Query         psy15340
Match_columns 81
No_of_seqs    108 out of 745
Neff          5.2 
Searched_HMMs 29240
Date          Fri Aug 16 18:27:42 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15340.a3m -d /work/01045/syshi/HHdatabase/pdb70.hhm -o /work/01045/syshi/hhsearch_pdb/15340hhsearch_pdb -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 2j6a_A Protein TRM112; transla 100.0 1.5E-33   5E-38  193.4   5.4   79    1-81     50-135 (141)
  2 3q87_A Putative uncharacterize 100.0 1.2E-33   4E-38  190.7  -2.6   75    1-77     44-121 (125)
  3 2jny_A Uncharacterized BCR; st  99.5 1.9E-14 6.5E-19   87.7   2.3   34   47-80     20-53  (67)
  4 2jr6_A UPF0434 protein NMA0874  99.4 3.2E-14 1.1E-18   86.8   2.3   34   47-80     18-51  (68)
  5 2hf1_A Tetraacyldisaccharide-1  99.4   3E-14   1E-18   86.9   1.6   34   47-80     18-51  (68)
  6 2js4_A UPF0434 protein BB2007;  99.4 3.6E-14 1.2E-18   87.0   1.7   34   47-80     18-51  (70)
  7 2pk7_A Uncharacterized protein  99.4 5.3E-14 1.8E-18   86.1   1.5   34   47-80     18-51  (69)
  8 2k5r_A Uncharacterized protein  99.3 2.4E-13 8.3E-18   88.0   0.7   32   49-80     47-78  (97)
  9 2kpi_A Uncharacterized protein  99.3 1.9E-12 6.5E-17   76.2   2.7   28   53-80     24-53  (56)
 10 1pft_A TFIIB, PFTFIIBN; N-term  95.7  0.0064 2.2E-07   33.6   2.3   21   47-67     16-36  (50)
 11 1weo_A Cellulose synthase, cat  91.4   0.041 1.4E-06   35.0   0.3   38   42-79     45-82  (93)
 12 1dl6_A Transcription factor II  88.5     0.2 6.8E-06   28.7   1.6   20   47-66     22-41  (58)
 13 2jrr_A Uncharacterized protein  84.2     0.4 1.4E-05   28.7   1.3   33   43-75     26-60  (67)
 14 2i5o_A DNA polymerase ETA; zin  81.7    0.69 2.3E-05   24.8   1.5   15   54-68      8-22  (39)
 15 3a43_A HYPD, hydrogenase nicke  80.5       1 3.6E-05   29.5   2.5   26   44-69     59-84  (139)
 16 2k5c_A Uncharacterized protein  80.0     1.3 4.3E-05   28.0   2.6   46    4-67     17-63  (95)
 17 2kdx_A HYPA, hydrogenase/ureas  79.1     1.3 4.4E-05   28.0   2.5   25   45-69     63-87  (119)
 18 2m0f_A Zinc finger and BTB dom  77.7    0.95 3.3E-05   19.6   1.2   13   55-67      2-14  (29)
 19 2jz8_A Uncharacterized protein  77.3    0.91 3.1E-05   28.4   1.3   23   52-74     45-67  (87)
 20 2jvm_A Uncharacterized protein  75.5     0.6   2E-05   28.8   0.1   31   42-72     38-70  (80)
 21 2e72_A POGO transposable eleme  74.5     0.7 2.4E-05   26.2   0.2   16   54-69     11-26  (49)
 22 2m0d_A Zinc finger and BTB dom  74.4     1.4 4.8E-05   19.0   1.3   14   55-68      3-16  (30)
 23 2kvh_A Zinc finger and BTB dom  73.0     1.6 5.4E-05   18.9   1.2   14   55-68      3-16  (27)
 24 1rik_A E6APC1 peptide; E6-bind  70.2     1.8 6.2E-05   18.7   1.1   14   56-69      3-16  (29)
 25 1znf_A 31ST zinc finger from X  69.7     1.6 5.6E-05   18.6   0.9   13   56-68      2-14  (27)
 26 1vyx_A ORF K3, K3RING; zinc-bi  69.0     0.4 1.4E-05   27.2  -1.7   28   41-68     32-60  (60)
 27 1ard_A Yeast transcription fac  68.9     1.6 5.4E-05   18.9   0.7   13   56-68      3-15  (29)
 28 2m0e_A Zinc finger and BTB dom  68.9     1.6 5.6E-05   18.7   0.8   14   56-69      3-16  (29)
 29 2kvf_A Zinc finger and BTB dom  67.8     2.3 7.9E-05   18.3   1.2   14   55-68      3-16  (28)
 30 2kvg_A Zinc finger and BTB dom  67.8       2   7E-05   18.7   1.0   14   55-68      3-16  (27)
 31 2lvu_A Zinc finger and BTB dom  70.3     1.2   4E-05   19.2   0.0   15   56-70      3-17  (26)
 32 1paa_A Yeast transcription fac  66.2     2.1 7.1E-05   18.7   0.9   14   56-69      3-16  (30)
 33 2elx_A Zinc finger protein 406  65.8     2.5 8.4E-05   19.2   1.1   15   54-68      6-20  (35)
 34 1klr_A Zinc finger Y-chromosom  64.6     2.1 7.2E-05   18.4   0.7   13   56-68      3-15  (30)
 35 1twf_L ABC10-alpha, DNA-direct  64.3     3.4 0.00011   24.5   1.7   19   54-72     27-45  (70)
 36 2odx_A Cytochrome C oxidase po  63.9     3.5 0.00012   25.1   1.7   23   46-68     46-69  (80)
 37 2elo_A Zinc finger protein 406  63.0     2.6 8.8E-05   19.5   0.9   16   53-68      7-22  (37)
 38 1v54_F VI, cytochrome C oxidas  62.6     3.5 0.00012   26.0   1.6   23   46-68     69-92  (98)
 39 2lvt_A Zinc finger and BTB dom  66.4     1.6 5.5E-05   19.1   0.0   15   56-70      3-17  (29)
 40 3k1f_M Transcription initiatio  62.3     4.6 0.00016   28.6   2.3   19   47-65     34-52  (197)
 41 2akl_A PHNA-like protein PA012  61.9     2.8 9.6E-05   28.2   1.1   14   53-66     42-55  (138)
 42 1srk_A Zinc finger protein ZFP  61.5     3.6 0.00012   18.7   1.2   16   53-68      5-20  (35)
 43 2elm_A Zinc finger protein 406  61.4     3.4 0.00012   19.4   1.1   16   53-68      7-22  (37)
 44 2elp_A Zinc finger protein 406  60.9     3.6 0.00012   19.0   1.2   16   53-68      7-22  (37)
 45 2els_A Zinc finger protein 406  60.7     3.8 0.00013   18.8   1.3   15   54-68      8-22  (36)
 46 2elt_A Zinc finger protein 406  60.2     3.7 0.00013   18.7   1.1   16   53-68      7-22  (36)
 47 2elr_A Zinc finger protein 406  60.1     3.1 0.00011   19.0   0.9   16   53-68      7-22  (36)
 48 2lvr_A Zinc finger and BTB dom  64.4     1.9 6.3E-05   18.8   0.0   16   55-70      3-18  (30)
 49 1p7a_A BF3, BKLF, kruppel-like  60.0       3  0.0001   19.3   0.8   16   53-68      9-24  (37)
 50 2elv_A Zinc finger protein 406  58.5     4.3 0.00015   18.6   1.2   16   53-68      7-22  (36)
 51 2kfq_A FP1; protein, de novo p  58.3     2.8 9.6E-05   19.1   0.5   15   56-70      3-17  (32)
 52 4bbr_M Transcription initiatio  58.2     5.4 0.00018   29.5   2.2   17   49-65     36-52  (345)
 53 1njq_A Superman protein; zinc-  57.7     4.3 0.00015   19.1   1.2   15   54-68      5-19  (39)
 54 2elq_A Zinc finger protein 406  57.3     4.4 0.00015   18.6   1.1   16   53-68      7-22  (36)
 55 2drp_A Protein (tramtrack DNA-  56.1     6.6 0.00023   20.5   1.9   13   54-66      9-21  (66)
 56 1rim_A E6APC2 peptide; E6-bind  55.2     3.9 0.00013   18.8   0.7   13   56-68      3-15  (33)
 57 2y69_F Cytochrome C oxidase su  54.8     4.8 0.00017   26.6   1.4   22   47-68    101-123 (129)
 58 3mjh_B Early endosome antigen   54.7     4.5 0.00016   20.9   1.0   13   53-66      4-16  (34)
 59 2epv_A Zinc finger protein 268  54.6     5.3 0.00018   19.4   1.2   17   52-68      9-25  (44)
 60 1vq8_Z 50S ribosomal protein L  54.5     8.2 0.00028   23.4   2.3   18   48-65     38-55  (83)
 61 2ecv_A Tripartite motif-contai  54.4     7.1 0.00024   21.7   1.9   25   54-78     58-82  (85)
 62 2el5_A Zinc finger protein 268  54.4     4.6 0.00016   19.2   1.0   16   53-68      8-23  (42)
 63 2emb_A Zinc finger protein 473  54.3     5.1 0.00018   19.3   1.1   17   52-68      9-25  (44)
 64 2eox_A Zinc finger protein 473  53.9     5.1 0.00018   19.3   1.1   18   52-69      9-26  (44)
 65 2epc_A Zinc finger protein 32;  53.4     5.6 0.00019   18.8   1.2   17   52-68      8-24  (42)
 66 3iuf_A Zinc finger protein UBI  53.2     5.2 0.00018   20.2   1.1   15   54-68      6-20  (48)
 67 1mzb_A Ferric uptake regulatio  53.1     5.3 0.00018   25.2   1.3   15   55-69     91-105 (136)
 68 2yts_A Zinc finger protein 484  53.1     5.6 0.00019   19.3   1.2   17   52-68      9-25  (46)
 69 2jsp_A Transcriptional regulat  52.9     5.4 0.00018   24.8   1.3   18   50-67     16-33  (87)
 70 2emi_A Zinc finger protein 484  52.9     5.6 0.00019   19.3   1.2   17   52-68      9-25  (46)
 71 2ecw_A Tripartite motif-contai  52.4     7.3 0.00025   21.7   1.7   24   54-77     58-81  (85)
 72 2em4_A Zinc finger protein 28   52.3       6 0.00021   19.3   1.2   17   52-68      9-25  (46)
 73 2yu5_A Zinc finger protein 473  51.8     5.6 0.00019   19.2   1.0   17   52-68      9-25  (44)
 74 1vd4_A Transcription initiatio  51.7     8.3 0.00028   20.5   1.8   21   50-70     34-54  (62)
 75 2eoy_A Zinc finger protein 473  51.7     6.4 0.00022   19.2   1.3   17   52-68      9-25  (46)
 76 2ept_A Zinc finger protein 32;  51.7     6.6 0.00023   18.5   1.3   16   53-68      8-23  (41)
 77 2l8e_A Polyhomeotic-like prote  51.7     6.3 0.00022   21.8   1.3   21   49-69     12-32  (49)
 78 2ytb_A Zinc finger protein 32;  51.1       5 0.00017   19.0   0.8   16   53-68      9-24  (42)
 79 2emj_A Zinc finger protein 28   50.9     6.1 0.00021   19.3   1.1   16   53-68     10-25  (46)
 80 2emx_A Zinc finger protein 268  50.9     6.4 0.00022   18.9   1.2   16   53-68      8-23  (44)
 81 2en2_A B-cell lymphoma 6 prote  50.6     6.5 0.00022   18.6   1.1   16   53-68      9-24  (42)
 82 2eow_A Zinc finger protein 347  50.5     6.6 0.00023   19.0   1.2   16   53-68     10-25  (46)
 83 2yrj_A Zinc finger protein 473  50.5     6.9 0.00024   18.9   1.3   17   52-68      9-25  (46)
 84 1fv5_A First zinc finger of U-  50.1     5.6 0.00019   20.0   0.9   16   53-68      6-21  (36)
 85 2eoj_A Zinc finger protein 268  49.9     4.9 0.00017   19.3   0.6   16   53-68     10-25  (44)
 86 2em3_A Zinc finger protein 28   49.9     6.7 0.00023   19.0   1.2   17   52-68      9-25  (46)
 87 2em8_A Zinc finger protein 224  49.6       7 0.00024   19.0   1.2   17   52-68      9-25  (46)
 88 2yte_A Zinc finger protein 473  49.5       5 0.00017   19.0   0.6   16   53-68      8-23  (42)
 89 2ene_A Zinc finger protein 347  49.3     6.7 0.00023   19.0   1.1   17   52-68      9-25  (46)
 90 2fe3_A Peroxide operon regulat  49.2     6.9 0.00024   25.0   1.4   16   55-70     93-108 (145)
 91 1yui_A GAGA-factor; complex (D  49.1     7.1 0.00024   19.9   1.2   16   53-68     22-37  (54)
 92 2emg_A Zinc finger protein 484  49.1     5.8  0.0002   19.3   0.8   16   53-68     10-25  (46)
 93 2eos_A B-cell lymphoma 6 prote  49.0     6.1 0.00021   18.8   0.9   16   53-68      9-24  (42)
 94 2eoo_A ZFP-95, zinc finger pro  49.0     7.3 0.00025   18.9   1.2   16   53-68     10-25  (46)
 95 2eml_A Zinc finger protein 28   48.9     7.1 0.00024   18.9   1.2   17   52-68      9-25  (46)
 96 3mwm_A ZUR, putative metal upt  48.9     6.8 0.00023   24.9   1.3   15   55-69     87-101 (139)
 97 2eof_A Zinc finger protein 268  48.8     6.7 0.00023   18.7   1.0   17   52-68      9-25  (44)
 98 2enf_A Zinc finger protein 347  48.8     5.8  0.0002   19.3   0.8   16   53-68     10-25  (46)
 99 2em5_A ZFP-95, zinc finger pro  48.7     7.4 0.00025   18.9   1.2   16   53-68     10-25  (46)
100 2ysp_A Zinc finger protein 224  48.7     6.7 0.00023   19.0   1.0   17   52-68      9-25  (46)
101 2en9_A Zinc finger protein 28   48.6     5.8  0.0002   19.4   0.8   17   52-68      9-25  (46)
102 2yto_A Zinc finger protein 484  48.5     7.7 0.00026   18.9   1.3   17   52-68      9-25  (46)
103 2ytp_A Zinc finger protein 484  48.4     7.2 0.00025   19.0   1.1   16   53-68     10-25  (46)
104 2em9_A Zinc finger protein 224  48.3     7.4 0.00025   18.8   1.2   17   52-68      9-25  (46)
105 2emy_A Zinc finger protein 268  48.3     7.8 0.00027   18.8   1.3   17   52-68      9-25  (46)
106 2ep3_A Zinc finger protein 484  48.1     7.8 0.00027   18.8   1.2   16   53-68     10-25  (46)
107 2eoz_A Zinc finger protein 473  48.1     6.7 0.00023   19.1   1.0   16   53-68     10-25  (46)
108 2yso_A ZFP-95, zinc finger pro  48.0     7.1 0.00024   18.9   1.1   17   52-68      9-25  (46)
109 2epw_A Zinc finger protein 268  47.8     7.8 0.00027   18.7   1.2   17   52-68      9-25  (46)
110 2em7_A Zinc finger protein 224  47.7     7.1 0.00024   18.9   1.0   16   53-68     10-25  (46)
111 2eou_A Zinc finger protein 473  47.7     5.9  0.0002   19.1   0.7   16   53-68     10-25  (44)
112 2em2_A Zinc finger protein 28   47.6     7.7 0.00026   18.9   1.2   17   52-68      9-25  (46)
113 2egp_A Tripartite motif-contai  47.5     8.4 0.00029   21.3   1.5   24   54-77     52-75  (79)
114 2ytk_A Zinc finger protein 347  47.3     7.5 0.00025   18.8   1.1   17   52-68      9-25  (46)
115 2eon_A ZFP-95, zinc finger pro  47.3     5.6 0.00019   19.5   0.6   17   52-68      9-25  (46)
116 2en6_A Zinc finger protein 268  47.2     7.5 0.00026   18.8   1.1   17   52-68      9-25  (46)
117 2d8s_A Cellular modulator of i  47.0     7.9 0.00027   22.8   1.3   19   54-72     57-75  (80)
118 3eyy_A Putative iron uptake re  47.0       7 0.00024   25.0   1.2   15   55-69     90-104 (145)
119 3k7a_M Transcription initiatio  46.9       5 0.00017   29.4   0.5   18   48-65     35-52  (345)
120 2ytg_A ZFP-95, zinc finger pro  46.9     7.9 0.00027   18.7   1.1   18   52-69      9-26  (46)
121 2eor_A Zinc finger protein 224  46.8     8.3 0.00029   18.6   1.2   16   53-68     10-25  (46)
122 2xig_A Ferric uptake regulatio  46.7     7.6 0.00026   25.0   1.3   16   54-69     98-113 (150)
123 2enh_A Zinc finger protein 28   46.6     6.7 0.00023   19.1   0.9   16   53-68     10-25  (46)
124 2ytf_A Zinc finger protein 268  46.5     7.8 0.00027   18.7   1.1   16   53-68     10-25  (46)
125 2eov_A Zinc finger protein 484  46.4     6.7 0.00023   19.0   0.8   16   53-68     10-25  (46)
126 2ytj_A Zinc finger protein 484  46.4     8.6 0.00029   18.6   1.2   16   53-68     10-25  (46)
127 2eq1_A Zinc finger protein 347  46.2     6.2 0.00021   19.2   0.7   16   53-68     10-25  (46)
128 2emf_A Zinc finger protein 484  46.1     7.5 0.00025   18.9   1.0   17   52-68      9-25  (46)
129 2ema_A Zinc finger protein 347  45.9     7.8 0.00027   18.8   1.0   16   53-68     10-25  (46)
130 2emh_A Zinc finger protein 484  45.9     8.1 0.00028   18.7   1.1   16   53-68     10-25  (46)
131 2en3_A ZFP-95, zinc finger pro  45.8     8.1 0.00028   18.7   1.1   16   53-68     10-25  (46)
132 4ets_A Ferric uptake regulatio  45.8       8 0.00027   25.4   1.3   15   55-69    107-121 (162)
133 2el4_A Zinc finger protein 268  45.6     8.2 0.00028   18.6   1.1   16   53-68     10-25  (46)
134 3j20_Y 30S ribosomal protein S  45.4     9.5 0.00033   21.0   1.4   14   52-65     34-47  (50)
135 2elz_A Zinc finger protein 224  45.4       7 0.00024   19.0   0.8   17   52-68      9-25  (46)
136 2eme_A Zinc finger protein 473  45.3     9.1 0.00031   18.4   1.2   16   53-68     10-25  (46)
137 2yu8_A Zinc finger protein 347  45.3     9.1 0.00031   18.5   1.2   16   53-68     10-25  (46)
138 2w57_A Ferric uptake regulatio  45.2     8.3 0.00028   24.8   1.3   15   55-69     90-104 (150)
139 2em6_A Zinc finger protein 224  45.1     7.3 0.00025   18.9   0.8   16   53-68     10-25  (46)
140 2emp_A Zinc finger protein 347  45.0     8.2 0.00028   18.7   1.0   16   53-68     10-25  (46)
141 1t1h_A Gspef-atpub14, armadill  45.0     4.2 0.00014   22.8  -0.1   24   53-76     41-64  (78)
142 2en8_A Zinc finger protein 224  45.0     9.1 0.00031   18.4   1.2   16   53-68     10-25  (46)
