Diaphorina citri psyllid: psy15326


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------
MYDVDGNGVIDIQEMTKIVQAIYDMLGACSSNRPADSAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSKMLAP
cccccccccEEHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHccHHHHHHccc
MYDVDGNGVIDIQEMTKIVQAIYDMLGAC*******SAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSKMLAP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYDVDGNGVIDIQEMTKIVQAIYDMLGACSSNRPADSAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSKMLAP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Neuronal calcium sensor 2 Neuronal calcium sensor, regulator of G protein-coupled receptor phosphorylation in a calcium dependent manner.confidentP36609

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0005509 [MF]calcium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0008048 [MF]calcium sensitive guanylate cyclase activator activityprobableGO:0030249, GO:0030234, GO:0030250, GO:0008047, GO:0003674, GO:0010851, GO:0010853
GO:0016247 [MF]channel regulator activityprobableGO:0003674
GO:0008092 [MF]cytoskeletal protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0032991 [CC]macromolecular complexprobableGO:0005575

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JBA, chain A
Confidence level:very confident
Coverage over the Query: 2-77
View the alignment between query and template
View the model in PyMOL