Q psy15323         90 G   90 (139)
Q Consensus        90 g   90 (139)
                      .
T Consensus        57 ~   57 (70)
T PF07191_consen   57 H   57 (70)
T ss_dssp             T
T ss_pred             C
Confidence            4


No 133
>cd07168 NR_DBD_DHR4_like DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers. DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Ecdysone-induced orphan receptor DHR4 is a member of the nuclear receptor family. DHR4 is expressed during the early Drosophila larval development and is induced by ecdysone. DHR4 coordinates growth and maturation in Drosophila by mediating endocrine response to the attainment of proper body size during larval development. Mutations in DHR4 result in shorter larval development which translates into smaller and lighter flies. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, DHR4
Probab=21.61  E-value=60  Score=22.05  Aligned_cols=32  Identities=25%  Similarity=0.526  Sum_probs=19.9

Q ss_pred             CcccccCCCCCCcceecCCCCCcccchhhhhHHhhC
Q psy15323         62 GLCCTNCGTRMTTLWRRNNDGEPVCNACGLYYKLHN   97 (139)
Q Consensus        62 ~~~C~~C~t~~t~~Wr~~~~g~~lCnaCgly~~~~~   97 (139)
                      ...|..|+...+-.    --|...|+||...++..-
T Consensus         6 ~~~C~VCg~~~~g~----hyGv~sC~aCk~FFRR~v   37 (90)
T cd07168           6 PKLCSICEDKATGL----HYGIITCEGCKGFFKRTV   37 (90)
T ss_pred             CCCCcccCCcCcce----EECceehhhhhHhhhhhh
Confidence            44688887643322    124467999988886543


No 134
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=21.52  E-value=63  Score=25.49  Aligned_cols=25  Identities=24%  Similarity=0.683  Sum_probs=17.9

Q ss_pred             CCCCccccCCCCCCCceeecCCCCccccccccc
Q psy15323          6 GEGRECVNCGAISTPLWRRDGTGHYLCNACGLY   38 (139)
Q Consensus         6 ~~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly   38 (139)
                      .+...|+.||.     +.   ...+.|..||..
T Consensus       307 ~tS~~C~~cg~-----~~---~r~~~C~~cg~~  331 (364)
T COG0675         307 YTSKTCPCCGH-----LS---GRLFKCPRCGFV  331 (364)
T ss_pred             CCcccccccCC-----cc---ceeEECCCCCCe
Confidence            35688999997     11   235789999984


No 135
>COG0333 RpmF Ribosomal protein L32 [Translation, ribosomal structure and biogenesis]
Probab=21.25  E-value=69  Score=20.34  Aligned_cols=26  Identities=35%  Similarity=0.775  Sum_probs=13.8

Q ss_pred             CCCCccccCCCCCCCceeecCCCCcccccccccc
Q psy15323          6 GEGRECVNCGAISTPLWRRDGTGHYLCNACGLYH   39 (139)
Q Consensus         6 ~~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~   39 (139)
                      +..-+|.|||...=        -+-+|..||.|.
T Consensus        25 ~~~~~c~~cG~~~l--------~Hrvc~~cg~Y~   50 (57)
T COG0333          25 PTLSVCPNCGEYKL--------PHRVCLKCGYYK   50 (57)
T ss_pred             ccceeccCCCCccc--------CceEcCCCCCcc
Confidence            33456777763211        124777777654


No 136
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=20.48  E-value=47  Score=18.89  Aligned_cols=29  Identities=17%  Similarity=0.409  Sum_probs=11.8

Q ss_pred             CCccccCCCCCCCceeecCCCCccccccc
Q psy15323          8 GRECVNCGAISTPLWRRDGTGHYLCNACG   36 (139)
Q Consensus         8 ~~~C~nC~~~~tp~WRr~~~g~~lCnaCg   36 (139)
                      ...|..|+....--|=...=+..+|..|-
T Consensus         3 ~~~C~eC~~~f~dSyL~~~F~~~VCD~CR   31 (34)
T PF01286_consen    3 YPKCDECGKPFMDSYLLNNFDLPVCDKCR   31 (34)
T ss_dssp             -EE-TTT--EES-SSCCCCTS-S--TTT-
T ss_pred             CchHhHhCCHHHHHHHHHhCCcccccccc
Confidence            45788888755554443333455777773