143 2emm_A ZFP-95, zinc finger pro  44.7     8.4 0.00029   18.6   1.0   16   53-68     10-25  (46)
144 2epx_A Zinc finger protein 28   44.4     7.5 0.00026   18.8   0.8   16   53-68     10-25  (47)
145 2en7_A Zinc finger protein 268  44.4     5.9  0.0002   18.9   0.4   16   53-68     10-25  (44)
146 1g25_A CDK-activating kinase a  44.3     8.6 0.00029   20.8   1.1   23   53-75     41-63  (65)
147 2ely_A Zinc finger protein 224  44.2     7.5 0.00026   18.9   0.8   18   52-69      9-26  (46)
148 2epu_A Zinc finger protein 32;  43.9     9.2 0.00032   18.5   1.1   16   53-68     10-25  (45)
149 2en1_A Zinc finger protein 224  43.8     9.3 0.00032   18.5   1.1   16   53-68     10-25  (46)
150 2ab3_A ZNF29; zinc finger prot  43.6     9.2 0.00031   16.1   1.0   13   56-68      3-17  (29)
151 2ep2_A Zinc finger protein 484  43.6     8.7  0.0003   18.6   1.0   16   53-68     10-25  (46)
152 1v87_A Deltex protein 2; ring-  43.3     9.5 0.00032   22.8   1.3   19   53-71     80-98  (114)
153 2eoh_A Zinc finger protein 28   43.0       7 0.00024   19.0   0.6   16   53-68     10-25  (46)
154 2yth_A Zinc finger protein 224  43.0     7.8 0.00027   18.8   0.7   16   53-68     10-25  (46)
155 2eq3_A Zinc finger protein 347  42.9     7.7 0.00026   18.7   0.7   16   53-68     10-25  (46)
156 2yti_A Zinc finger protein 347  42.9       8 0.00027   18.7   0.8   16   53-68     10-25  (46)
157 2enc_A Zinc finger protein 224  42.8      11 0.00036   18.3   1.2   17   52-68      9-25  (46)
158 2ep1_A Zinc finger protein 484  42.7     6.8 0.00023   18.9   0.5   16   53-68     10-25  (46)
159 3dqy_A Toluene 1,2-dioxygenase  42.7      13 0.00045   22.1   1.9   25   50-74     53-77  (106)
160 2el6_A Zinc finger protein 268  42.7      10 0.00035   18.4   1.2   16   53-68     10-25  (46)
161 2epz_A Zinc finger protein 28   42.6     7.7 0.00026   18.8   0.7   16   53-68     10-25  (46)
162 2ytn_A Zinc finger protein 347  42.5     8.3 0.00028   18.7   0.8   16   53-68     10-25  (46)
163 2emz_A ZFP-95, zinc finger pro  42.5     6.8 0.00023   19.1   0.5   16   53-68     10-25  (46)
164 2eq0_A Zinc finger protein 347  42.4      11 0.00038   18.2   1.3   16   53-68     10-25  (46)
165 2xeu_A Ring finger protein 4;   42.1     8.3 0.00029   20.3   0.8   20   55-74     44-63  (64)
166 2emk_A Zinc finger protein 28   42.0     8.6 0.00029   18.7   0.8   16   53-68     10-25  (46)
167 2eq2_A Zinc finger protein 347  41.9     8.4 0.00029   18.7   0.8   16   53-68     10-25  (46)
168 2eop_A Zinc finger protein 268  41.7     8.7  0.0003   18.5   0.8   16   53-68     10-25  (46)
169 2ep0_A Zinc finger protein 28   41.3      11 0.00039   18.1   1.2   16   53-68     10-25  (46)
170 6rxn_A Rubredoxin; electron tr  41.3      10 0.00036   20.6   1.1   18   55-72      4-21  (46)
171 2eoe_A Zinc finger protein 347  41.1     8.1 0.00028   18.6   0.6   16   53-68     10-25  (46)
172 2ytd_A Zinc finger protein 473  41.1      11 0.00037   18.2   1.1   16   53-68     10-25  (46)
173 3ng2_A RNF4, snurf, ring finge  41.0      14 0.00047   20.0   1.6   21   55-75     51-71  (71)
174 2lv2_A Insulinoma-associated p  41.0     9.2 0.00031   22.5   0.9   17   52-68     25-41  (85)
175 2wx3_A MRNA-decapping enzyme 1  40.2      11 0.00037   21.4   1.1   16   32-47     24-39  (51)
176 2eq4_A Zinc finger protein 224  40.1     8.6 0.00029   18.5   0.6   16   53-68     10-25  (46)
177 2yrm_A B-cell lymphoma 6 prote  39.7      10 0.00034   18.3   0.8   16   53-68      8-23  (43)
178 2em0_A Zinc finger protein 224  39.4       9 0.00031   18.5   0.6   16   53-68     10-25  (46)
179 2eoq_A Zinc finger protein 224  39.2     8.6 0.00029   18.6   0.5   16   53-68     10-25  (46)
180 2eom_A ZFP-95, zinc finger pro  38.8     9.6 0.00033   18.5   0.7   16   53-68     10-25  (46)
181 2lcq_A Putative toxin VAPC6; P  38.4      12  0.0004   24.4   1.2   14   55-68    132-145 (165)
182 2epr_A POZ-, at HOOK-, and zin  38.4      13 0.00043   18.3   1.1   16   53-68     10-25  (48)
183 1sp2_A SP1F2; zinc finger, tra  38.3      11 0.00036   16.5   0.8   13   56-68      3-17  (31)
184 3flo_B DNA polymerase alpha ca  38.3      13 0.00044   26.0   1.5   17   55-72     22-38  (206)
185 2ytr_A Zinc finger protein 347  38.3     7.4 0.00025   18.8   0.2   16   53-68     10-25  (46)
186 2ytq_A Zinc finger protein 268  38.2     9.6 0.00033   18.5   0.6   16   53-68     10-25  (46)
187 1f2i_G Fusion of N-terminal 17  38.1      13 0.00045   19.7   1.2   17   52-68     46-62  (73)
188 1wii_A Hypothetical UPF0222 pr  38.1      13 0.00043   22.8   1.3   16   52-67     44-59  (85)
189 2o03_A Probable zinc uptake re  37.6      13 0.00044   23.2   1.3   16   54-69     82-97  (131)
190 3uk3_C Zinc finger protein 217  37.6      14 0.00048   18.5   1.2   17   53-69     30-46  (57)
191 2wx4_A DCP1, decapping protein  37.5       8 0.00027   21.5   0.3   16   33-48     23-38  (46)
192 2v3b_B Rubredoxin 2, rubredoxi  37.1      21 0.00071   19.9   2.0   18   55-72      3-20  (55)
193 2qpz_A Naphthalene 1,2-dioxyge  37.1      18 0.00062   21.3   1.9   24   50-73     55-78  (103)
194 2ct1_A Transcriptional repress  36.2      14 0.00046   20.0   1.1   12   55-66     15-26  (77)
195 1bbo_A Human enhancer-binding   36.0      15 0.00051   18.4   1.2   16   53-68     27-42  (57)
196 2ytm_A Zinc finger protein 28   35.9     9.5 0.00033   18.6   0.4   16   53-68     10-25  (46)
197 1yk4_A Rubredoxin, RD; electro  35.7      22 0.00075   19.6   1.9   18   55-72      2-19  (52)
198 2epq_A POZ-, at HOOK-, and zin  35.3      12 0.00041   18.0   0.7   16   53-68      8-23  (45)
199 2adr_A ADR1; transcription reg  35.1      16 0.00054   18.5   1.2   17   53-69     28-44  (60)
200 1gh9_A 8.3 kDa protein (gene M  35.1      15  0.0005   21.8   1.2   13   56-69      5-17  (71)
201 3h0g_I DNA-directed RNA polyme  34.9      22 0.00076   22.2   2.1   16   55-70     26-41  (113)
202 1e8j_A Rubredoxin; iron-sulfur  34.4      23 0.00078   19.5   1.9   18   55-72      3-20  (52)
203 3na7_A HP0958; flagellar bioge  34.1      15  0.0005   25.8   1.2   13   53-65    220-232 (256)
204 3gce_A Ferredoxin component of  34.1      22 0.00076   21.8   2.0   26   50-75     64-89  (121)
205 2nn6_I 3'-5' exoribonuclease C  34.0      17 0.00058   25.1   1.5   15   52-66    182-196 (209)
206 2ytt_A Zinc finger protein 473  33.8      14 0.00047   17.9   0.8   16   53-68     10-25  (46)
207 1s5p_A NAD-dependent deacetyla  33.4      21 0.00071   24.7   1.9   26   46-71    104-129 (235)
208 1x6e_A Zinc finger protein 24;  33.2      18 0.00062   19.2   1.3   15   53-67     12-26  (72)
209 1x5w_A Zinc finger protein 64,  33.2      17 0.00058   19.1   1.2   13   55-67      9-21  (70)
210 1bor_A Transcription factor PM  33.1      11 0.00036   20.2   0.3   19   54-72     36-54  (56)
211 2yt9_A Zinc finger-containing   33.0      18 0.00061   19.9   1.3   13   54-66      6-18  (95)
212 3h0g_L DNA-directed RNA polyme  32.8      15 0.00053   21.3   1.0   23   53-75     36-58  (63)
213 2d9h_A Zinc finger protein 692  32.8      18 0.00061   19.4   1.2   12   55-66      7-18  (78)
214 2i7f_A Ferredoxin component of  32.6      23 0.00079   21.0   1.8   24   50-73     56-79  (108)
215 1dx8_A Rubredoxin; electron tr  32.6      27 0.00093   20.4   2.1   19   54-72      6-24  (70)
216 2eps_A POZ-, at HOOK-, and zin  32.2      20 0.00067   18.1   1.3   15   53-67     10-24  (54)
217 2kn9_A Rubredoxin; metalloprot  32.1      26  0.0009   21.2   2.0   19   54-72     26-44  (81)
218 1qyp_A RNA polymerase II; tran  32.0      21 0.00071   19.5   1.4   13   55-67     43-55  (57)
219 2lce_A B-cell lymphoma 6 prote  31.4      15 0.00052   19.6   0.8   15   53-67     15-29  (74)
220 4rxn_A Rubredoxin; electron tr  31.4      27 0.00094   19.5   1.9   18   55-72      3-20  (54)
221 2ctu_A Zinc finger protein 483  31.2      28 0.00096   17.9   1.9   20   52-71     15-34  (73)
222 1k81_A EIF-2-beta, probable tr  31.2      15  0.0005   18.8   0.6   14   55-68     21-34  (36)
223 3qxb_A Putative xylose isomera  31.2      72  0.0025   21.8   4.4   17    4-20    263-279 (316)
224 3m7n_A Putative uncharacterize  30.6      20 0.00067   24.0   1.4   15   52-66    153-167 (179)
225 2de6_D Ferredoxin component of  30.6      26  0.0009   21.2   1.9   24   50-73     57-80  (115)
226 1b0n_B Protein (SINI protein);  30.4      28 0.00097   19.7   1.8   16    5-20     13-28  (57)
227 2ctd_A Zinc finger protein 512  30.4      20 0.00069   20.9   1.2   14   52-65     31-44  (96)
228 2gqj_A Zinc finger protein KIA  30.3      15 0.00051   21.1   0.7   15   52-66     21-35  (98)
229 2kmk_A Zinc finger protein GFI  30.0      21 0.00072   18.9   1.2   16   53-68     55-70  (82)
230 1zr9_A Zinc finger protein 593  29.4      16 0.00055   23.7   0.7   16   51-66     46-61  (124)
231 1zfd_A SWI5; DNA binding motif  29.3      18 0.00063   15.7   0.8   13   56-68      4-18  (32)
232 2lt7_A Transcriptional regulat  29.0      26 0.00089   21.7   1.7   17   52-68     17-35  (133)
233 2wbs_A Krueppel-like factor 4;  28.9      23 0.00077   19.2   1.2   17   52-68     62-78  (89)
234 2ct7_A Ring finger protein 31;  28.7      26 0.00089   20.6   1.5   11   56-66     44-54  (86)
235 1x6h_A Transcriptional repress  28.7      18 0.00061   19.5   0.8   12   55-66     15-26  (86)
236 1s24_A Rubredoxin 2; electron   28.5      30   0.001   21.3   1.8   20   53-72     33-52  (87)
237 2b9d_A E7 protein; zinc finger  27.9      27 0.00091   19.4   1.4   27   33-63     23-49  (52)
238 1a1h_A QGSR zinc finger peptid  27.6      25 0.00086   19.0   1.3   16   53-68     60-75  (90)
239 3pwf_A Rubrerythrin; non heme   27.3      24 0.00083   23.6   1.4   19   53-73    136-154 (170)
240 2l9z_A PR domain zinc finger p  27.2      28 0.00096   18.6   1.3   25   54-78     10-37  (39)
241 1jm7_A BRCA1, breast cancer ty  27.1      23 0.00079   20.8   1.1   23   53-75     56-78  (112)
242 3o9x_A Uncharacterized HTH-typ  26.7      17 0.00059   22.2   0.5   11   54-64      1-11  (133)
243 4gzn_C ZFP-57, zinc finger pro  26.7      26  0.0009   19.0   1.2    9   57-65      6-14  (60)
244 2epp_A POZ-, at HOOK-, and zin  26.6      19 0.00066   20.2   0.7   16   53-68     11-26  (66)
245 1m2k_A Silent information regu  26.4      27 0.00091   24.4   1.5   26   44-69    110-135 (249)
246 2cot_A Zinc finger protein 435  26.1      26 0.00088   18.7   1.1   18   52-69     43-60  (77)
247 2djb_A Polycomb group ring fin  25.7      30   0.001   18.9   1.4   19   55-73     50-68  (72)
248 2con_A RUH-035 protein, NIN on  25.5      20 0.00068   21.7   0.6   21   44-64     19-39  (79)
249 3sr0_A Adenylate kinase; phosp  25.3      30   0.001   23.2   1.6   21   52-72    121-141 (206)
250 3u31_A SIR2A, transcriptional   25.1      29 0.00098   25.2   1.5   24   46-69    145-168 (290)
251 2ct2_A Tripartite motif protei  25.0      33  0.0011   19.1   1.5   25   51-75     11-35  (88)
252 1e4u_A Transcriptional repress  24.8      45  0.0015   19.2   2.1   17   53-69     48-64  (78)
253 1ncs_A Peptide M30F, transcrip  24.7      34  0.0012   16.7   1.4   20   50-69     13-34  (47)
254 1twf_I B12.6, DNA-directed RNA  24.5      30   0.001   21.9   1.3   18   53-70     24-41  (122)
255 1va1_A Transcription factor SP  24.5      34  0.0012   15.6   1.3   15   54-68      7-23  (37)
256 3ttc_A HYPF, transcriptional r  24.4      25 0.00085   28.5   1.1   18   56-73     40-57  (657)
257 2dmd_A Zinc finger protein 64,  24.3      24 0.00081   19.4   0.8   13   54-66      7-19  (96)
258 1lv3_A Hypothetical protein YA  24.3      30   0.001   20.4   1.2   15   54-68      8-22  (68)
259 4g9i_A Hydrogenase maturation   24.2      27 0.00093   28.7   1.3   18   56-73    129-146 (772)
260 3sp4_A Aprataxin-like protein;  24.1      26 0.00089   24.5   1.1   14   53-66    167-180 (204)
261 1bhi_A CRE-BP1, ATF-2; CRE bin  24.0      34  0.0012   15.4   1.2   15   54-68      5-21  (38)
262 1vm9_A Toluene-4-monooxygenase  23.8      42  0.0014   19.9   1.9   24   50-73     55-78  (111)
263 1x4s_A Protein FON, zinc finge  23.7      26  0.0009   20.1   0.9   14   52-65     23-36  (59)
264 1m3v_A FLIN4, fusion of the LI  23.6      28 0.00096   21.3   1.0   23   50-72     98-120 (122)
265 1llm_C Chimera of ZIF23-GCN4;   23.5      33  0.0011   18.8   1.3   11   56-66     32-42  (88)
266 1fqt_A Rieske-type ferredoxin   23.3      44  0.0015   20.0   1.9   23   51-73     59-81  (112)
267 3ga8_A HTH-type transcriptiona  23.2      31  0.0011   19.8   1.2   13   54-66     35-47  (78)
268 2dlk_A Novel protein; ZF-C2H2   22.9      23 0.00078   18.8   0.5   12   54-65     67-78  (79)
269 1l1o_C Replication protein A 7  22.6      42  0.0014   22.3   1.8   15   52-66     59-73  (181)
270 2csh_A Zinc finger protein 297  22.5      35  0.0012   19.3   1.3   17   52-68     62-78  (110)
271 3vth_A Hydrogenase maturation   22.3      29 0.00097   28.6   1.1   18   56-73    134-151 (761)
272 2ysl_A Tripartite motif-contai  22.0      32  0.0011   18.6   1.0   15   54-68     56-70  (73)
273 1x4j_A Ring finger protein 38;  21.8      35  0.0012   18.7   1.2   14   57-70     62-75  (75)
274 1ma3_A SIR2-AF2, transcription  21.8      40  0.0014   23.5   1.7   26   44-69    112-137 (253)
275 2dmi_A Teashirt homolog 3; zin  21.7      36  0.0012   19.5   1.2   13   54-66     18-30  (115)
276 4ap4_A E3 ubiquitin ligase RNF  21.4      39  0.0013   20.0   1.4   23   55-77     48-70  (133)
277 1lko_A Rubrerythrin all-iron(I  21.4      31   0.001   23.2   1.0   12   55-66    155-166 (191)
278 2ebt_A Krueppel-like factor 5;  21.3      31   0.001   19.0   0.8   16   53-68     73-88  (100)
279 2eod_A TNF receptor-associated  21.3      43  0.0015   17.4   1.4   11   56-66     11-21  (66)
280 2kr4_A Ubiquitin conjugation f  21.1      35  0.0012   19.7   1.1   21   55-75     48-68  (85)
281 2gmg_A Hypothetical protein PF  20.9      39  0.0013   21.5   1.3   12   54-65     66-77  (105)
282 1iym_A EL5; ring-H2 finger, ub  20.5      34  0.0012   17.4   0.8   13   55-67     43-55  (55)
283 1yc5_A NAD-dependent deacetyla  20.5      37  0.0013   23.5   1.2   25   44-68    110-134 (246)
284 2dlq_A GLI-kruppel family memb  20.4      41  0.0014   19.2   1.3   17   52-68     63-79  (124)
285 1tfi_A Transcriptional elongat  20.4      38  0.0013   18.4   1.0   13   55-67     37-49  (50)
286 2ee8_A Protein ODD-skipped-rel  20.2      35  0.0012   19.1   0.9   14   54-67     16-29  (106)
287 1l8d_A DNA double-strand break  20.0      34  0.0011   20.6   0.9   12   55-66     47-58  (112)

