Diaphorina citri psyllid: psy15334

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-
MPSWSDVQSFSIWPPYQVLEPCQFFTNTSEVDFTIGRETCPNEAHYCNGPLKQGTTYRVKVRAFTSPELFTDTIYSPPVSTGKDVSWLLVMGFLVLIVLPVLFIIIRRKIVGVTSPRAGGIRGWLPRMSVTRRDTCHPSQDVTLHNCSHPIPVTLFCTMTLDPDWIAVEFEDLKSVGRGQPTTAAELRCNRPKNRYTNIFPYDSSRYKLQPVDDEEGSDYVNANYIGGYLSPRQYIATQGPLCSTVDDFWRMCWESRTPAIVMLTQCIEKHRDKCYKYWPSDQHPMRCADIEISLQDVCHYGSWVLSELRMCRGGEHRMISHYHFTTWPDSGVPSSPNTLVSFVLSFRTHISPAQHPIVVHCSAGVGRTGTFIALDTVLQRLYNSEGAGSVDILRIVHGLRRQRVLMVQSLAQYAFIYECVQVYLQGGVRHEERQIQNNEAIERDEGVDDL
cccHHHHHccccccccHccccccccccccccCEEECcccccccccCCccccccccEEEEEEEEEccccccccccccccccccccccEEEEHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccHHHHHHHccccccccccHHccccccccccccccccccccccEECccccccccccEEcccccccccccccEEEccccccccHHHHHHHHHHccccEEEEEcccEEcccccccccccccccccEEEEEEEEEEEEEEEccEEEEEEEEECccCEEEEEEEccccccccccccccHHHHHHHHHHHcccccccccEEEEccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccccHHHHHHccccccccccccc
*PSWSDVQSFSIWPPYQVLEPCQFFTNTSEVDFTIGRETCPNEAHYCNGPLKQGTTYRVKVRAFTSPELFTDTIYSPPVSTGKDVSWLLVMGFLVLIVLPVLFIIIRRKIVGVTSPRAGGIRGWLPRMSVTRRDTCHPSQDVTLHNCSHPIPVTLFCTMTLDPDWIAVEFEDLKSVGRGQPTTAAELRCNRPKNRYTNIFPYDSSRYKLQPVDDEEGSDYVNANYIGGYLSPRQYIATQGPLCSTVDDFWRMCWESRTPAIVMLTQCIEKHRDKCYKYWPSDQHPMRCADIEISLQDVCHYGSWVLSELRMCRGGEHRMISHYHFTTWPDSGVPSSPNTLVSFVLSFRTHISPAQHPIVVHCSAGVGRTGTFIALDTVLQRLYNSEGAGSVDILRIVHGLRRQRVLMVQSLAQYAFIYECVQVYLQGGVR*********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPSWSDVQSFSIWPPYQVLEPCQFFTNTSEVDFTIGRETCPNEAHYCNGPLKQGTTYRVKVRAFTSPELFTDTIYSPPVSTGKDVSWLLVMGFLVLIVLPVLFIIIRRKIVGVTSPRAGGIRGWLPRMSVTRRDTCHPSQDVTLHNCSHPIPVTLFCTMTLDPDWIAVEFEDLKSVGRGQPTTAAELRCNRPKNRYTNIFPYDSSRYKLQPVDDEEGSDYVNANYIGGYLSPRQYIATQGPLCSTVDDFWRMCWESRTPAIVMLTQCIEKHRDKCYKYWPSDQHPMRCADIEISLQDVCHYGSWVLSELRMCRGGEHRMISHYHFTTWPDSGVPSSPNTLVSFVLSFRTHISPAQHPIVVHCSAGVGRTGTFIALDTVLQRLYNSEGAGSVDILRIVHGLRRQRVLMVQSLAQYAFIYECVQVYLQGGVRHEERQIQNNEAIERDEGVDDL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tyrosine-protein phosphatase 10D May have a role in axon outgrowth and guidance.confidentP35992

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0031252 [CC]cell leading edgeprobableGO:0005575, GO:0044464, GO:0005623
GO:0016324 [CC]apical plasma membraneprobableGO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0044463 [CC]cell projection partprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0004725 [MF]protein tyrosine phosphatase activityprobableGO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674, GO:0004721
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0030334 [BP]regulation of cell migrationprobableGO:0051270, GO:0050794, GO:0008150, GO:0040012, GO:2000145, GO:0065007, GO:0032879, GO:0050789
GO:0035335 [BP]peptidyl-tyrosine dephosphorylationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0016311, GO:0006470, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0019538, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0009968 [BP]negative regulation of signal transductionprobableGO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0080090 [BP]regulation of primary metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0060255 [BP]regulation of macromolecule metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0007411 [BP]axon guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0005912 [CC]adherens junctionprobableGO:0005575, GO:0070161, GO:0030054
GO:0031323 [BP]regulation of cellular metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222, GO:0050794
GO:0005911 [CC]cell-cell junctionprobableGO:0005575, GO:0030054
GO:0007156 [BP]homophilic cell adhesionprobableGO:0016337, GO:0009987, GO:0044763, GO:0007155, GO:0008150, GO:0022610, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3I36, chain A
Confidence level:very confident
Coverage over the Query: 148-429
View the alignment between query and template
View the model in PyMOL
Template: 2KS1, chain B
Confidence level:probable
Coverage over the Query: 104-110
View the alignment between query and template
View the model in PyMOL
Template: 1UJT, chain A
Confidence level:probable
Coverage over the Query: 44-79
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
2v5y, chain Aprobable Alignment | Template Structure