No 137
>PF00569 ZZ:  Zinc finger, ZZ type;  InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZZ-type zinc finger domains, named because of their ability to bind two zinc ions []. These domains contain 4-6 Cys residues that participate in zinc binding (plus additional Ser/His residues), including a Cys-X2-Cys motif found in other zinc finger domains. These zinc fingers are thought to be involved in protein-protein interactions. The structure of the ZZ domain shows that it belongs to the family of cross-brace zinc finger motifs that include the PHD, RING, and FYVE domains []. ZZ-type zinc finger domains are found in:   Transcription factors P300 and CBP. Plant proteins involved in light responses, such as Hrb1. E3 ubiquitin ligases MEX and MIB2 (6.3.2 from EC). Dystrophin and its homologues.   Single copies of the ZZ zinc finger occur in the transcriptional adaptor/coactivator proteins P300, in cAMP response element-binding protein (CREB)-binding protein (CBP) and ADA2. CBP provides several binding sites for transcriptional coactivators. The site of interaction with the tumour suppressor protein p53 and the oncoprotein E1A with CBP/P300 is a Cys-rich region that incorporates two zinc-binding motifs: ZZ-type and TAZ2-type. The ZZ-type zinc finger of CBP contains two twisted anti-parallel beta-sheets and a short alpha-helix, and binds two zinc ions []. One zinc ion is coordinated by four cysteine residues via 2 Cys-X2-Cys motifs, and the third zinc ion via a third Cys-X-Cys motif and a His-X-His motif. The first zinc cluster is strictly conserved, whereas the second zinc cluster displays variability in the position of the two His residues. In Arabidopsis thaliana (Mouse-ear cress), the hypersensitive to red and blue 1 (Hrb1) protein, which regulating both red and blue light responses, contains a ZZ-type zinc finger domain [].  ZZ-type zinc finger domains have also been identified in the testis-specific E3 ubiquitin ligase MEX that promotes death receptor-induced apoptosis []. MEX has four putative zinc finger domains: one ZZ-type, one SWIM-type and two RING-type. The region containing the ZZ-type and RING-type zinc fingers is required for interaction with UbcH5a and MEX self-association, whereas the SWIM domain was critical for MEX ubiquitination. In addition, the Cys-rich domains of dystrophin, utrophin and an 87kDa post-synaptic protein contain a ZZ-type zinc finger with high sequence identity to P300/CBP ZZ-type zinc fingers. In dystrophin and utrophin, the ZZ-type zinc finger lies between a WW domain (flanked by and EF hand) and the C-terminal coiled-coil domain. Dystrophin is thought to act as a link between the actin cytoskeleton and the extracellular matrix, and perturbations of the dystrophin-associated complex, for example, between dystrophin and the transmembrane glycoprotein beta-dystroglycan, may lead to muscular dystrophy. Dystrophin and its autosomal homologue utrophin interact with beta-dystroglycan via their C-terminal regions, which are comprised of a WW domain, an EF hand domain and a ZZ-type zinc finger domain []. The WW domain is the primary site of interaction between dystrophin or utrophin and dystroglycan, while the EF hand and ZZ-type zinc finger domains stabilise and strengthen this interaction.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1TOT_A 2DIP_A 2FC7_A 2E5R_A.
Probab=20.30  E-value=77  Score=18.62  Aligned_cols=31  Identities=23%  Similarity=0.451  Sum_probs=17.3

Q ss_pred             CcccccCCCCC--CcceecCC-CCCcccchhhhh
Q psy15323         62 GLCCTNCGTRM--TTLWRRNN-DGEPVCNACGLY   92 (139)
Q Consensus        62 ~~~C~~C~t~~--t~~Wr~~~-~g~~lCnaCgly   92 (139)
                      ...|..|++..  ...|+=.. ....||.+|+.-
T Consensus         4 ~~~C~~C~~~~i~g~Ry~C~~C~d~dLC~~C~~~   37 (46)
T PF00569_consen    4 GYTCDGCGTDPIIGVRYHCLVCPDYDLCEDCFSK   37 (46)
T ss_dssp             SCE-SSS-SSSEESSEEEESSSSS-EEEHHHHHH
T ss_pred             CeECcCCCCCcCcCCeEECCCCCCCchhhHHHhC
Confidence            45677777732  44565332 345799999864


No 138
>PLN03114 ADP-ribosylation factor GTPase-activating protein AGD10; Provisional
Probab=20.29  E-value=65  Score=27.95  Aligned_cols=38  Identities=18%  Similarity=0.423  Sum_probs=30.3

Q ss_pred             ccCcccccCCCCCCcceecCCCCCcccchhhhhHHhhCC
Q psy15323         60 RLGLCCTNCGTRMTTLWRRNNDGEPVCNACGLYYKLHNV   98 (139)
Q Consensus        60 ~~~~~C~~C~t~~t~~Wr~~~~g~~lCnaCgly~~~~~~   98 (139)
                      .....|..|+.. -|.|=.-+-|-.||..|.-..|..++
T Consensus        20 PgNk~CaDCga~-nPtWASvn~GIFLCl~CSGVHRsLGv   57 (395)
T PLN03114         20 SDNKICFDCNAK-NPTWASVTYGIFLCIDCSAVHRSLGV   57 (395)
T ss_pred             cCCCcCccCCCC-CCCceeeccceeehhhhhHhhccCCC
Confidence            456789999985 69999888898999999866655553


No 139
>cd07173 NR_DBD_AR DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers. DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. To regulate gene expression, AR interacts with a palindrome of the core sequence 5'-TGTTCT-3' with a 3-bp spacer. It also binds to the direct repeat  5'-TGTTCT-3' hexamer in some androgen controlled genes. AR is activated by the androgenic hormones, testosterone or dihydrotestosterone, which are responsible for primary and for secondary male characteristics, respectively. The primary mechanism of action of ARs is by direct regulation of gene transcription. The binding of androgen results in a conformational change in the androgen receptor which causes its transport from the cytosol into the cell nucleus, and dimerization. The receptor dimer binds to a hormone response element of AR regulated genes and modul
Probab=20.13  E-value=49  Score=22.16  Aligned_cols=32  Identities=22%  Similarity=0.620  Sum_probs=22.3

Q ss_pred             CCCccccCCCCCCCceeecCCCCccccccccccccc
Q psy15323          7 EGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMN   42 (139)
Q Consensus         7 ~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~k~h   42 (139)
                      +...|..|+...+-.+-    |.+-|+||..+++..
T Consensus         2 ~~~~C~VCg~~a~g~hy----Gv~sC~aCk~FFRR~   33 (82)
T cd07173           2 PQKTCLICGDEASGCHY----GALTCGSCKVFFKRA   33 (82)
T ss_pred             CCCCCeecCCcCcceEE----CcchhhhHHHHHHHH
Confidence            34579999965544332    456899999988654


Done!