No 1  
>2j6a_A Protein TRM112; translation termination, methyltransferase, transferase, ERF1, nuclear protein, protein methylation; 1.7A {Saccharomyces cerevisiae}
Probab=99.98  E-value=1.5e-33  Score=193.42  Aligned_cols=79  Identities=28%  Similarity=0.607  Sum_probs=74.2

Q ss_pred             CCccccHHHHHHHHHHhCCCCCCCCCCccCcc-----cccHH--HHHHhhhhceeeeeccceeEeCCCCccccccCCccc
Q psy15340          1 MIPKLDWSAFYKATLMLGDAEISIPEKLIDSY-----EKDSE--FLKKVHHALLEVEVVEGDLECPESGRKFPISSGIPN   73 (81)
Q Consensus         1 ml~kldw~al~~aa~~lg~~~~~lP~~~~~~~-----~~~e~--~l~~lh~~ll~~~v~eg~L~C~~c~~~ypI~dGIP~   73 (81)
                      ||||+||+||++||++||.  .+||+++|+++     ++||+  |||++||+++++++.+|+|+|+.||++|||+|||||
T Consensus        50 mlpkldW~aL~~aA~~lg~--~~LP~~~pe~~~~~~~~~dee~~~Lk~lHh~lle~~v~eg~L~C~~cg~~YPI~dGIP~  127 (141)
T 2j6a_A           50 IVDRVDWPAVLTVAAELGN--NALPPTKPSFPSSIQELTDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIYYIKNGIPN  127 (141)
T ss_dssp             HHHHSCHHHHHHHHHHTTC--CCSCSSCCCCCSSGGGCCHHHHHHHHHHHHHHTTEEEEEEEEECTTTCCEEEEETTEES
T ss_pred             HHhhcCHHHHHHHHHHhCC--ccCCCcCCcccccccccCchHHHHHHHHHHHHhheeccCCEEECCCCCCcccccCCccC
Confidence            6899999999999999999  66999999875     55776  999999999999999999999999999999999999


Q ss_pred             cCCCCcCC
Q psy15340         74 MLLKEDEI   81 (81)
Q Consensus        74 ml~~e~ev   81 (81)
                      ||+++++|
T Consensus       128 mL~~ear~  135 (141)
T 2j6a_A          128 LLLPPHLV  135 (141)
T ss_dssp             SCCCSSCC
T ss_pred             cCCcHHHh
Confidence            99999986


No 2  
>3q87_A Putative uncharacterized protein ECU08_1170; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi}
Probab=99.97  E-value=1.2e-33  Score=190.69  Aligned_cols=75  Identities=21%  Similarity=0.328  Sum_probs=72.1

Q ss_pred             CCc---cccHHHHHHHHHHhCCCCCCCCCCccCcccccHHHHHHhhhhceeeeeccceeEeCCCCccccccCCccccCCC
Q psy15340          1 MIP---KLDWSAFYKATLMLGDAEISIPEKLIDSYEKDSEFLKKVHHALLEVEVVEGDLECPESGRKFPISSGIPNMLLK   77 (81)
Q Consensus         1 ml~---kldw~al~~aa~~lg~~~~~lP~~~~~~~~~~e~~l~~lh~~ll~~~v~eg~L~C~~c~~~ypI~dGIP~ml~~   77 (81)
                      |||   |+||+||++||++||.  .+||+++|+++++|++|||++||+|++++|++|+|+||+|||.|||++|||||+..
T Consensus        44 mlp~~~kldW~aL~~aA~~lg~--~~LP~~~p~~~~~deefLr~lHh~Lle~~V~EG~L~Cp~cgr~ypI~~GIPNm~~~  121 (125)
T 3q87_A           44 MFTENGGERLKSLVNSLRDFHG--RELSEQDISSFVENPGDDEKIKEFLFGIDVVEGSLRCDMCGLIYPIKGSIVETVDT  121 (125)
T ss_dssp             HHHHHHHHHHHHHHHHTTTCCS--SCCCHHHHHHHHHCTTCCHHHHHHHHSEEEEEEEEEETTTCCEEEEETTEEECSSC
T ss_pred             HcCCccccCHHHHHHHHHHhCC--ccCCCCCCCcccCCHHHHHHHHHHHHheEEEEEEEECCCCCCEeeccCCcccHHHh
Confidence            678   9999999999999998  77999999999999999999999999999999999999999999999999999964


No 3  
>2jny_A Uncharacterized BCR; structure, CGR1, NESG, structural genomics, PSI-2, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: b.171.1.1
Probab=99.45  E-value=1.9e-14  Score=87.71  Aligned_cols=34  Identities=26%  Similarity=0.302  Sum_probs=30.6

Q ss_pred             eeeeeccceeEeCCCCccccccCCccccCCCCcC
Q psy15340         47 LEVEVVEGDLECPESGRKFPISSGIPNMLLKEDE   80 (81)
Q Consensus        47 l~~~v~eg~L~C~~c~~~ypI~dGIP~ml~~e~e   80 (81)
                      +.++..+|+|+|+.||++|||+||||+||+++++
T Consensus        20 L~~~~~~g~LvC~~c~~~YPI~dGIPvmL~~Ear   53 (67)
T 2jny_A           20 LRYLESEQLLVNERLNLAYRIDDGIPVLLIDEAT   53 (67)
T ss_dssp             CEEETTTTEEEETTTTEEEEEETTEECCCSSCCE
T ss_pred             CeEeCCCCEEEcCCCCccccCCCCEeeeChhHhc
Confidence            4556678999999999999999999999999875


No 4  
>2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, structure initiative, northeast structural genomics consort NESG; NMR {Neisseria meningitidis}
Probab=99.43  E-value=3.2e-14  Score=86.83  Aligned_cols=34  Identities=32%  Similarity=0.467  Sum_probs=30.6

Q ss_pred             eeeeeccceeEeCCCCccccccCCccccCCCCcC
Q psy15340         47 LEVEVVEGDLECPESGRKFPISSGIPNMLLKEDE   80 (81)
Q Consensus        47 l~~~v~eg~L~C~~c~~~ypI~dGIP~ml~~e~e   80 (81)
                      +.++..+|+|+|+.||++|||+||||+||+++++
T Consensus        18 L~~~~~~~~LiC~~cg~~YPI~dGIPvmL~~Ear   51 (68)
T 2jr6_A           18 LEYHQDKQELWSRQAKLAYPIKDGIPYMLENEAR   51 (68)
T ss_dssp             CEEETTTTEEEETTTTEEEEEETTEECCCTTTCE
T ss_pred             CeEeCCCCEEEcCCCCcEecCCCCeeeeChhhcc
Confidence            4556678999999999999999999999999875


No 5  
>2hf1_A Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A biosynthes structural genomics, PSI-2, protein structure initiative; 1.90A {Chromobacterium violaceum} SCOP: b.171.1.1
Probab=99.42  E-value=3e-14  Score=86.95  Aligned_cols=34  Identities=35%  Similarity=0.579  Sum_probs=30.5

Q ss_pred             eeeeeccceeEeCCCCccccccCCccccCCCCcC
Q psy15340         47 LEVEVVEGDLECPESGRKFPISSGIPNMLLKEDE   80 (81)
Q Consensus        47 l~~~v~eg~L~C~~c~~~ypI~dGIP~ml~~e~e   80 (81)
                      +.++..+|+|+|+.||++|||+||||+||+++++
T Consensus        18 L~~~~~~~~LiC~~cg~~YPI~dGIPvmL~~Ear   51 (68)
T 2hf1_A           18 LVFDKSKDELICKGDRLAFPIKDGIPMMLESEAR   51 (68)
T ss_dssp             CEEETTTTEEEETTTTEEEEEETTEECCCGGGCE
T ss_pred             CeEeCCCCEEEcCCCCcEecCCCCeeeeChhhcc
Confidence            4566678999999999999999999999999875


No 6  
>2js4_A UPF0434 protein BB2007; NESG, northeast structural genomics consortium, beta, PSI-2, protein structure initiative; NMR {Bordetella bronchiseptica RB50}
Probab=99.42  E-value=3.6e-14  Score=87.02  Aligned_cols=34  Identities=32%  Similarity=0.621  Sum_probs=30.5

Q ss_pred             eeeeeccceeEeCCCCccccccCCccccCCCCcC
Q psy15340         47 LEVEVVEGDLECPESGRKFPISSGIPNMLLKEDE   80 (81)
Q Consensus        47 l~~~v~eg~L~C~~c~~~ypI~dGIP~ml~~e~e   80 (81)
                      +.++..+|+|+|+.||++|||+||||+||+++++
T Consensus        18 L~~~~~~~~LiC~~cg~~YPI~dGIPvmL~~Ear   51 (70)
T 2js4_A           18 LEFQRAQAELVCNADRLAFPVRDGVPIMLEAEAR   51 (70)
T ss_dssp             EEEETTTTEEEETTTTEEEEEETTEECCCGGGSE
T ss_pred             CEEeCCCCEEEcCCCCceecCCCCeeeeChhhcc
Confidence            4566678999999999999999999999999875


No 7  
>2pk7_A Uncharacterized protein; NESG, PLR1, putative tetraacyldisaccharide-1-P 4-kinase, Q4K structural genomics, PSI-2; 2.20A {Pseudomonas fluorescens} SCOP: b.171.1.1
Probab=99.40  E-value=5.3e-14  Score=86.05  Aligned_cols=34  Identities=32%  Similarity=0.536  Sum_probs=30.1

Q ss_pred             eeeeeccceeEeCCCCccccccCCccccCCCCcC
Q psy15340         47 LEVEVVEGDLECPESGRKFPISSGIPNMLLKEDE   80 (81)
Q Consensus        47 l~~~v~eg~L~C~~c~~~ypI~dGIP~ml~~e~e   80 (81)
                      +.++..+|+|+|+.||++|||+||||+||+++++
T Consensus        18 L~~~~~~~~LiC~~cg~~YPI~dGIPvmL~~ear   51 (69)
T 2pk7_A           18 LKLSADKTELISKGAGLAYPIRDGIPVMLESEAR   51 (69)
T ss_dssp             CEECTTSSEEEETTTTEEEEEETTEECCCGGGCE
T ss_pred             CeEeCCCCEEEcCCCCcEecCcCCeeeeChhhcc
Confidence            3455678999999999999999999999999875


No 8  
>2k5r_A Uncharacterized protein XF2673; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Xylella fastidiosa TEMECULA1}
Probab=99.31  E-value=2.4e-13  Score=88.04  Aligned_cols=32  Identities=22%  Similarity=0.289  Sum_probs=28.6

Q ss_pred             eeeccceeEeCCCCccccccCCccccCCCCcC
Q psy15340         49 VEVVEGDLECPESGRKFPISSGIPNMLLKEDE   80 (81)
Q Consensus        49 ~~v~eg~L~C~~c~~~ypI~dGIP~ml~~e~e   80 (81)
                      .++.+|+|+|+.||++|||+||||+||+++++
T Consensus        47 ~e~~~~~LvC~~c~~~YPI~dGIPvmL~~ear   78 (97)
T 2k5r_A           47 NQSLHEALITRDRKQVFRIEDSIPVLLPEEAI   78 (97)
T ss_dssp             CCCCSEEEECTTSCEEEEEETTEEECCGGGEE
T ss_pred             ccccCCeEEcCCCCCCccccCCCcccChHHhc
Confidence            34568999999999999999999999999864


No 9  
>2kpi_A Uncharacterized protein SCO3027; zinc finger, PSI-2, NESG, all beta, structural genomics, protein structure initiative; NMR {Streptomyces coelicolor}
Probab=99.26  E-value=1.9e-12  Score=76.22  Aligned_cols=28  Identities=32%  Similarity=0.839  Sum_probs=26.5

Q ss_pred             cceeEeC--CCCccccccCCccccCCCCcC
Q psy15340         53 EGDLECP--ESGRKFPISSGIPNMLLKEDE   80 (81)
Q Consensus        53 eg~L~C~--~c~~~ypI~dGIP~ml~~e~e   80 (81)
                      +|+|+|+  .||++|||+||||+||+++++
T Consensus        24 ~~~L~C~~~~c~~~YPI~dGIPvlL~~ear   53 (56)
T 2kpi_A           24 DAELICTGQDCGLAYPVRDGIPVLLVDEAR   53 (56)
T ss_dssp             TTEEEECSSSCCCEEEEETTEECCCTTTCB
T ss_pred             CCEEEcCCcCCCcEEeeECCEeeeCHHHcc
Confidence            4999999  999999999999999999986


No 10 
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1
Probab=95.67  E-value=0.0064  Score=33.58  Aligned_cols=21  Identities=19%  Similarity=0.379  Sum_probs=18.1

Q ss_pred             eeeeeccceeEeCCCCccccc
Q psy15340         47 LEVEVVEGDLECPESGRKFPI   67 (81)
Q Consensus        47 l~~~v~eg~L~C~~c~~~ypI   67 (81)
                      +.++...|+|+|+.||.+|+-
T Consensus        16 l~~d~~~gelvC~~CG~v~~e   36 (50)
T 1pft_A           16 LIYDPERGEIVCAKCGYVIEE   36 (50)
T ss_dssp             EEEETTTTEEEESSSCCBCCC
T ss_pred             eEEcCCCCeEECcccCCcccc
Confidence            566778899999999999984


No 11 
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1
Probab=91.38  E-value=0.041  Score=35.04  Aligned_cols=38  Identities=26%  Similarity=0.420  Sum_probs=31.5

Q ss_pred             hhhhceeeeeccceeEeCCCCccccccCCccccCCCCc
Q psy15340         42 VHHALLEVEVVEGDLECPESGRKFPISSGIPNMLLKED   79 (81)
Q Consensus        42 lh~~ll~~~v~eg~L~C~~c~~~ypI~dGIP~ml~~e~   79 (81)
                      +=+..++++..+|...||+|+..|.=..|-|.+--+++
T Consensus        45 vCrpCyEYErkeG~q~CpqCktrYkr~kgsp~v~GDe~   82 (93)
T 1weo_A           45 ACRPCYEYERREGTQNCPQCKTRYKRLRGSPRVEGDED   82 (93)
T ss_dssp             CCHHHHHHHHHTSCSSCTTTCCCCCCCTTCCCCTTSCC
T ss_pred             hhHHHHHHHHhccCccccccCCccccccCCCCcccccc
Confidence            34677888999999999999999998889987766543


No 12 
>1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A
Probab=88.46  E-value=0.2  Score=28.67  Aligned_cols=20  Identities=35%  Similarity=0.587  Sum_probs=16.3

Q ss_pred             eeeeeccceeEeCCCCcccc
Q psy15340         47 LEVEVVEGDLECPESGRKFP   66 (81)
Q Consensus        47 l~~~v~eg~L~C~~c~~~yp   66 (81)
                      +..+...|+++|..||.++.
T Consensus        22 lv~D~~~ge~vC~~CGlVl~   41 (58)
T 1dl6_A           22 LVEDYRAGDMICPECGLVVG   41 (58)
T ss_dssp             CEECSSSCCEECTTTCCEEC
T ss_pred             eeEeCCCCeEEeCCCCCEEe
Confidence            35567889999999999873


No 13 
>2jrr_A Uncharacterized protein; solution structure, SIR90, structural genomics, PSI-2, protein structure initiative; NMR {Silicibacter pomeroyi}
Probab=84.19  E-value=0.4  Score=28.67  Aligned_cols=33  Identities=21%  Similarity=0.394  Sum_probs=23.4

Q ss_pred             hhhceeeee--ccceeEeCCCCccccccCCccccC
Q psy15340         43 HHALLEVEV--VEGDLECPESGRKFPISSGIPNML   75 (81)
Q Consensus        43 h~~ll~~~v--~eg~L~C~~c~~~ypI~dGIP~ml   75 (81)
                      -|...=+++  .+|.-.||-||+.|..+++-..-|
T Consensus        26 gHPrVyl~ld~~~g~~~CpYCg~~f~l~~~~~~~~   60 (67)
T 2jrr_A           26 GHPRVWLQIPEDTGWVECPYCDCKYVLKGSKADAL   60 (67)
T ss_dssp             EEEEEEEECCTTTSEEEETTTTEEEEETTSGGGCC
T ss_pred             CCCEEEEEccCCCCeEECCCCCCEEEECCCcchhh
Confidence            333333444  579999999999999888765443


No 14 
>2i5o_A DNA polymerase ETA; zinc finger, DNA polymerase,POL ETA, UBZ, ubiquitin-binding zinc finger, translesion synthesis, ubiquitin-binding domain; HET: DNA; NMR {Homo sapiens}
Probab=81.69  E-value=0.69  Score=24.79  Aligned_cols=15  Identities=20%  Similarity=0.587  Sum_probs=12.8

Q ss_pred             ceeEeCCCCcccccc
Q psy15340         54 GDLECPESGRKFPIS   68 (81)
Q Consensus        54 g~L~C~~c~~~ypI~   68 (81)
                      ....|++||..+|+.
T Consensus         8 ~~~~C~~C~~~i~~~   22 (39)
T 2i5o_A            8 DQVPCEKCGSLVPVW   22 (39)
T ss_dssp             CEEECTTTCCEEEGG
T ss_pred             CCcccccccCcCCcc
Confidence            457899999999985


No 15 
>3a43_A HYPD, hydrogenase nickel incorporation protein HYPA; [NIFE] hydrogenase maturation, zinc-finger, nickel binding, metal-binding; HET: FME; 2.30A {Pyrococcus kodakaraensis} PDB: 3a44_A*
Probab=80.53  E-value=1  Score=29.51  Aligned_cols=26  Identities=15%  Similarity=0.270  Sum_probs=20.4

Q ss_pred             hhceeeeeccceeEeCCCCccccccC
Q psy15340         44 HALLEVEVVEGDLECPESGRKFPISS   69 (81)
Q Consensus        44 ~~ll~~~v~eg~L~C~~c~~~ypI~d   69 (81)
                      .+-|+++...+...|..||..|.+.+
T Consensus        59 ~A~L~i~~~p~~~~C~~CG~~~~~~~   84 (139)
T 3a43_A           59 GAEIEFVEEEAVFKCRNCNYEWKLKE   84 (139)
T ss_dssp             TCEEEEEEECCEEEETTTCCEEEGGG
T ss_pred             CCEEEEEecCCcEECCCCCCEEeccc
Confidence            34455666777999999999999866


No 16 
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus}
Probab=80.00  E-value=1.3  Score=27.98  Aligned_cols=46  Identities=22%  Similarity=0.435  Sum_probs=31.2

Q ss_pred             cccHHHHHHHHHHhCCCCCCCCCCccCcccc-cHHHHHHhhhhceeeeeccceeEeCCCCccccc
Q psy15340          4 KLDWSAFYKATLMLGDAEISIPEKLIDSYEK-DSEFLKKVHHALLEVEVVEGDLECPESGRKFPI   67 (81)
Q Consensus         4 kldw~al~~aa~~lg~~~~~lP~~~~~~~~~-~e~~l~~lh~~ll~~~v~eg~L~C~~c~~~ypI   67 (81)
                      .+||..|.+..         |+-..-++... -+.||+++-..         .+-||.||-.|-=
T Consensus        17 ~L~W~eLIeQM---------L~~en~~ei~kDr~~Fl~~~e~F---------~FkCP~CgEEFyG   63 (95)
T 2k5c_A           17 PLKWEELIEEM---------LIIENFEEIVKDRERFLAQVEEF---------VFKCPVCGEEFYG   63 (95)
T ss_dssp             EECHHHHHHHS---------TTCSTHHHHTTCHHHHHHHHHHS---------EEECTTTCCEEET
T ss_pred             ccCHHHHHHHH---------HhhccHHHHHhhHHHHHHHHHHH---------hhcCCCccHHHhc
Confidence            58999999843         23333334333 56799998766         4579999998853


No 17 
>2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori}
Probab=79.07  E-value=1.3  Score=27.99  Aligned_cols=25  Identities=24%  Similarity=0.472  Sum_probs=19.5

Q ss_pred             hceeeeeccceeEeCCCCccccccC
Q psy15340         45 ALLEVEVVEGDLECPESGRKFPISS   69 (81)
Q Consensus        45 ~ll~~~v~eg~L~C~~c~~~ypI~d   69 (81)
                      +-|++....+...|..||+.|.+.+
T Consensus        63 a~L~i~~~p~~~~C~~CG~~~e~~~   87 (119)
T 2kdx_A           63 AILDIVDEKVELECKDCSHVFKPNA   87 (119)
T ss_dssp             CCEEEEEECCEEECSSSSCEECSCC
T ss_pred             cEEEEEeccceEEcCCCCCEEeCCC
Confidence            3344566778999999999999854


No 18 
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens}
Probab=77.73  E-value=0.95  Score=19.57  Aligned_cols=13  Identities=38%  Similarity=0.925  Sum_probs=10.6

Q ss_pred             eeEeCCCCccccc
Q psy15340         55 DLECPESGRKFPI   67 (81)
Q Consensus        55 ~L~C~~c~~~ypI   67 (81)
                      ...|+.|++.|.-
T Consensus         2 ~~~C~~C~k~f~~   14 (29)
T 2m0f_A            2 PLKCRECGKQFTT   14 (29)
T ss_dssp             CEECTTTSCEESC
T ss_pred             CccCCCCCCccCC
Confidence            4689999999864


No 19 
>2jz8_A Uncharacterized protein BH09830; zinc binding, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Bartonella henselae str}
Probab=77.27  E-value=0.91  Score=28.44  Aligned_cols=23  Identities=9%  Similarity=0.232  Sum_probs=19.6

Q ss_pred             ccceeEeCCCCccccccCCcccc
Q psy15340         52 VEGDLECPESGRKFPISSGIPNM   74 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~dGIP~m   74 (81)
                      .+|+-.||-||+.|..+++.+-.
T Consensus        45 ~~g~~~CpYCg~~y~~~~~~~~~   67 (87)
T 2jz8_A           45 STDEKICPYCSTLYRYDPSLSYN   67 (87)
T ss_dssp             TCCEECCTTTCCEEECCTTSCTT
T ss_pred             CCCeEECCCCCCEeEcCCCCCcC
Confidence            46999999999999999887643


No 20 
>2jvm_A Uncharacterized protein; alpha+beta, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Rhodobacter sphaeroides 2}
Probab=75.51  E-value=0.6  Score=28.84  Aligned_cols=31  Identities=19%  Similarity=0.264  Sum_probs=22.6

Q ss_pred             hhhhceeeee--ccceeEeCCCCccccccCCcc
Q psy15340         42 VHHALLEVEV--VEGDLECPESGRKFPISSGIP   72 (81)
Q Consensus        42 lh~~ll~~~v--~eg~L~C~~c~~~ypI~dGIP   72 (81)
                      +-|...=+++  .+|.-.||-||..|..+++..
T Consensus        38 LGHPrVyL~ld~~~g~~~CpYCg~~f~l~~~~~   70 (80)
T 2jvm_A           38 LGHPRVWLSIPHETGFVECGYCDRRYIHESFAA   70 (80)
T ss_dssp             CCCCCEEEECCTTTCEEECSSSSCEEEEHHHHS
T ss_pred             CCCCEEEEEccCCCCeEECCCCCCEEEecCCcc
Confidence            3444444555  579999999999998876643


No 21 
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=74.47  E-value=0.7  Score=26.17  Aligned_cols=16  Identities=25%  Similarity=0.694  Sum_probs=13.8

Q ss_pred             ceeEeCCCCccccccC
Q psy15340         54 GDLECPESGRKFPISS   69 (81)
Q Consensus        54 g~L~C~~c~~~ypI~d   69 (81)
                      +.-.||.|++.|...+
T Consensus        11 ~~~~CPrCn~~f~~~~   26 (49)
T 2e72_A           11 GRKICPRCNAQFRVTE   26 (49)
T ss_dssp             SCCCCTTTCCCCSSHH
T ss_pred             CceeCCcccccccchH
Confidence            6889999999998754


No 22 
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens}
Probab=74.42  E-value=1.4  Score=19.04  Aligned_cols=14  Identities=29%  Similarity=0.586  Sum_probs=11.2

Q ss_pred             eeEeCCCCcccccc
Q psy15340         55 DLECPESGRKFPIS   68 (81)
Q Consensus        55 ~L~C~~c~~~ypI~   68 (81)
                      ...|+.|++.|.-.
T Consensus         3 ~~~C~~C~~~f~~~   16 (30)
T 2m0d_A            3 PYQCDYCGRSFSDP   16 (30)
T ss_dssp             CEECTTTCCEESCH
T ss_pred             CccCCCCCcccCCH
Confidence            46899999999743


No 23 
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus}
Probab=73.03  E-value=1.6  Score=18.88  Aligned_cols=14  Identities=7%  Similarity=0.074  Sum_probs=11.1

Q ss_pred             eeEeCCCCcccccc
Q psy15340         55 DLECPESGRKFPIS   68 (81)
Q Consensus        55 ~L~C~~c~~~ypI~   68 (81)
                      ...|+.||+.|.-+
T Consensus         3 ~~~C~~C~k~f~~~   16 (27)
T 2kvh_A            3 PFSCSLCPQRSRDF   16 (27)
T ss_dssp             CEECSSSSCEESSH
T ss_pred             CccCCCcChhhCCH
Confidence            46899999999643


No 24 
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A
Probab=70.19  E-value=1.8  Score=18.72  Aligned_cols=14  Identities=36%  Similarity=0.797  Sum_probs=11.1

Q ss_pred             eEeCCCCccccccC
Q psy15340         56 LECPESGRKFPISS   69 (81)
Q Consensus        56 L~C~~c~~~ypI~d   69 (81)
                      ..|+.|++.|.-+.
T Consensus         3 ~~C~~C~k~f~~~~   16 (29)
T 1rik_A            3 FACPECPKRFMRSD   16 (29)
T ss_dssp             EECSSSSCEESCSH
T ss_pred             ccCCCCCchhCCHH
Confidence            57999999997543


No 25 
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1
Probab=69.65  E-value=1.6  Score=18.60  Aligned_cols=13  Identities=23%  Similarity=0.386  Sum_probs=10.3

Q ss_pred             eEeCCCCcccccc
Q psy15340         56 LECPESGRKFPIS   68 (81)
Q Consensus        56 L~C~~c~~~ypI~   68 (81)
                      ..|+.|++.|.-+
T Consensus         2 ~~C~~C~k~f~~~   14 (27)
T 1znf_A            2 YKCGLCERSFVEK   14 (27)
T ss_dssp             CBCSSSCCBCSSH
T ss_pred             ccCCCCCCcCCCH
Confidence            3699999999754


No 26 
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3
Probab=68.98  E-value=0.4  Score=27.24  Aligned_cols=28  Identities=18%  Similarity=0.325  Sum_probs=19.2

Q ss_pred             Hhhhhceeeeec-cceeEeCCCCcccccc
Q psy15340         41 KVHHALLEVEVV-EGDLECPESGRKFPIS   68 (81)
Q Consensus        41 ~lh~~ll~~~v~-eg~L~C~~c~~~ypI~   68 (81)
                      .+|...+..=+. .+...||.|+..|+++
T Consensus        32 ~~H~~Cl~~W~~~~~~~~C~~C~~~~~~r   60 (60)
T 1vyx_A           32 NVHRSCLSTWLTISRNTACQICGVVYNTR   60 (60)
T ss_dssp             SCCHHHHHHHHHHHTCSBCTTTCCBCCCC
T ss_pred             hhHHHHHHHHHHhCCCCccCCCCCeeecC
Confidence            455554443333 4678999999999985


No 27 
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A
Probab=68.88  E-value=1.6  Score=18.86  Aligned_cols=13  Identities=23%  Similarity=0.452  Sum_probs=10.4

Q ss_pred             eEeCCCCcccccc
Q psy15340         56 LECPESGRKFPIS   68 (81)
Q Consensus        56 L~C~~c~~~ypI~   68 (81)
                      ..|+.|++.|.-.
T Consensus         3 ~~C~~C~~~f~~~   15 (29)
T 1ard_A            3 FVCEVCTRAFARQ   15 (29)
T ss_dssp             CBCTTTCCBCSSH
T ss_pred             eECCCCCcccCCH
Confidence            5799999998643


No 28 
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens}
Probab=68.86  E-value=1.6  Score=18.65  Aligned_cols=14  Identities=29%  Similarity=0.679  Sum_probs=10.8

Q ss_pred             eEeCCCCccccccC
Q psy15340         56 LECPESGRKFPISS   69 (81)
Q Consensus        56 L~C~~c~~~ypI~d   69 (81)
                      ..|+.|++.|.-..
T Consensus         3 ~~C~~C~~~f~~~~   16 (29)
T 2m0e_A            3 HKCPHCDKKFNQVG   16 (29)
T ss_dssp             CCCSSCCCCCCTTT
T ss_pred             CcCCCCCcccCCHH
Confidence            46999999997543


No 29 
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus}
Probab=67.85  E-value=2.3  Score=18.31  Aligned_cols=14  Identities=21%  Similarity=0.759  Sum_probs=11.1

Q ss_pred             eeEeCCCCcccccc
Q psy15340         55 DLECPESGRKFPIS   68 (81)
Q Consensus        55 ~L~C~~c~~~ypI~   68 (81)
                      ...|+.|++.|.-+
T Consensus         3 ~~~C~~C~k~f~~~   16 (28)
T 2kvf_A            3 PYSCSVCGKRFSLK   16 (28)
T ss_dssp             SEECSSSCCEESCH
T ss_pred             CccCCCCCcccCCH
Confidence            36799999999754


No 30 
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus}
Probab=67.76  E-value=2  Score=18.68  Aligned_cols=14  Identities=21%  Similarity=0.389  Sum_probs=11.1

Q ss_pred             eeEeCCCCcccccc
Q psy15340         55 DLECPESGRKFPIS   68 (81)
Q Consensus        55 ~L~C~~c~~~ypI~   68 (81)
                      ...|+.||+.|.-+
T Consensus         3 ~~~C~~C~k~f~~~   16 (27)
T 2kvg_A            3 PYRCPLCRAGCPSL   16 (27)
T ss_dssp             TEEETTTTEEESCH
T ss_pred             CcCCCCCCcccCCH
Confidence            36799999999754


No 31 
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens}
Probab=70.35  E-value=1.2  Score=19.18  Aligned_cols=15  Identities=33%  Similarity=0.629  Sum_probs=11.7

Q ss_pred             eEeCCCCccccccCC
Q psy15340         56 LECPESGRKFPISSG   70 (81)
Q Consensus        56 L~C~~c~~~ypI~dG   70 (81)
                      ..|+.||+.|.-+..
T Consensus         3 ~~C~~C~k~f~~~~~   17 (26)
T 2lvu_A            3 YVCERCGKRFVQSSQ   17 (26)
Confidence            469999999976544


No 32 
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1
Probab=66.25  E-value=2.1  Score=18.65  Aligned_cols=14  Identities=21%  Similarity=0.403  Sum_probs=11.0

Q ss_pred             eEeCCCCccccccC
Q psy15340         56 LECPESGRKFPISS   69 (81)
Q Consensus        56 L~C~~c~~~ypI~d   69 (81)
                      ..|+.|++.|.-+.
T Consensus         3 ~~C~~C~k~f~~~~   16 (30)
T 1paa_A            3 YACGLCNRAFTRRD   16 (30)
T ss_dssp             SBCTTTCCBCSSSH
T ss_pred             cCCcccCcccCChH
Confidence            46999999997544


No 33 
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}
Probab=65.75  E-value=2.5  Score=19.20  Aligned_cols=15  Identities=27%  Similarity=0.330  Sum_probs=11.8

Q ss_pred             ceeEeCCCCcccccc
Q psy15340         54 GDLECPESGRKFPIS   68 (81)
Q Consensus        54 g~L~C~~c~~~ypI~   68 (81)
                      ....|+.|++.|.-+
T Consensus         6 k~~~C~~C~k~f~~~   20 (35)
T 2elx_A            6 SGYVCALCLKKFVSS   20 (35)
T ss_dssp             CSEECSSSCCEESSH
T ss_pred             CCeECCCCcchhCCH
Confidence            457899999999643


No 34 
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A
Probab=64.58  E-value=2.1  Score=18.41  Aligned_cols=13  Identities=15%  Similarity=0.130  Sum_probs=10.3

Q ss_pred             eEeCCCCcccccc
Q psy15340         56 LECPESGRKFPIS   68 (81)
Q Consensus        56 L~C~~c~~~ypI~   68 (81)
                      ..|+.|++.|.-.
T Consensus         3 ~~C~~C~k~f~~~   15 (30)
T 1klr_A            3 YQCQYCEFRSADS   15 (30)
T ss_dssp             CCCSSSSCCCSCS
T ss_pred             ccCCCCCCccCCH
Confidence            4699999999644


No 35 
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ...
Probab=64.31  E-value=3.4  Score=24.51  Aligned_cols=19  Identities=21%  Similarity=0.263  Sum_probs=12.1

Q ss_pred             ceeEeCCCCccccccCCcc
Q psy15340         54 GDLECPESGRKFPISSGIP   72 (81)
Q Consensus        54 g~L~C~~c~~~ypI~dGIP   72 (81)
                      -+-+|+.||+.|.+.++-+
T Consensus        27 v~Y~C~~CG~~~e~~~~d~   45 (70)
T 1twf_L           27 LKYICAECSSKLSLSRTDA   45 (70)
T ss_dssp             CCEECSSSCCEECCCTTST
T ss_pred             EEEECCCCCCcceeCCCCC
Confidence            3457777777777765533


No 36 
>2odx_A Cytochrome C oxidase polypeptide IV; all beta-protein, metallo-protein, oxidoreductase; NMR {Saccharomyces cerevisiae}
Probab=63.86  E-value=3.5  Score=25.08  Aligned_cols=23  Identities=13%  Similarity=0.421  Sum_probs=16.7

Q ss_pred             ceeeeecccee-EeCCCCcccccc
Q psy15340         46 LLEVEVVEGDL-ECPESGRKFPIS   68 (81)
Q Consensus        46 ll~~~v~eg~L-~C~~c~~~ypI~   68 (81)
                      +.=+-+.+|.. +|++||..|...
T Consensus        46 v~W~~l~~g~~~RC~eCG~~fkL~   69 (80)
T 2odx_A           46 IMWLKPTVNEVARCWECGSVYKLN   69 (80)
T ss_dssp             CEEECCCTTCEEECSSSCCEEEEC
T ss_pred             EEEEEecCCCCeECCCCCeEEEEE
Confidence            33445566665 999999999865


No 37 
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=62.95  E-value=2.6  Score=19.52  Aligned_cols=16  Identities=19%  Similarity=0.488  Sum_probs=12.5

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus         7 ~k~~~C~~C~k~f~~~   22 (37)
T 2elo_A            7 GRSYSCPVCEKSFSED   22 (37)
T ss_dssp             CCCCEETTTTEECSSH
T ss_pred             CCCcCCCCCCCccCCH
Confidence            4457899999999754


No 38 
>1v54_F VI, cytochrome C oxidase polypeptide VB; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: g.41.5.3 PDB: 1oco_F* 1occ_F* 1ocz_F* 1ocr_F* 1v55_F* 2dyr_F* 2dys_F* 2eij_F* 2eik_F* 2eil_F* 2eim_F* 2ein_F* 2occ_F* 2ybb_Q* 2zxw_F* 3abk_F* 3abl_F* 3abm_F* 3ag1_F* 3ag2_F* ...
Probab=62.63  E-value=3.5  Score=25.96  Aligned_cols=23  Identities=17%  Similarity=0.556  Sum_probs=16.1

Q ss_pred             ceeeeecccee-EeCCCCcccccc
Q psy15340         46 LLEVEVVEGDL-ECPESGRKFPIS   68 (81)
Q Consensus        46 ll~~~v~eg~L-~C~~c~~~ypI~   68 (81)
                      ++=+-+.+|.. +|++||..|...
T Consensus        69 v~W~~l~~g~~~RC~eCG~~fkL~   92 (98)
T 1v54_F           69 VIWFWLHKGEAQRCPSCGTHYKLV   92 (98)
T ss_dssp             CEEEEEESSSCEECTTTCCEEEEE
T ss_pred             eEEEEEeCCCceECCCCCeEEEEe
Confidence            33444556655 999999999754


No 39 
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens}
Probab=66.37  E-value=1.6  Score=19.06  Aligned_cols=15  Identities=27%  Similarity=0.574  Sum_probs=11.6

Q ss_pred             eEeCCCCccccccCC
Q psy15340         56 LECPESGRKFPISSG   70 (81)
Q Consensus        56 L~C~~c~~~ypI~dG   70 (81)
                      ..|+.|++.|.-...
T Consensus         3 ~~C~~C~k~f~~~~~   17 (29)
T 2lvt_A            3 CQCVMCGKAFTQASS   17 (29)
Confidence            579999999976543


No 40 
>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae}
Probab=62.27  E-value=4.6  Score=28.58  Aligned_cols=19  Identities=26%  Similarity=0.476  Sum_probs=15.2

Q ss_pred             eeeeeccceeEeCCCCccc
Q psy15340         47 LEVEVVEGDLECPESGRKF   65 (81)
Q Consensus        47 l~~~v~eg~L~C~~c~~~y   65 (81)
                      +..|...|+++|.+||...
T Consensus        34 IV~D~erGE~VCsdCGLVL   52 (197)
T 3k1f_M           34 IVERFSEGDVVCALCGLVL   52 (197)
T ss_dssp             EEEEGGGTEEEETTTCBBC
T ss_pred             EEEeCCCCEEEEcCCCCCc
Confidence            3456679999999999874


No 41 
>2akl_A PHNA-like protein PA0128; two domains, Zn binding protein, beta-strand protein, structural genomics, PSI; NMR {Pseudomonas aeruginosa PAO1} SCOP: b.34.11.2 g.41.3.5
Probab=61.93  E-value=2.8  Score=28.21  Aligned_cols=14  Identities=29%  Similarity=0.641  Sum_probs=12.1

Q ss_pred             cceeEeCCCCcccc
Q psy15340         53 EGDLECPESGRKFP   66 (81)
Q Consensus        53 eg~L~C~~c~~~yp   66 (81)
                      ...++||+|++.|.
T Consensus        42 g~l~vCPeC~hEW~   55 (138)
T 2akl_A           42 GALLVCPECAHEWS   55 (138)
T ss_dssp             SSSEEETTTTEEEC
T ss_pred             CCeEECCccccccC
Confidence            45799999999994


No 42 
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1
Probab=61.45  E-value=3.6  Score=18.70  Aligned_cols=16  Identities=13%  Similarity=0.193  Sum_probs=12.3

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus         5 ~k~~~C~~C~k~f~~~   20 (35)
T 1srk_A            5 KRPFVCRICLSAFTTK   20 (35)
T ss_dssp             CSCEECSSSCCEESSH
T ss_pred             CcCeeCCCCCcccCCH
Confidence            3457899999999644


No 43 
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=61.42  E-value=3.4  Score=19.43  Aligned_cols=16  Identities=6%  Similarity=-0.085  Sum_probs=12.5

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus         7 ~k~~~C~~C~k~f~~~   22 (37)
T 2elm_A            7 GHLYYCSQCHYSSITK   22 (37)
T ss_dssp             SCEEECSSSSCEEECH
T ss_pred             CcCeECCCCCcccCCH
Confidence            4458899999999643


No 44 
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=60.91  E-value=3.6  Score=19.04  Aligned_cols=16  Identities=19%  Similarity=0.347  Sum_probs=12.5

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus         7 ~k~~~C~~C~k~f~~~   22 (37)
T 2elp_A            7 GRAMKCPYCDFYFMKN   22 (37)
T ss_dssp             CCCEECSSSSCEECSS
T ss_pred             CCCeECCCCChhhccC
Confidence            3457999999999643


No 45 
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=60.74  E-value=3.8  Score=18.80  Aligned_cols=15  Identities=13%  Similarity=0.319  Sum_probs=11.9

Q ss_pred             ceeEeCCCCcccccc
Q psy15340         54 GDLECPESGRKFPIS   68 (81)
Q Consensus        54 g~L~C~~c~~~ypI~   68 (81)
                      ....|+.|++.|.-.
T Consensus         8 k~~~C~~C~k~f~~~   22 (36)
T 2els_A            8 KIFTCEYCNKVFKFK   22 (36)
T ss_dssp             CCEECTTTCCEESSH
T ss_pred             CCEECCCCCceeCCH
Confidence            457899999999643


No 46 
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=60.22  E-value=3.7  Score=18.74  Aligned_cols=16  Identities=19%  Similarity=0.403  Sum_probs=12.5

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus         7 ~k~~~C~~C~k~f~~~   22 (36)
T 2elt_A            7 GKPYKCPQCSYASAIK   22 (36)
T ss_dssp             CCSEECSSSSCEESSH
T ss_pred             CCCCCCCCCCcccCCH
Confidence            3457899999999754


No 47 
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=60.07  E-value=3.1  Score=18.99  Aligned_cols=16  Identities=25%  Similarity=0.407  Sum_probs=12.2

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus         7 ~~~~~C~~C~k~f~~~   22 (36)
T 2elr_A            7 GKTHLCDMCGKKFKSK   22 (36)
T ss_dssp             CSSCBCTTTCCBCSSH
T ss_pred             CCCeecCcCCCCcCch
Confidence            3457899999999643


No 48 
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens}
Probab=64.42  E-value=1.9  Score=18.76  Aligned_cols=16  Identities=19%  Similarity=0.351  Sum_probs=12.1

Q ss_pred             eeEeCCCCccccccCC
Q psy15340         55 DLECPESGRKFPISSG   70 (81)
Q Consensus        55 ~L~C~~c~~~ypI~dG   70 (81)
                      ...|+.|++.|.-...
T Consensus         3 ~~~C~~C~k~f~~~~~   18 (30)
T 2lvr_A            3 PYVCIHCQRQFADPGA   18 (30)
Confidence            3679999999975543


No 49 
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A
Probab=60.01  E-value=3  Score=19.29  Aligned_cols=16  Identities=31%  Similarity=0.692  Sum_probs=12.4

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus         9 ~k~~~C~~C~k~f~~~   24 (37)
T 1p7a_A            9 IKPFQCPDCDRSFSRS   24 (37)
T ss_dssp             SSSBCCTTTCCCBSSH
T ss_pred             CCCccCCCCCcccCcH
Confidence            3457899999999654


No 50 
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=58.51  E-value=4.3  Score=18.60  Aligned_cols=16  Identities=25%  Similarity=0.256  Sum_probs=12.4

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus         7 ~k~~~C~~C~k~f~~~   22 (36)
T 2elv_A            7 GLLYDCHICERKFKNE   22 (36)
T ss_dssp             CCCEECSSSCCEESSH
T ss_pred             CCCeECCCCCCccCCH
Confidence            3457899999999754


No 51 
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic}
Probab=58.29  E-value=2.8  Score=19.12  Aligned_cols=15  Identities=27%  Similarity=0.676  Sum_probs=11.3

Q ss_pred             eEeCCCCccccccCC
Q psy15340         56 LECPESGRKFPISSG   70 (81)
Q Consensus        56 L~C~~c~~~ypI~dG   70 (81)
                      ..|+.|++.|.-+..
T Consensus         3 ~~C~~C~k~f~~~~~   17 (32)
T 2kfq_A            3 FACPACPKRFMRSDA   17 (32)
T ss_dssp             SSSSSSCTTHHHHHT
T ss_pred             CCCCCCCcccCCHHH
Confidence            469999999975543


No 52 
>4bbr_M Transcription initiation factor IIB; RNA polymerase, TFIIB; 3.40A {Saccharomyces cerevisiae} PDB: 3k7a_M 4bbs_M
Probab=58.16  E-value=5.4  Score=29.49  Aligned_cols=17  Identities=29%  Similarity=0.515  Sum_probs=13.8

Q ss_pred             eeeccceeEeCCCCccc
Q psy15340         49 VEVVEGDLECPESGRKF   65 (81)
Q Consensus        49 ~~v~eg~L~C~~c~~~y   65 (81)
                      .|..+|+++|..||...
T Consensus        36 ~D~~~G~~vC~~CGlVl   52 (345)
T 4bbr_M           36 ERFSEGDVVCALCGLVL   52 (345)
T ss_dssp             EEGGGTEEEETTTCBEE
T ss_pred             EECCCCcEEeCCCCCCc
Confidence            35578999999999763


No 53 
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A
Probab=57.68  E-value=4.3  Score=19.10  Aligned_cols=15  Identities=20%  Similarity=0.395  Sum_probs=11.9

Q ss_pred             ceeEeCCCCcccccc
Q psy15340         54 GDLECPESGRKFPIS   68 (81)
Q Consensus        54 g~L~C~~c~~~ypI~   68 (81)
                      ....|+.|++.|.-+
T Consensus         5 k~~~C~~C~k~f~~~   19 (39)
T 1njq_A            5 RSYTCSFCKREFRSA   19 (39)
T ss_dssp             SSEECTTTCCEESSH
T ss_pred             CceECCCCCcccCCH
Confidence            457899999999643


No 54 
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=57.29  E-value=4.4  Score=18.58  Aligned_cols=16  Identities=6%  Similarity=0.044  Sum_probs=12.2

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-.
T Consensus         7 ~k~~~C~~C~k~f~~~   22 (36)
T 2elq_A            7 GKPFKCSLCEYATRSK   22 (36)
T ss_dssp             CCSEECSSSSCEESCH
T ss_pred             CCCccCCCCCchhCCH
Confidence            3457899999998643


No 55 
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1
Probab=56.07  E-value=6.6  Score=20.50  Aligned_cols=13  Identities=15%  Similarity=0.429  Sum_probs=6.8

Q ss_pred             ceeEeCCCCcccc
Q psy15340         54 GDLECPESGRKFP   66 (81)
Q Consensus        54 g~L~C~~c~~~yp   66 (81)
                      ....|+.|++.|.
T Consensus         9 k~~~C~~C~k~f~   21 (66)
T 2drp_A            9 HTYRCKVCSRVYT   21 (66)
T ss_dssp             TEEECTTTCCEES
T ss_pred             cceECCCCcchhC
Confidence            3455555555554


No 56 
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1
Probab=55.21  E-value=3.9  Score=18.79  Aligned_cols=13  Identities=38%  Similarity=0.846  Sum_probs=10.2

Q ss_pred             eEeCCCCcccccc
Q psy15340         56 LECPESGRKFPIS   68 (81)
Q Consensus        56 L~C~~c~~~ypI~   68 (81)
                      ..|+.|++.|.-.
T Consensus         3 ~~C~~C~k~F~~~   15 (33)
T 1rim_A            3 FACPECPKRFMRS   15 (33)
T ss_dssp             CCCSSSCCCCSSH
T ss_pred             ccCCCCCchhCCH
Confidence            4699999998643


No 57 
>2y69_F Cytochrome C oxidase subunit 5B; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus}
Probab=54.81  E-value=4.8  Score=26.62  Aligned_cols=22  Identities=18%  Similarity=0.554  Sum_probs=15.6

Q ss_pred             eeeeecccee-EeCCCCcccccc
Q psy15340         47 LEVEVVEGDL-ECPESGRKFPIS   68 (81)
Q Consensus        47 l~~~v~eg~L-~C~~c~~~ypI~   68 (81)
                      +=+-+.+|.. .||+||..|...
T Consensus       101 ~Wf~L~kg~p~RCpeCG~~fkL~  123 (129)
T 2y69_F          101 IWFWLHKGEAQRCPSCGTHYKLV  123 (129)
T ss_dssp             EEEEEESSSCEECTTTCCEEEEE
T ss_pred             EEEEEeCCCceeCCCCCeEEEEe
Confidence            3344556654 999999999764


No 58 
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens}
Probab=54.65  E-value=4.5  Score=20.93  Aligned_cols=13  Identities=31%  Similarity=0.772  Sum_probs=10.1

Q ss_pred             cceeEeCCCCcccc
Q psy15340         53 EGDLECPESGRKFP   66 (81)
Q Consensus        53 eg~L~C~~c~~~yp   66 (81)
                      +| ++||.|.+.+.
T Consensus         4 EG-FiCP~C~~~l~   16 (34)
T 3mjh_B            4 EG-FICPQCMKSLG   16 (34)
T ss_dssp             EE-EECTTTCCEES
T ss_pred             cc-cCCcHHHHHcC
Confidence            45 89999987663


No 59 
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=54.64  E-value=5.3  Score=19.39  Aligned_cols=17  Identities=35%  Similarity=0.550  Sum_probs=13.0

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-+
T Consensus         9 ~~k~~~C~~C~k~F~~~   25 (44)
T 2epv_A            9 GEKPYECNECGKAFIWK   25 (44)
T ss_dssp             CCCSEECSSSCCEESSH
T ss_pred             CCcCeECCCCCcccCch
Confidence            34568999999999643


No 60 
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ...
Probab=54.48  E-value=8.2  Score=23.45  Aligned_cols=18  Identities=22%  Similarity=0.230  Sum_probs=13.9

Q ss_pred             eeeeccceeEeCCCCccc
Q psy15340         48 EVEVVEGDLECPESGRKF   65 (81)
Q Consensus        48 ~~~v~eg~L~C~~c~~~y   65 (81)
                      ...+-.|.+.|+.|+..|
T Consensus        38 v~r~atGiW~C~~Cg~~~   55 (83)
T 1vq8_Z           38 VDRQGTGIWQCSYCDYKF   55 (83)
T ss_dssp             EEEEETTEEEETTTCCEE
T ss_pred             eeccCCCeEECCCCCCEe
Confidence            345667889999999875


No 61 
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=54.41  E-value=7.1  Score=21.74  Aligned_cols=25  Identities=20%  Similarity=0.375  Sum_probs=19.8

Q ss_pred             ceeEeCCCCccccccCCccccCCCC
Q psy15340         54 GDLECPESGRKFPISSGIPNMLLKE   78 (81)
Q Consensus        54 g~L~C~~c~~~ypI~dGIP~ml~~e   78 (81)
                      +...||.|+..+...+=.||....+
T Consensus        58 ~~~~CP~Cr~~~~~~~~~~n~~l~~   82 (85)
T 2ecv_A           58 GESSCPVCRISYQPENIRPNRHVAN   82 (85)
T ss_dssp             SCCCCTTTCCSSCSSSCCCSCCCCC
T ss_pred             CCCcCCCCCCccCHHhcCccHHHHH
Confidence            5789999999999877777766543


No 62 
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A
Probab=54.38  E-value=4.6  Score=19.19  Aligned_cols=16  Identities=38%  Similarity=0.733  Sum_probs=12.7

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus         8 ~k~~~C~~C~k~f~~~   23 (42)
T 2el5_A            8 ENPYECSECGKAFNRK   23 (42)
T ss_dssp             CCSEECSSSCCEESSH
T ss_pred             CCCccCCCcChhhCCH
Confidence            4568999999999754


No 63 
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=54.32  E-value=5.1  Score=19.30  Aligned_cols=17  Identities=18%  Similarity=0.452  Sum_probs=13.1

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-+
T Consensus         9 ~~k~~~C~~C~k~f~~~   25 (44)
T 2emb_A            9 TRKRYECSKCQATFNLR   25 (44)
T ss_dssp             CCSSEECTTTCCEESCH
T ss_pred             CCCCeECCCCCCccCCH
Confidence            34568999999999754


No 64 
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=53.90  E-value=5.1  Score=19.30  Aligned_cols=18  Identities=22%  Similarity=0.388  Sum_probs=13.7

Q ss_pred             ccceeEeCCCCccccccC
Q psy15340         52 VEGDLECPESGRKFPISS   69 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~d   69 (81)
                      .+....|+.|++.|.-..
T Consensus         9 ~~~~~~C~~C~k~F~~~~   26 (44)
T 2eox_A            9 DSKSYNCNECGKAFTRIF   26 (44)
T ss_dssp             CCCCEEETTTTEEESSSH
T ss_pred             CCCCeECcccCcccCCHH
Confidence            345689999999997543


No 65 
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A
Probab=53.45  E-value=5.6  Score=18.79  Aligned_cols=17  Identities=24%  Similarity=0.429  Sum_probs=13.1

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-+
T Consensus         8 ~~~~~~C~~C~k~f~~~   24 (42)
T 2epc_A            8 GETPYLCGQCGKSFTQR   24 (42)
T ss_dssp             SSCCEECSSSCCEESSH
T ss_pred             CCCCeECCCCCcccCCH
Confidence            34568999999999643


No 66 
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens}
Probab=53.18  E-value=5.2  Score=20.19  Aligned_cols=15  Identities=13%  Similarity=0.443  Sum_probs=11.9

Q ss_pred             ceeEeCCCCcccccc
Q psy15340         54 GDLECPESGRKFPIS   68 (81)
Q Consensus        54 g~L~C~~c~~~ypI~   68 (81)
                      ....|..|++.|.-+
T Consensus         6 kp~~C~~C~k~F~~~   20 (48)
T 3iuf_A            6 KPYACDICGKRYKNR   20 (48)
T ss_dssp             SCEECTTTCCEESSH
T ss_pred             cCEECCCcCcccCCH
Confidence            457899999999643


No 67 
>1mzb_A Ferric uptake regulation protein; ferric uptake regulator, iron, DTXR, gene regulation; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.42
Probab=53.14  E-value=5.3  Score=25.19  Aligned_cols=15  Identities=13%  Similarity=0.470  Sum_probs=13.2

Q ss_pred             eeEeCCCCccccccC
Q psy15340         55 DLECPESGRKFPISS   69 (81)
Q Consensus        55 ~L~C~~c~~~ypI~d   69 (81)
                      -|+|..||+.+.|.+
T Consensus        91 HliC~~Cg~v~~~~~  105 (136)
T 1mzb_A           91 HMVCVDTGEVIEFMD  105 (136)
T ss_dssp             EEEETTTCCEEEECC
T ss_pred             EEEECCCCCEEEecc
Confidence            589999999999864


No 68 
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=53.13  E-value=5.6  Score=19.29  Aligned_cols=17  Identities=29%  Similarity=0.434  Sum_probs=13.1

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-+
T Consensus         9 ~~k~~~C~~C~k~f~~~   25 (46)
T 2yts_A            9 GEKPYICNECGKSFIQK   25 (46)
T ss_dssp             SCCSEECSSSCCEESSH
T ss_pred             CCcCEECCCCChhhCCh
Confidence            34568999999999643


No 69 
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens}
Probab=52.94  E-value=5.4  Score=24.78  Aligned_cols=18  Identities=28%  Similarity=0.545  Sum_probs=15.2

Q ss_pred             eeccceeEeCCCCccccc
Q psy15340         50 EVVEGDLECPESGRKFPI   67 (81)
Q Consensus        50 ~v~eg~L~C~~c~~~ypI   67 (81)
                      .|....++|-+||+.|..
T Consensus        16 si~~d~iiClecGK~fK~   33 (87)
T 2jsp_A           16 SVQDDHIVCLECGGSFKS   33 (87)
T ss_dssp             TBCSSCEECTBTCCEESB
T ss_pred             ccCCCceEecccchhhHH
Confidence            457789999999999974


No 70 
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=52.89  E-value=5.6  Score=19.33  Aligned_cols=17  Identities=35%  Similarity=0.597  Sum_probs=13.0

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-+
T Consensus         9 ~~~~~~C~~C~k~F~~~   25 (46)
T 2emi_A            9 GERHYECSECGKAFIQK   25 (46)
T ss_dssp             SCCCEECSSSCCEESSH
T ss_pred             CCCCCCCCCCCcccCCH
Confidence            34568999999999643


No 71 
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus}
Probab=52.39  E-value=7.3  Score=21.69  Aligned_cols=24  Identities=25%  Similarity=0.549  Sum_probs=19.2

Q ss_pred             ceeEeCCCCccccccCCccccCCC
Q psy15340         54 GDLECPESGRKFPISSGIPNMLLK   77 (81)
Q Consensus        54 g~L~C~~c~~~ypI~dGIP~ml~~   77 (81)
                      +...||.|+..+...+=.||...+
T Consensus        58 ~~~~CP~Cr~~~~~~~~~~n~~l~   81 (85)
T 2ecw_A           58 GKGNCPVCRVPYPFGNLKPNLHVA   81 (85)
T ss_dssp             SCBCCTTTCCCCCTTCCEECSCCC
T ss_pred             CCCCCCCCCCcCCHHhCCcCHHHH
Confidence            478999999999887777776554


No 72 
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=52.31  E-value=6  Score=19.28  Aligned_cols=17  Identities=29%  Similarity=0.544  Sum_probs=13.2

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-+
T Consensus         9 ~~k~~~C~~C~k~f~~~   25 (46)
T 2em4_A            9 GQRPYECIECGKAFKTK   25 (46)
T ss_dssp             CSSSEECSSSCCEESSH
T ss_pred             CCcCcCCCCCCCccCCH
Confidence            34568999999999754


No 73 
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=51.76  E-value=5.6  Score=19.15  Aligned_cols=17  Identities=24%  Similarity=0.481  Sum_probs=13.3

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-+
T Consensus         9 ~~k~~~C~~C~k~f~~~   25 (44)
T 2yu5_A            9 GENPFKCSKCDRVFTQR   25 (44)
T ss_dssp             CCCSEECSSSSCEESSS
T ss_pred             CCCCeECCCCCchhCCH
Confidence            34568999999999754


No 74 
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1
Probab=51.75  E-value=8.3  Score=20.47  Aligned_cols=21  Identities=10%  Similarity=0.268  Sum_probs=16.0

Q ss_pred             eeccceeEeCCCCccccccCC
Q psy15340         50 EVVEGDLECPESGRKFPISSG   70 (81)
Q Consensus        50 ~v~eg~L~C~~c~~~ypI~dG   70 (81)
                      +..+....|+.||+.|.-.+.
T Consensus        34 H~~~k~~~C~~C~k~f~~~~~   54 (62)
T 1vd4_A           34 DPMTGTFRCTFCHTEVEEDES   54 (62)
T ss_dssp             ETTTTEEBCSSSCCBCEECTT
T ss_pred             cCCCCCEECCCCCCccccCcc
Confidence            445677999999999976653


No 75 
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=51.74  E-value=6.4  Score=19.18  Aligned_cols=17  Identities=24%  Similarity=0.456  Sum_probs=13.2

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-+
T Consensus         9 ~~k~~~C~~C~k~f~~~   25 (46)
T 2eoy_A            9 KEKCFKCNKCEKTFSCS   25 (46)
T ss_dssp             CSCCEECSSSCCEESSS
T ss_pred             CCCCEECcCCCCcCCCH
Confidence            34568999999999754


No 76 
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=51.69  E-value=6.6  Score=18.55  Aligned_cols=16  Identities=31%  Similarity=0.628  Sum_probs=12.5

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-.
T Consensus         8 ~k~~~C~~C~k~f~~~   23 (41)
T 2ept_A            8 QRVYECQECGKSFRQK   23 (41)
T ss_dssp             CCCEECSSSCCEESSH
T ss_pred             CCCeECCCCCCCcCCH
Confidence            4467899999999643


No 77 
>2l8e_A Polyhomeotic-like protein 1; DNA binding protein; NMR {Homo sapiens}
Probab=51.66  E-value=6.3  Score=21.85  Aligned_cols=21  Identities=19%  Similarity=0.370  Sum_probs=15.9

Q ss_pred             eeeccceeEeCCCCccccccC
Q psy15340         49 VEVVEGDLECPESGRKFPISS   69 (81)
Q Consensus        49 ~~v~eg~L~C~~c~~~ypI~d   69 (81)
                      .+...+.++|+.||...+...
T Consensus        12 ~~~~~~~~~C~~CG~~i~~~~   32 (49)
T 2l8e_A           12 LDKKANLLKCEYCGKYAPAEQ   32 (49)
T ss_dssp             GGGGCSEEECTTTCCEEEGGG
T ss_pred             ccccCCCCcChhccCcccccc
Confidence            344567788999999888753


No 78 
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=51.14  E-value=5  Score=19.00  Aligned_cols=16  Identities=25%  Similarity=0.611  Sum_probs=12.6

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus         9 ~k~~~C~~C~k~f~~~   24 (42)
T 2ytb_A            9 EKPYRCDQCGKAFSQK   24 (42)
T ss_dssp             CCSBCCTTTTCCBSSH
T ss_pred             CCCeeCCCccchhCCH
Confidence            4567899999999754


No 79 
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A
Probab=50.94  E-value=6.1  Score=19.25  Aligned_cols=16  Identities=50%  Similarity=0.956  Sum_probs=12.7

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~F~~~   25 (46)
T 2emj_A           10 EKPFECAECGKSFSIS   25 (46)
T ss_dssp             CCSEECSSSSCEESSH
T ss_pred             CCCEECCCCCcccCCH
Confidence            4568999999999643


No 80 
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=50.89  E-value=6.4  Score=18.92  Aligned_cols=16  Identities=19%  Similarity=0.401  Sum_probs=12.8

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus         8 ~k~~~C~~C~k~f~~~   23 (44)
T 2emx_A            8 EKPFGCSCCEKAFSSK   23 (44)
T ss_dssp             CCCEECSSSSCEESSH
T ss_pred             CcCccCCCCCcccCCH
Confidence            4568999999999754


No 81 
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=50.60  E-value=6.5  Score=18.63  Aligned_cols=16  Identities=25%  Similarity=0.522  Sum_probs=12.7

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus         9 ~k~~~C~~C~k~f~~~   24 (42)
T 2en2_A            9 EKPYKCETCGARFVQV   24 (42)
T ss_dssp             SCSEECTTTCCEESSH
T ss_pred             CCCEeCCCcChhhCCH
Confidence            4568999999999643


No 82 
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=50.52  E-value=6.6  Score=18.99  Aligned_cols=16  Identities=31%  Similarity=0.652  Sum_probs=12.8

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2eow_A           10 EKPYKCNECGKAFRAR   25 (46)
T ss_dssp             CCCEECTTSCCEESSH
T ss_pred             CCCeeccccCChhcCH
Confidence            4568999999999754


No 83 
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=50.45  E-value=6.9  Score=18.91  Aligned_cols=17  Identities=29%  Similarity=0.528  Sum_probs=13.1

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-+
T Consensus         9 ~~~~~~C~~C~k~f~~~   25 (46)
T 2yrj_A            9 GEKPYRCGECGKAFAQK   25 (46)
T ss_dssp             CCCCEECSSSCCEESSH
T ss_pred             CCCCeECCCCCCccCCH
Confidence            34568999999999743


No 84 
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B
Probab=50.14  E-value=5.6  Score=19.96  Aligned_cols=16  Identities=19%  Similarity=0.382  Sum_probs=12.2

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +.-..|+.||++|.-+
T Consensus         6 ekp~~C~~CgK~F~~~   21 (36)
T 1fv5_A            6 PARFMCLPCGIAFSSP   21 (36)
T ss_dssp             CCCCEETTTTEECSCH
T ss_pred             ccCeECCCCCCccCCH
Confidence            3457899999999643


No 85 
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=49.88  E-value=4.9  Score=19.29  Aligned_cols=16  Identities=38%  Similarity=0.661  Sum_probs=12.6

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (44)
T 2eoj_A           10 ENPYECCECGKVFSRK   25 (44)
T ss_dssp             CCSCEETTTTEECSSH
T ss_pred             CcCeeCCCCCCccCCH
Confidence            4568999999998754


No 86 
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=49.87  E-value=6.7  Score=19.03  Aligned_cols=17  Identities=24%  Similarity=0.378  Sum_probs=13.1

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-+
T Consensus         9 ~~~~~~C~~C~k~F~~~   25 (46)
T 2em3_A            9 GEKPYECKVCSKAFTQK   25 (46)
T ss_dssp             SCCSEECSSSCCEESSH
T ss_pred             CCcCeECCCCCcccCCH
Confidence            34568999999999743


No 87 
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=49.56  E-value=7  Score=19.02  Aligned_cols=17  Identities=24%  Similarity=0.456  Sum_probs=13.2

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-+
T Consensus         9 ~~k~~~C~~C~k~f~~~   25 (46)
T 2em8_A            9 GEKPYKCVECGKGYKRR   25 (46)
T ss_dssp             SCCSEECSSSCCEESSH
T ss_pred             CCCCeECcccCchhCCH
Confidence            34568999999999743


No 88 
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=49.46  E-value=5  Score=19.01  Aligned_cols=16  Identities=25%  Similarity=0.447  Sum_probs=12.5

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus         8 ~k~~~C~~C~k~f~~~   23 (42)
T 2yte_A            8 EKPYSCAECKETFSDN   23 (42)
T ss_dssp             CCSCBCTTTCCBCSSH
T ss_pred             CCCeECCCCCCccCCH
Confidence            4457899999999743


No 89 
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=49.31  E-value=6.7  Score=19.03  Aligned_cols=17  Identities=29%  Similarity=0.518  Sum_probs=13.3

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-+
T Consensus         9 ~~k~~~C~~C~k~f~~~   25 (46)
T 2ene_A            9 GEKPYKCNECGKVFRHN   25 (46)
T ss_dssp             CSSSEECSSSCCEESSH
T ss_pred             CCCCeECCCCCchhCCh
Confidence            34568999999999754


No 90 
>2fe3_A Peroxide operon regulator; oxidative stress regulator, DNA binding protein; 1.75A {Bacillus subtilis} PDB: 3f8n_A 2rgv_A*
Probab=49.22  E-value=6.9  Score=24.96  Aligned_cols=16  Identities=13%  Similarity=0.260  Sum_probs=13.8

Q ss_pred             eeEeCCCCccccccCC
Q psy15340         55 DLECPESGRKFPISSG   70 (81)
Q Consensus        55 ~L~C~~c~~~ypI~dG   70 (81)
                      -|+|..||+.+.|.+.
T Consensus        93 HliC~~Cg~v~~~~~~  108 (145)
T 2fe3_A           93 HAICENCGKIVDFHYP  108 (145)
T ss_dssp             EEEETTTCCEEECCCC
T ss_pred             eEEECCCCCEEEecCC
Confidence            5999999999999653


No 91 
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A*
Probab=49.14  E-value=7.1  Score=19.90  Aligned_cols=16  Identities=25%  Similarity=0.235  Sum_probs=12.6

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-.
T Consensus        22 ~k~~~C~~C~k~f~~~   37 (54)
T 1yui_A           22 EQPATCPICYAVIRQS   37 (54)
T ss_dssp             SCCEECTTTCCEESSH
T ss_pred             CCCccCCCCCcccCCH
Confidence            4568999999998643


No 92 
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=49.11  E-value=5.8  Score=19.28  Aligned_cols=16  Identities=31%  Similarity=0.642  Sum_probs=12.5

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2emg_A           10 ENPFICSECGKVFTHK   25 (46)
T ss_dssp             CCSCBCTTTCCBCSSH
T ss_pred             CCCEECCccCcccCCH
Confidence            4467899999999643


No 93 
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=49.00  E-value=6.1  Score=18.80  Aligned_cols=16  Identities=25%  Similarity=0.430  Sum_probs=12.7

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus         9 ~k~~~C~~C~k~f~~~   24 (42)
T 2eos_A            9 EKPYPCEICGTRFRHL   24 (42)
T ss_dssp             SCCBCCSSSCCCBSSH
T ss_pred             CCCEECCCCCCccCCH
Confidence            4467899999999754


No 94 
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=48.96  E-value=7.3  Score=18.94  Aligned_cols=16  Identities=31%  Similarity=0.590  Sum_probs=12.8

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~F~~~   25 (46)
T 2eoo_A           10 ERPYGCNECGKNFGRH   25 (46)
T ss_dssp             CCCEECSSSCCEESSH
T ss_pred             CCCEEccccCcccCCH
Confidence            4568999999999754


No 95 
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=48.93  E-value=7.1  Score=18.93  Aligned_cols=17  Identities=29%  Similarity=0.513  Sum_probs=13.2

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-+
T Consensus         9 ~~k~~~C~~C~k~f~~~   25 (46)
T 2eml_A            9 GEKPYECSVCGKAFSHR   25 (46)
T ss_dssp             SCCSEECSSSCCEESSH
T ss_pred             CCCCeeCCCcCCccCCH
Confidence            34568999999999754


No 96 
>3mwm_A ZUR, putative metal uptake regulation protein; FUR, regulatory metal, graded transcription regulation, transcription; 2.40A {Streptomyces coelicolor}
Probab=48.88  E-value=6.8  Score=24.94  Aligned_cols=15  Identities=20%  Similarity=0.565  Sum_probs=13.2

Q ss_pred             eeEeCCCCccccccC
Q psy15340         55 DLECPESGRKFPISS   69 (81)
Q Consensus        55 ~L~C~~c~~~ypI~d   69 (81)
                      -|+|..||+.+.|.+
T Consensus        87 HliC~~Cg~v~~~~~  101 (139)
T 3mwm_A           87 HLVCRACGKAVEVEG  101 (139)
T ss_dssp             EEEETTTCCEEEECC
T ss_pred             EEEECCCCCEeeccc
Confidence            499999999999864


No 97 
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=48.82  E-value=6.7  Score=18.70  Aligned_cols=17  Identities=29%  Similarity=0.458  Sum_probs=13.2

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-+
T Consensus         9 ~~k~~~C~~C~k~f~~~   25 (44)
T 2eof_A            9 GEKPYECNECQKAFNTK   25 (44)
T ss_dssp             CCCSEECTTTCCEESCH
T ss_pred             CCCCeECCCCCcccCCH
Confidence            34568999999999754


No 98 
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=48.77  E-value=5.8  Score=19.27  Aligned_cols=16  Identities=31%  Similarity=0.646  Sum_probs=12.6

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~F~~~   25 (46)
T 2enf_A           10 EKPYKCNECGKVFTQN   25 (46)
T ss_dssp             CCSCBCSSSCCBCSSH
T ss_pred             CcCeECCCCCcccCCH
Confidence            4567999999999754


No 99 
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=48.66  E-value=7.4  Score=18.92  Aligned_cols=16  Identities=31%  Similarity=0.696  Sum_probs=12.8

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~~~~~C~~C~k~f~~~   25 (46)
T 2em5_A           10 TKSHQCHECGRGFTLK   25 (46)
T ss_dssp             SCSEECSSSCCEESSH
T ss_pred             CCCeECCcCCCccCCH
Confidence            4568999999999643


No 100
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=48.66  E-value=6.7  Score=19.03  Aligned_cols=17  Identities=18%  Similarity=0.446  Sum_probs=13.1

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-+
T Consensus         9 ~~k~~~C~~C~k~f~~~   25 (46)
T 2ysp_A            9 GEKPYKCEKCGKGYNSK   25 (46)
T ss_dssp             SCCSEEETTTTEEESCH
T ss_pred             CCCCeECCCCCCccCCH
Confidence            34568999999999654


No 101
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=48.60  E-value=5.8  Score=19.37  Aligned_cols=17  Identities=24%  Similarity=0.382  Sum_probs=13.0

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-+
T Consensus         9 ~~k~~~C~~C~k~F~~~   25 (46)
T 2en9_A            9 GKKLFKCNECKKTFTQS   25 (46)
T ss_dssp             SSCCCBCTTTCCBCSSH
T ss_pred             CCCCEECCccCcccCCH
Confidence            34568899999999743


No 102
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=48.51  E-value=7.7  Score=18.86  Aligned_cols=17  Identities=24%  Similarity=0.552  Sum_probs=13.1

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-+
T Consensus         9 ~~k~~~C~~C~k~f~~~   25 (46)
T 2yto_A            9 GEKPYKCSDCGKAFTRK   25 (46)
T ss_dssp             SCCCEECSSSCCEESSH
T ss_pred             CCCCEECcccCCccCCH
Confidence            34568999999999643


No 103
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=48.44  E-value=7.2  Score=18.98  Aligned_cols=16  Identities=38%  Similarity=0.752  Sum_probs=12.6

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~F~~~   25 (46)
T 2ytp_A           10 ERHYECSECGKAFARK   25 (46)
T ss_dssp             CCCEECSSSCCEESSH
T ss_pred             CCCeECCcCCcccCCH
Confidence            4568999999999643


No 104
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A
Probab=48.28  E-value=7.4  Score=18.80  Aligned_cols=17  Identities=29%  Similarity=0.565  Sum_probs=13.1

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-+
T Consensus         9 ~~k~~~C~~C~k~f~~~   25 (46)
T 2em9_A            9 GEKPYNCKECGKSFRWA   25 (46)
T ss_dssp             CCCSEECSSSCCEESSH
T ss_pred             CCcCeECCccccccCCh
Confidence            34568999999999753


No 105
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=48.28  E-value=7.8  Score=18.77  Aligned_cols=17  Identities=35%  Similarity=0.622  Sum_probs=13.1

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-+
T Consensus         9 ~~k~~~C~~C~k~F~~~   25 (46)
T 2emy_A            9 GENPYECHECGKAFSRK   25 (46)
T ss_dssp             SSCCEECSSSCCEESSH
T ss_pred             CCcCcCCCCCCcccCcH
Confidence            34568999999999743


No 106
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=48.11  E-value=7.8  Score=18.78  Aligned_cols=16  Identities=31%  Similarity=0.619  Sum_probs=12.8

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2ep3_A           10 EKPYRCAECGKAFTDR   25 (46)
T ss_dssp             CCSEECSSSCCEESSH
T ss_pred             CCCeECCCCCchhCCH
Confidence            4568999999999754


No 107
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=48.06  E-value=6.7  Score=19.09  Aligned_cols=16  Identities=31%  Similarity=0.623  Sum_probs=12.6

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2eoz_A           10 EKPYSCNVCGKAFVLS   25 (46)
T ss_dssp             CCSEEETTTTEEESSH
T ss_pred             CCCeECcccChhhCCH
Confidence            4568999999999643


No 108
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=48.04  E-value=7.1  Score=18.93  Aligned_cols=17  Identities=29%  Similarity=0.382  Sum_probs=13.2

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-+
T Consensus         9 ~~~~~~C~~C~k~f~~~   25 (46)
T 2yso_A            9 REKSHQCRECGEIFFQY   25 (46)
T ss_dssp             CCCCEECTTTCCEESSH
T ss_pred             CCCCEEccccChhhCCH
Confidence            34568999999999753


No 109
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=47.83  E-value=7.8  Score=18.70  Aligned_cols=17  Identities=29%  Similarity=0.483  Sum_probs=13.2

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-+
T Consensus         9 ~~k~~~C~~C~k~F~~~   25 (46)
T 2epw_A            9 GEKPCKCTECGKAFCWK   25 (46)
T ss_dssp             CCCSEECSSSCCEESSS
T ss_pred             CCCCeeCCCCCCccCCH
Confidence            34568999999999754


No 110
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=47.74  E-value=7.1  Score=18.94  Aligned_cols=16  Identities=31%  Similarity=0.605  Sum_probs=12.7

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2em7_A           10 EKPYKCEECGKGFICR   25 (46)
T ss_dssp             CCSEECSSSCCEESCH
T ss_pred             CcCccCCCccchhCCH
Confidence            4568999999999754


No 111
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=47.67  E-value=5.9  Score=19.12  Aligned_cols=16  Identities=38%  Similarity=0.623  Sum_probs=12.7

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-.
T Consensus        10 ~~~~~C~~C~k~f~~~   25 (44)
T 2eou_A           10 KTTSECQECGKIFRHS   25 (44)
T ss_dssp             SCCCCCTTTCCCCSSH
T ss_pred             CcCeECCCCCcccCCH
Confidence            4567899999999754


No 112
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=47.59  E-value=7.7  Score=18.87  Aligned_cols=17  Identities=29%  Similarity=0.595  Sum_probs=13.1

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-+
T Consensus         9 ~~k~~~C~~C~k~f~~~   25 (46)
T 2em2_A            9 GEKPFKCKECGKAFRQN   25 (46)
T ss_dssp             CCCSEECSSSCCEESSH
T ss_pred             CCCCEECCcCCchhCCH
Confidence            34568999999999643


No 113
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens}
Probab=47.48  E-value=8.4  Score=21.34  Aligned_cols=24  Identities=25%  Similarity=0.443  Sum_probs=18.7

Q ss_pred             ceeEeCCCCccccccCCccccCCC
Q psy15340         54 GDLECPESGRKFPISSGIPNMLLK   77 (81)
Q Consensus        54 g~L~C~~c~~~ypI~dGIP~ml~~   77 (81)
                      +...||.|+..+...+=.||....
T Consensus        52 ~~~~CP~Cr~~~~~~~l~~n~~l~   75 (79)
T 2egp_A           52 GKSSCPVCGISYSFEHLQANQHLA   75 (79)
T ss_dssp             CCCCCSSSCCCCCSSGGGTCSSSC
T ss_pred             CCCcCCCCCCcCCHhhCCcCHHHH
Confidence            478999999999887766666554


No 114
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=47.31  E-value=7.5  Score=18.85  Aligned_cols=17  Identities=29%  Similarity=0.544  Sum_probs=13.1

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-+
T Consensus         9 ~~~~~~C~~C~k~f~~~   25 (46)
T 2ytk_A            9 GEKPYKCNECGKVFTQN   25 (46)
T ss_dssp             SSCSEECSSSCCEESSH
T ss_pred             CCCCEeCCcCCCccCCH
Confidence            34568999999999743


No 115
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=47.30  E-value=5.6  Score=19.49  Aligned_cols=17  Identities=29%  Similarity=0.579  Sum_probs=13.1

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-+
T Consensus         9 ~~k~~~C~~C~k~f~~~   25 (46)
T 2eon_A            9 GEKPYKCQVCGKAFRVS   25 (46)
T ss_dssp             SCCSCBCSSSCCBCSSH
T ss_pred             CCcccCCCCCCcccCcH
Confidence            34567899999999754


No 116
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=47.23  E-value=7.5  Score=18.83  Aligned_cols=17  Identities=29%  Similarity=0.530  Sum_probs=13.2

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-+
T Consensus         9 ~~~~~~C~~C~k~f~~~   25 (46)
T 2en6_A            9 GEKPYGCNECGKTFSQK   25 (46)
T ss_dssp             SSCCEEETTTTEEESSH
T ss_pred             CCcCeECCCCCcccCch
Confidence            34568999999999743


No 117
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=46.98  E-value=7.9  Score=22.80  Aligned_cols=19  Identities=11%  Similarity=0.216  Sum_probs=16.0

Q ss_pred             ceeEeCCCCccccccCCcc
Q psy15340         54 GDLECPESGRKFPISSGIP   72 (81)
Q Consensus        54 g~L~C~~c~~~ypI~dGIP   72 (81)
                      +...||.|+..|++...++
T Consensus        57 ~~~~CplCr~~~~~~~~~~   75 (80)
T 2d8s_A           57 DTRCCELCKYEFIMETKLS   75 (80)
T ss_dssp             CCSBCSSSCCBCCCCCCSC
T ss_pred             CCCCCCCCCCeeecCcccC
Confidence            4689999999999987654


No 118
>3eyy_A Putative iron uptake regulatory protein; NUR, nickel-uptake regulator, D-domain, dimerization domain, DB-domain, DNA-binding domain; 2.40A {Streptomyces coelicolor}
Probab=46.96  E-value=7  Score=25.04  Aligned_cols=15  Identities=13%  Similarity=0.257  Sum_probs=13.3

Q ss_pred             eeEeCCCCccccccC
Q psy15340         55 DLECPESGRKFPISS   69 (81)
Q Consensus        55 ~L~C~~c~~~ypI~d   69 (81)
                      -|+|..||+.+.|..
T Consensus        90 HliC~~Cg~v~~~~~  104 (145)
T 3eyy_A           90 HLVCRDCTNVIEADL  104 (145)
T ss_dssp             EEEESSSSCEEEECG
T ss_pred             EEEECCCCCEEEecC
Confidence            599999999999864


No 119
>3k7a_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, DNA-binding, DNA- directed RNA polymerase, isopeptide bond, magnesium; 3.80A {Saccharomyces cerevisiae}
Probab=46.92  E-value=5  Score=29.40  Aligned_cols=18  Identities=28%  Similarity=0.451  Sum_probs=14.3

Q ss_pred             eeeeccceeEeCCCCccc
Q psy15340         48 EVEVVEGDLECPESGRKF   65 (81)
Q Consensus        48 ~~~v~eg~L~C~~c~~~y   65 (81)
                      ..|-..|+++|..||..-
T Consensus        35 v~D~~~G~~vC~~CG~Vl   52 (345)
T 3k7a_M           35 VERFSEGDVVCALCGLVL   52 (345)
T ss_dssp             CCCSSSCSCCCSSSCCCC
T ss_pred             EEECCCCCEecCCCCeEc
Confidence            345578999999999865


No 120
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=46.86  E-value=7.9  Score=18.74  Aligned_cols=18  Identities=22%  Similarity=0.479  Sum_probs=13.7

Q ss_pred             ccceeEeCCCCccccccC
Q psy15340         52 VEGDLECPESGRKFPISS   69 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~d   69 (81)
                      .+....|+.|++.|.-+.
T Consensus         9 ~~~~~~C~~C~k~f~~~~   26 (46)
T 2ytg_A            9 GEKPFKCGECGKSYNQRV   26 (46)
T ss_dssp             SCCSEECTTTCCEESSSH
T ss_pred             CCCCeECCCCCcccCCHH
Confidence            345689999999997543


No 121
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=46.76  E-value=8.3  Score=18.59  Aligned_cols=16  Identities=31%  Similarity=0.605  Sum_probs=12.7

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~~~~~C~~C~k~f~~~   25 (46)
T 2eor_A           10 EKPYNCEECGKAFIHD   25 (46)
T ss_dssp             CCSEECTTTCCEESSH
T ss_pred             CcCccCCCCCCCcCCH
Confidence            4568999999999643


No 122
>2xig_A Ferric uptake regulation protein; hpfur, transcription, homeostasis; HET: CIT; 1.85A {Helicobacter pylori}
Probab=46.71  E-value=7.6  Score=25.00  Aligned_cols=16  Identities=13%  Similarity=0.430  Sum_probs=13.8

Q ss_pred             ceeEeCCCCccccccC
Q psy15340         54 GDLECPESGRKFPISS   69 (81)
Q Consensus        54 g~L~C~~c~~~ypI~d   69 (81)
                      .-|+|..||+.+.|.+
T Consensus        98 ~HliC~~Cg~v~~~~~  113 (150)
T 2xig_A           98 DHIICLHCGKIIEFAD  113 (150)
T ss_dssp             EEEEETTTCCEEEECC
T ss_pred             eEEEECCCCCEEEecC
Confidence            3699999999999864


No 123
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=46.65  E-value=6.7  Score=19.09  Aligned_cols=16  Identities=25%  Similarity=0.432  Sum_probs=12.7

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~F~~~   25 (46)
T 2enh_A           10 EKPYECDVCRKAFSHH   25 (46)
T ss_dssp             SSSCBCTTTCCBCSSS
T ss_pred             CCCcCCCCcCchhCCH
Confidence            4568899999999754


No 124
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=46.47  E-value=7.8  Score=18.70  Aligned_cols=16  Identities=31%  Similarity=0.623  Sum_probs=12.7

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2ytf_A           10 EKPFECSECQKAFNTK   25 (46)
T ss_dssp             CCSEECSSSCCEESSH
T ss_pred             CCCcCCCCCCcccCCH
Confidence            4568999999999644


No 125
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=46.38  E-value=6.7  Score=18.97  Aligned_cols=16  Identities=25%  Similarity=0.677  Sum_probs=12.6

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~~~~~C~~C~k~f~~~   25 (46)
T 2eov_A           10 EKPYKCSDCGKSFTWK   25 (46)
T ss_dssp             CCSCBCSSSCCBCSSH
T ss_pred             CCCccCCccChhhCCH
Confidence            4468899999999743


No 126
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=46.38  E-value=8.6  Score=18.60  Aligned_cols=16  Identities=38%  Similarity=0.717  Sum_probs=12.8

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2ytj_A           10 EKPYICAECGKAFTIR   25 (46)
T ss_dssp             CCSEECSSSCCEESSH
T ss_pred             CcCeECCCCChhhCCH
Confidence            4568999999999754


No 127
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=46.23  E-value=6.2  Score=19.16  Aligned_cols=16  Identities=31%  Similarity=0.652  Sum_probs=12.6

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2eq1_A           10 EKPYKCNECGKAFRAH   25 (46)
T ss_dssp             SCCCCCTTTTCCCSSH
T ss_pred             CCCeECCcCChhhCCH
Confidence            4568899999999643


No 128
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=46.08  E-value=7.5  Score=18.92  Aligned_cols=17  Identities=29%  Similarity=0.585  Sum_probs=13.0

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-+
T Consensus         9 ~~k~~~C~~C~k~F~~~   25 (46)
T 2emf_A            9 GGKHFECTECGKAFTRK   25 (46)
T ss_dssp             SSCCEECSSSCCEESCH
T ss_pred             CCCCeECCCCCchhCCH
Confidence            34568999999999643


No 129
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A
Probab=45.94  E-value=7.8  Score=18.78  Aligned_cols=16  Identities=31%  Similarity=0.650  Sum_probs=12.8

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2ema_A           10 EKRYKCNECGKVFSRN   25 (46)
T ss_dssp             SCCEECSSSCCEESSH
T ss_pred             CcCcCCCCCcchhCCH
Confidence            4568999999999643


No 130
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=45.91  E-value=8.1  Score=18.70  Aligned_cols=16  Identities=25%  Similarity=0.439  Sum_probs=12.8

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~F~~~   25 (46)
T 2emh_A           10 ERPYICTVCGKAFTDR   25 (46)
T ss_dssp             CCSEECTTTCCEESSH
T ss_pred             CCCcCCCCCCchhCCH
Confidence            4568999999999754


No 131
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=45.79  E-value=8.1  Score=18.70  Aligned_cols=16  Identities=38%  Similarity=0.700  Sum_probs=12.6

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~F~~~   25 (46)
T 2en3_A           10 EKPFQCKECGMNFSWS   25 (46)
T ss_dssp             CCSEECSSSCCEESSS
T ss_pred             CCCeeCcccChhhCCH
Confidence            4568999999999643


No 132
>4ets_A Ferric uptake regulation protein; metal binding protein, transcription factor; 2.10A {Campylobacter jejuni subsp}
Probab=45.79  E-value=8  Score=25.38  Aligned_cols=15  Identities=13%  Similarity=0.494  Sum_probs=13.2

Q ss_pred             eeEeCCCCccccccC
Q psy15340         55 DLECPESGRKFPISS   69 (81)
Q Consensus        55 ~L~C~~c~~~ypI~d   69 (81)
                      -|+|..||+.+.+.+
T Consensus       107 HliC~~CG~v~e~~~  121 (162)
T 4ets_A          107 HMICKNCGKIIEFEN  121 (162)
T ss_dssp             EEEETTTCCEEEECC
T ss_pred             EEEECCCCCEEEecc
Confidence            499999999999864


No 133
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A
Probab=45.64  E-value=8.2  Score=18.62  Aligned_cols=16  Identities=13%  Similarity=0.476  Sum_probs=12.8

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2el4_A           10 VKPYGCSQCAKTFSLK   25 (46)
T ss_dssp             CCSEECSSSSCEESSH
T ss_pred             CCceECCCCCchhCCH
Confidence            4568999999999754


No 134
>3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus}
Probab=45.44  E-value=9.5  Score=20.96  Aligned_cols=14  Identities=14%  Similarity=0.204  Sum_probs=10.9

Q ss_pred             ccceeEeCCCCccc
Q psy15340         52 VEGDLECPESGRKF   65 (81)
Q Consensus        52 ~eg~L~C~~c~~~y   65 (81)
                      ..+.+.|+.||..|
T Consensus        34 ~~~R~~C~kCG~t~   47 (50)
T 3j20_Y           34 HGDRWACGKCGYTE   47 (50)
T ss_dssp             CSSEEECSSSCCEE
T ss_pred             CCCeEECCCCCCEE
Confidence            35788999998765


No 135
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=45.38  E-value=7  Score=19.02  Aligned_cols=17  Identities=24%  Similarity=0.589  Sum_probs=13.1

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-+
T Consensus         9 ~~k~~~C~~C~k~F~~~   25 (46)
T 2elz_A            9 VEKPYKCEDCGKGYNRR   25 (46)
T ss_dssp             CCSSCBCSSSCCBCSSH
T ss_pred             CCCCeeCcccCchhCCH
Confidence            34568899999999754


No 136
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=45.33  E-value=9.1  Score=18.43  Aligned_cols=16  Identities=31%  Similarity=0.571  Sum_probs=12.8

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2eme_A           10 EKPYVCDYCGKAFGLS   25 (46)
T ss_dssp             CCSEECSSSCCEESSH
T ss_pred             CCCeECCCCChhhCCH
Confidence            4568999999999754


No 137
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=45.27  E-value=9.1  Score=18.51  Aligned_cols=16  Identities=31%  Similarity=0.646  Sum_probs=12.8

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2yu8_A           10 EKPYKCNECGKVFTQN   25 (46)
T ss_dssp             CSSEECSSSCCEESSS
T ss_pred             CCCeECCcCCchhCCH
Confidence            4568999999999754


No 138
>2w57_A Ferric uptake regulation protein; gene regulation, transcription regulation, transport, iron, repressor, DNA-binding, transcription; 2.60A {Vibrio cholerae}
Probab=45.25  E-value=8.3  Score=24.82  Aligned_cols=15  Identities=27%  Similarity=0.534  Sum_probs=13.2

Q ss_pred             eeEeCCCCccccccC
Q psy15340         55 DLECPESGRKFPISS   69 (81)
Q Consensus        55 ~L~C~~c~~~ypI~d   69 (81)
                      -|+|..||+.+.|.+
T Consensus        90 HliC~~Cg~v~~~~~  104 (150)
T 2w57_A           90 HLVCLDCGEVIEFSD  104 (150)
T ss_dssp             EEEETTTCCEEEECC
T ss_pred             EEEECCCCCEEEecc
Confidence            599999999999864


No 139
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=45.08  E-value=7.3  Score=18.94  Aligned_cols=16  Identities=31%  Similarity=0.578  Sum_probs=12.6

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2em6_A           10 EKCYKCDVCGKEFSQS   25 (46)
T ss_dssp             CCCCBCSSSCCBCSSH
T ss_pred             CCCeECCCCCcccCCH
Confidence            4568899999999643


No 140
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=45.00  E-value=8.2  Score=18.68  Aligned_cols=16  Identities=25%  Similarity=0.544  Sum_probs=12.7

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2emp_A           10 VKPYMCNECGKAFSVY   25 (46)
T ss_dssp             CCSEECSSSCCEESCH
T ss_pred             CcCeECCCCCchhCCH
Confidence            4568999999999754


No 141
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2
Probab=44.98  E-value=4.2  Score=22.81  Aligned_cols=24  Identities=29%  Similarity=0.526  Sum_probs=19.0

Q ss_pred             cceeEeCCCCccccccCCccccCC
Q psy15340         53 EGDLECPESGRKFPISSGIPNMLL   76 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~dGIP~ml~   76 (81)
                      .|...||.|+..+...+=+||...
T Consensus        41 ~~~~~CP~C~~~~~~~~l~~n~~l   64 (78)
T 1t1h_A           41 AGHKTCPKSQETLLHAGLTPNYVL   64 (78)
T ss_dssp             TTCCBCTTTCCBCSSCCCEECTTT
T ss_pred             HCcCCCCCCcCCCChhhCccCHHH
Confidence            357899999999988777777654


No 142
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=44.97  E-value=9.1  Score=18.43  Aligned_cols=16  Identities=31%  Similarity=0.563  Sum_probs=12.7

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-.
T Consensus        10 ~~~~~C~~C~k~f~~~   25 (46)
T 2en8_A           10 EKSHTCDECGKNFCYI   25 (46)
T ss_dssp             CSSEECTTTCCEESSH
T ss_pred             CCCeECCCcCcccCCH
Confidence            4568999999999643


No 143
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=44.66  E-value=8.4  Score=18.58  Aligned_cols=16  Identities=38%  Similarity=0.617  Sum_probs=12.7

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2emm_A           10 ERPHKCNECGKSFIQS   25 (46)
T ss_dssp             CCSEECSSSCCEESSH
T ss_pred             CCCeeCCCCChhhCCH
Confidence            4568999999999754


No 144
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=44.39  E-value=7.5  Score=18.80  Aligned_cols=16  Identities=31%  Similarity=0.582  Sum_probs=12.6

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~F~~~   25 (47)
T 2epx_A           10 KKPYECIECGKAFIQN   25 (47)
T ss_dssp             CCSBCCSSSCCCBSSH
T ss_pred             CCCEECCccCchhCCh
Confidence            4468899999999743


No 145
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=44.37  E-value=5.9  Score=18.92  Aligned_cols=16  Identities=25%  Similarity=0.457  Sum_probs=12.6

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (44)
T 2en7_A           10 MKPYVCNECGKAFRSK   25 (44)
T ss_dssp             SSSSCCTTTCCCCSSH
T ss_pred             CcCeECCCCCCccCCH
Confidence            4567899999999754


No 146
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1
Probab=44.32  E-value=8.6  Score=20.79  Aligned_cols=23  Identities=26%  Similarity=0.436  Sum_probs=17.5

Q ss_pred             cceeEeCCCCccccccCCccccC
Q psy15340         53 EGDLECPESGRKFPISSGIPNML   75 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~dGIP~ml   75 (81)
                      ++...||.|+..+.-++=.|++.
T Consensus        41 ~~~~~CP~Cr~~~~~~~~~~~~~   63 (65)
T 1g25_A           41 RGAGNCPECGTPLRKSNFRVQLF   63 (65)
T ss_dssp             TTSSSCTTTCCCCSSCCCEEECC
T ss_pred             cCCCcCCCCCCccccccceeecc
Confidence            35678999999998776666654


No 147
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A
Probab=44.24  E-value=7.5  Score=18.90  Aligned_cols=18  Identities=33%  Similarity=0.562  Sum_probs=13.5

Q ss_pred             ccceeEeCCCCccccccC
Q psy15340         52 VEGDLECPESGRKFPISS   69 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~d   69 (81)
                      .+....|+.|++.|.-+.
T Consensus         9 ~~k~~~C~~C~k~f~~~~   26 (46)
T 2ely_A            9 GEKPFKCVECGKGFSRRS   26 (46)
T ss_dssp             CCCSBCCSSSCCCBSSTT
T ss_pred             CCCCcccCccCcccCCHH
Confidence            345678999999997543


No 148
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=43.90  E-value=9.2  Score=18.45  Aligned_cols=16  Identities=25%  Similarity=0.675  Sum_probs=12.6

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~F~~~   25 (45)
T 2epu_A           10 QKPFECTHCGKSFRAK   25 (45)
T ss_dssp             CCSEEETTTTEEESSH
T ss_pred             CcCccCCCCCCccCCh
Confidence            4468899999999754


No 149
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=43.82  E-value=9.3  Score=18.47  Aligned_cols=16  Identities=31%  Similarity=0.787  Sum_probs=12.8

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~~~~~C~~C~k~f~~~   25 (46)
T 2en1_A           10 EKPFKCEECGKRFTQN   25 (46)
T ss_dssp             CCSEEETTTTEEESSH
T ss_pred             CCCeeCCCCCcccCCH
Confidence            4568999999999754


No 150
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A
Probab=43.60  E-value=9.2  Score=16.08  Aligned_cols=13  Identities=31%  Similarity=0.590  Sum_probs=10.3

Q ss_pred             eEeC--CCCcccccc
Q psy15340         56 LECP--ESGRKFPIS   68 (81)
Q Consensus        56 L~C~--~c~~~ypI~   68 (81)
                      ..|+  .|++.|.-.
T Consensus         3 ~~C~~~~C~k~f~~~   17 (29)
T 2ab3_A            3 YVCHFENCGRSFNDR   17 (29)
T ss_dssp             EEECSTTTCEEESSH
T ss_pred             CCCcCCcCcCccCCH
Confidence            5799  999998643


No 151
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=43.57  E-value=8.7  Score=18.59  Aligned_cols=16  Identities=31%  Similarity=0.609  Sum_probs=12.7

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2ep2_A           10 EKPYECSICGKSFTKK   25 (46)
T ss_dssp             CCSEECSSSCCEESSH
T ss_pred             CcCcCCCCCCcccCCH
Confidence            4568999999999743


No 152
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1
Probab=43.28  E-value=9.5  Score=22.85  Aligned_cols=19  Identities=26%  Similarity=0.700  Sum_probs=15.6

Q ss_pred             cceeEeCCCCccccccCCc
Q psy15340         53 EGDLECPESGRKFPISSGI   71 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~dGI   71 (81)
                      .+...||.|+..|..+.|-
T Consensus        80 ~~~~~CP~CR~~~~~~~g~   98 (114)
T 1v87_A           80 DGSLQCPSCKTIYGEKTGT   98 (114)
T ss_dssp             SSCCBCTTTCCBSSSCSSS
T ss_pred             CCCCcCCCCCCccCCCCCC
Confidence            4578999999999887663


No 153
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=43.03  E-value=7  Score=19.03  Aligned_cols=16  Identities=25%  Similarity=0.420  Sum_probs=12.5

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2eoh_A           10 KKPYECKECRKTFIQI   25 (46)
T ss_dssp             SCSCCCSSSCCCCSSH
T ss_pred             CCCcCCCCcCchhCCH
Confidence            4467899999999743


No 154
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=42.98  E-value=7.8  Score=18.83  Aligned_cols=16  Identities=31%  Similarity=0.798  Sum_probs=12.6

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2yth_A           10 EKPFQCEECGKRFTQN   25 (46)
T ss_dssp             SSSBCCSSSCCCBSSH
T ss_pred             CcCCCCCCCCcccCCH
Confidence            4568899999999643


No 155
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=42.94  E-value=7.7  Score=18.73  Aligned_cols=16  Identities=31%  Similarity=0.771  Sum_probs=12.6

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2eq3_A           10 EKPYECNQCGKAFSVR   25 (46)
T ss_dssp             CCSSEETTTTEECSSH
T ss_pred             CCCeECCCCChhhCCH
Confidence            4568899999999643


No 156
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=42.86  E-value=8  Score=18.72  Aligned_cols=16  Identities=31%  Similarity=0.646  Sum_probs=12.4

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~F~~~   25 (46)
T 2yti_A           10 EKPYKCNECGKVFTQN   25 (46)
T ss_dssp             CCTTCCSSSCCCCSSH
T ss_pred             CcCeECCCCCcccCCh
Confidence            4457899999999754


No 157
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=42.82  E-value=11  Score=18.25  Aligned_cols=17  Identities=29%  Similarity=0.565  Sum_probs=13.1

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-+
T Consensus         9 ~~k~~~C~~C~k~f~~~   25 (46)
T 2enc_A            9 GEKPFKCEECGKGFYTN   25 (46)
T ss_dssp             CCCSEECSSSCCEESSH
T ss_pred             CCCCcCCCCCCCcCCCh
Confidence            34568999999999744


No 158
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=42.74  E-value=6.8  Score=18.94  Aligned_cols=16  Identities=31%  Similarity=0.665  Sum_probs=12.5

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2ep1_A           10 EKPYECSDCGKSFIKK   25 (46)
T ss_dssp             CCSSCCSSSCCCCSSH
T ss_pred             CCCcCCCCCCchhCCH
Confidence            4568899999999643


No 159
>3dqy_A Toluene 1,2-dioxygenase system ferredoxin subunit; rieske, iron-sulfur cluster, 2Fe-2S, aromatic hydrocarbons catabolism, electron transport; 1.20A {Pseudomonas putida} SCOP: b.33.1.0 PDB: 4emj_B*
Probab=42.72  E-value=13  Score=22.10  Aligned_cols=25  Identities=20%  Similarity=0.186  Sum_probs=20.3

Q ss_pred             eeccceeEeCCCCccccccCCcccc
Q psy15340         50 EVVEGDLECPESGRKFPISSGIPNM   74 (81)
Q Consensus        50 ~v~eg~L~C~~c~~~ypI~dGIP~m   74 (81)
                      .+.++.++||--|-.|.+++|-..=
T Consensus        53 ~~~~~~i~Cp~Hg~~Fdl~~G~~~~   77 (106)
T 3dqy_A           53 YLDGDIVECTLHFGKFCVRTGKVKA   77 (106)
T ss_dssp             EEETTEEECTTTCCEEETTTCCEEE
T ss_pred             EEeCCEEECCCCCCEEeCCCCCEeC
Confidence            3457899999999999999996543


No 160
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens}
Probab=42.66  E-value=10  Score=18.36  Aligned_cols=16  Identities=13%  Similarity=0.370  Sum_probs=12.7

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2el6_A           10 VNPYKCSQCEKSFSGK   25 (46)
T ss_dssp             CCSEECSSSSCEESSH
T ss_pred             CCCeECCCCCcccCCH
Confidence            4568999999999754


No 161
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=42.55  E-value=7.7  Score=18.80  Aligned_cols=16  Identities=25%  Similarity=0.636  Sum_probs=12.6

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2epz_A           10 EKPFDCIDCGKAFSDH   25 (46)
T ss_dssp             CCSBCCTTTCCCBSSH
T ss_pred             CCCeECCCCCceeCCH
Confidence            4568899999999754


No 162
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=42.51  E-value=8.3  Score=18.66  Aligned_cols=16  Identities=25%  Similarity=0.596  Sum_probs=12.6

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~F~~~   25 (46)
T 2ytn_A           10 KKPYKCNECGKVFTQN   25 (46)
T ss_dssp             CSSCBCTTTCCBCSSH
T ss_pred             CcCeECCCCCCeeCCH
Confidence            4568899999999754


No 163
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=42.50  E-value=6.8  Score=19.07  Aligned_cols=16  Identities=31%  Similarity=0.634  Sum_probs=12.6

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-.
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2emz_A           10 ERPFKCNECGKGFGRR   25 (46)
T ss_dssp             CCSCCCSSSCCCCSSH
T ss_pred             CCCeECCCCCcccCCH
Confidence            4467899999999754


No 164
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=42.39  E-value=11  Score=18.17  Aligned_cols=16  Identities=31%  Similarity=0.611  Sum_probs=12.8

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~F~~~   25 (46)
T 2eq0_A           10 EKPYKCHECGKVFRRN   25 (46)
T ss_dssp             CCCEECTTTCCEESSH
T ss_pred             CCCeECCCCCchhCCH
Confidence            4568999999999754


No 165
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens}
Probab=42.11  E-value=8.3  Score=20.34  Aligned_cols=20  Identities=20%  Similarity=0.282  Sum_probs=15.8

Q ss_pred             eeEeCCCCccccccCCcccc
Q psy15340         55 DLECPESGRKFPISSGIPNM   74 (81)
Q Consensus        55 ~L~C~~c~~~ypI~dGIP~m   74 (81)
                      ...||.|+..+..++=+|+.
T Consensus        44 ~~~CP~Cr~~~~~~~~~~~~   63 (64)
T 2xeu_A           44 ANTCPTCRKKINHKRYHPIY   63 (64)
T ss_dssp             CSBCTTTCCBCTTTCEEECC
T ss_pred             CCCCCCCCccCCccceeeee
Confidence            45899999999887766654


No 166
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A
Probab=42.04  E-value=8.6  Score=18.68  Aligned_cols=16  Identities=38%  Similarity=0.748  Sum_probs=12.6

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~F~~~   25 (46)
T 2emk_A           10 EKPYECKECGKAFSQT   25 (46)
T ss_dssp             SCSCBCSSSCCBCSCH
T ss_pred             CCceECCCCCchhCCH
Confidence            4468899999999743


No 167
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=41.93  E-value=8.4  Score=18.65  Aligned_cols=16  Identities=25%  Similarity=0.611  Sum_probs=12.5

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2eq2_A           10 GKPYQCNECGKAFSQT   25 (46)
T ss_dssp             SCSSSCCSSCCCCSSH
T ss_pred             CCCeECCCCCcccCCH
Confidence            4457899999999744


No 168
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=41.69  E-value=8.7  Score=18.52  Aligned_cols=16  Identities=38%  Similarity=0.760  Sum_probs=12.6

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~~~~~C~~C~k~f~~~   25 (46)
T 2eop_A           10 EKPHECRECGKSFSFN   25 (46)
T ss_dssp             CCSCBCTTTCCBCSSH
T ss_pred             CCCeeCCCCCchhCCH
Confidence            4468899999999643


No 169
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=41.35  E-value=11  Score=18.11  Aligned_cols=16  Identities=19%  Similarity=0.401  Sum_probs=12.7

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~~~~~C~~C~k~f~~~   25 (46)
T 2ep0_A           10 EKPYKCDVCHKSFRYG   25 (46)
T ss_dssp             CCSEECSSSCCEESSH
T ss_pred             CCCeeCcccCcccCCh
Confidence            4568999999999754


No 170
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1
Probab=41.33  E-value=10  Score=20.64  Aligned_cols=18  Identities=11%  Similarity=0.194  Sum_probs=14.7

Q ss_pred             eeEeCCCCccccccCCcc
Q psy15340         55 DLECPESGRKFPISSGIP   72 (81)
Q Consensus        55 ~L~C~~c~~~ypI~dGIP   72 (81)
                      .-+|+.||..|.-..|-|
T Consensus         4 ~y~C~vCGyvyd~~~Gd~   21 (46)
T 6rxn_A            4 KYVCNVCGYEYDPAEHDN   21 (46)
T ss_dssp             CEEETTTCCEECGGGGTT
T ss_pred             EEECCCCCeEEeCCcCCC
Confidence            468999999998777754


No 171
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=41.15  E-value=8.1  Score=18.64  Aligned_cols=16  Identities=31%  Similarity=0.646  Sum_probs=12.8

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~~~~~C~~C~k~F~~~   25 (46)
T 2eoe_A           10 EKPYKCNECGKVFTQN   25 (46)
T ss_dssp             CCSSEETTTTEECSSH
T ss_pred             CCCeECCCcChhhCCH
Confidence            4568999999999754


No 172
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=41.11  E-value=11  Score=18.19  Aligned_cols=16  Identities=31%  Similarity=0.642  Sum_probs=12.5

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2ytd_A           10 EKPYKCSECGKAFHRH   25 (46)
T ss_dssp             CCSEECSSSCCEESSH
T ss_pred             CcCeECCCCCCeeCCh
Confidence            4568999999998643


No 173
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus}
Probab=41.00  E-value=14  Score=19.98  Aligned_cols=21  Identities=19%  Similarity=0.313  Sum_probs=16.3

Q ss_pred             eeEeCCCCccccccCCccccC
Q psy15340         55 DLECPESGRKFPISSGIPNML   75 (81)
Q Consensus        55 ~L~C~~c~~~ypI~dGIP~ml   75 (81)
                      ...||.|+..+.-++=.|+.+
T Consensus        51 ~~~CP~Cr~~~~~~~~~~~~l   71 (71)
T 3ng2_A           51 ANTCPTCRKKINHKRYHPIYI   71 (71)
T ss_dssp             CSBCTTTCCBCCCCSCCCCCC
T ss_pred             CCCCCCCCCccChhheeeccC
Confidence            358999999998877776653


No 174
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens}
Probab=40.95  E-value=9.2  Score=22.46  Aligned_cols=17  Identities=24%  Similarity=0.399  Sum_probs=12.7

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      ....-+|+.|++.|.-+
T Consensus        25 ~~~~h~C~~Cgk~F~~~   41 (85)
T 2lv2_A           25 SAECHLCPVCGESFASK   41 (85)
T ss_dssp             CCTTEECTTSCCEESSH
T ss_pred             CCCCEECCCCCCCcCcH
Confidence            33456899999999754


No 175
>2wx3_A MRNA-decapping enzyme 1A; structural protein, trimerization module, P-BODY component, asymmetric assembly; 2.31A {Homo sapiens}
Probab=40.23  E-value=11  Score=21.36  Aligned_cols=16  Identities=38%  Similarity=0.665  Sum_probs=12.7

Q ss_pred             ccccHHHHHHhhhhce
Q psy15340         32 YEKDSEFLKKVHHALL   47 (81)
Q Consensus        32 ~~~~e~~l~~lh~~ll   47 (81)
                      ..+|++|++.+|.+-+
T Consensus        24 IqnD~~Fl~~IHeAYl   39 (51)
T 2wx3_A           24 IKNDSSFLSTLHEVYL   39 (51)
T ss_dssp             HHHCHHHHHHHHHHHH
T ss_pred             HHcCHHHHHHHHHHHH
Confidence            3568999999998744


No 176
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=40.07  E-value=8.6  Score=18.54  Aligned_cols=16  Identities=31%  Similarity=0.615  Sum_probs=12.4

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2eq4_A           10 EKLYNCKECGKSFSRA   25 (46)
T ss_dssp             CCCCCBTTTTBCCSCH
T ss_pred             CCCeECCCCCCccCch
Confidence            4457899999999743


No 177
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=39.70  E-value=10  Score=18.25  Aligned_cols=16  Identities=25%  Similarity=0.524  Sum_probs=12.4

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus         8 ~k~~~C~~C~k~f~~~   23 (43)
T 2yrm_A            8 NGAFFCNECDCRFSEE   23 (43)
T ss_dssp             SCCBCCSSSCCCBSSH
T ss_pred             CCCEECCCCCCeeCCh
Confidence            3457899999999643


No 178
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens}
Probab=39.44  E-value=9  Score=18.53  Aligned_cols=16  Identities=25%  Similarity=0.408  Sum_probs=12.5

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~F~~~   25 (46)
T 2em0_A           10 EKTWKCRECDMCFSQA   25 (46)
T ss_dssp             CCCCCCSSSCCCCSSH
T ss_pred             CcCeECCCCCcccCCH
Confidence            4467899999999643


No 179
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=39.17  E-value=8.6  Score=18.61  Aligned_cols=16  Identities=25%  Similarity=0.455  Sum_probs=12.5

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~~~~~C~~C~k~f~~~   25 (46)
T 2eoq_A           10 EKPFKCDICGKSFCGR   25 (46)
T ss_dssp             SCSCCCSSSCCCCSSH
T ss_pred             CCCcCCCcCCchhCCH
Confidence            4468899999999643


No 180
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=38.81  E-value=9.6  Score=18.55  Aligned_cols=16  Identities=25%  Similarity=0.538  Sum_probs=12.4

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~F~~~   25 (46)
T 2eom_A           10 ERGHRCSDCGKFFLQA   25 (46)
T ss_dssp             CSSCCCSSSCCCCSSH
T ss_pred             CCCcCCCCCCCeeCCh
Confidence            4457899999999743


No 181
>2lcq_A Putative toxin VAPC6; PIN domain, Zn ribbon domain, ribosome biogenesis, metal BIN protein; NMR {Pyrococcus horikoshii}
Probab=38.43  E-value=12  Score=24.36  Aligned_cols=14  Identities=36%  Similarity=0.600  Sum_probs=12.2

Q ss_pred             eeEeCCCCcccccc
Q psy15340         55 DLECPESGRKFPIS   68 (81)
Q Consensus        55 ~L~C~~c~~~ypI~   68 (81)
                      ...|..||+.|+..
T Consensus       132 ~y~C~~Cg~~~~~~  145 (165)
T 2lcq_A          132 RYVCIGCGRKFSTL  145 (165)
T ss_dssp             CEEESSSCCEESSC
T ss_pred             EEECCCCCCcccCC
Confidence            68999999999853


No 182
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1
Probab=38.42  E-value=13  Score=18.33  Aligned_cols=16  Identities=19%  Similarity=0.395  Sum_probs=12.3

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-.
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (48)
T 2epr_A           10 RKQVACEICGKIFRDV   25 (48)
T ss_dssp             CCSEEETTTTEEESSH
T ss_pred             CcCeeCCCCCcccCCH
Confidence            4468899999998643


No 183
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A
Probab=38.28  E-value=11  Score=16.47  Aligned_cols=13  Identities=31%  Similarity=0.715  Sum_probs=9.9

Q ss_pred             eEeC--CCCcccccc
Q psy15340         56 LECP--ESGRKFPIS   68 (81)
Q Consensus        56 L~C~--~c~~~ypI~   68 (81)
                      ..|+  .||+.|.-+
T Consensus         3 ~~C~~~~C~k~f~~~   17 (31)
T 1sp2_A            3 FMCTWSYCGKRFTRS   17 (31)
T ss_dssp             CBCCSTTCCCBCSSH
T ss_pred             cCCcCCCCCcccCCH
Confidence            4687  999999754


No 184
>3flo_B DNA polymerase alpha catalytic subunit A; protein-protein complex, phosphoesterase fold, OB fold, zinc motif, DNA replication, nucleus; HET: DNA; 2.50A {Saccharomyces cerevisiae}
Probab=38.26  E-value=13  Score=26.02  Aligned_cols=17  Identities=41%  Similarity=1.109  Sum_probs=13.7

Q ss_pred             eeEeCCCCccccccCCcc
Q psy15340         55 DLECPESGRKFPISSGIP   72 (81)
Q Consensus        55 ~L~C~~c~~~ypI~dGIP   72 (81)
                      .|.||.|+..|+-. ||-
T Consensus        22 ~l~Cp~C~~~~~F~-gv~   38 (206)
T 3flo_B           22 ELSCPSCDKRFPFG-GIV   38 (206)
T ss_dssp             EEECTTTCCEEEEC-SSS
T ss_pred             EEECCCCCCccCCC-Ccc
Confidence            78999999999865 553


No 185
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=38.25  E-value=7.4  Score=18.80  Aligned_cols=16  Identities=31%  Similarity=0.692  Sum_probs=12.4

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2ytr_A           10 EKPYKCNECGKAFSQT   25 (46)
T ss_dssp             CCTTCCTTTCCCCSSH
T ss_pred             CcCcCCCCCCCccCCH
Confidence            4457899999999754


No 186
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=38.19  E-value=9.6  Score=18.48  Aligned_cols=16  Identities=31%  Similarity=0.650  Sum_probs=12.5

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2ytq_A           10 EKPYGCSECGKAFSSK   25 (46)
T ss_dssp             CCSCBCSSSCCBCSCH
T ss_pred             CCCcCCCccChhhCCh
Confidence            4457899999999754


No 187
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1
Probab=38.13  E-value=13  Score=19.68  Aligned_cols=17  Identities=24%  Similarity=0.344  Sum_probs=13.2

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-+
T Consensus        46 ~~~~~~C~~C~~~f~~~   62 (73)
T 1f2i_G           46 GQKPFQCRICMRNFSRS   62 (73)
T ss_dssp             CCCCEECTTTCCEESCH
T ss_pred             CCCCeECCCCCchhCCH
Confidence            34568999999999754


No 188
>1wii_A Hypothetical UPF0222 protein MGC4549; domain of unknown function, zinc finger, metal-binding protein, structural genomics; NMR {Mus musculus} SCOP: g.41.3.4
Probab=38.07  E-value=13  Score=22.79  Aligned_cols=16  Identities=19%  Similarity=0.368  Sum_probs=13.9

Q ss_pred             ccceeEeCCCCccccc
Q psy15340         52 VEGDLECPESGRKFPI   67 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI   67 (81)
                      .-|.+.|..||..|..
T Consensus        44 ~~g~l~C~~Cg~~~~~   59 (85)
T 1wii_A           44 NTGVISCTVCLEEFQT   59 (85)
T ss_dssp             TEEEEEESSSCCEEEE
T ss_pred             CEEEEEcccCCCeEEe
Confidence            3589999999999976


No 189
>2o03_A Probable zinc uptake regulation protein FURB; DNA-binding, helix-turn-helix, zinc binding, GE regulation; 2.70A {Mycobacterium tuberculosis}
Probab=37.64  E-value=13  Score=23.16  Aligned_cols=16  Identities=19%  Similarity=0.480  Sum_probs=13.6

Q ss_pred             ceeEeCCCCccccccC
Q psy15340         54 GDLECPESGRKFPISS   69 (81)
Q Consensus        54 g~L~C~~c~~~ypI~d   69 (81)
                      .-|+|..||+.+.+.+
T Consensus        82 ~HliC~~Cg~v~~~~~   97 (131)
T 2o03_A           82 HHLVCRSCGSTIEVGD   97 (131)
T ss_dssp             EEEEETTTCCEEEECC
T ss_pred             CEEEeCCCCCEEEECC
Confidence            4699999999999864


No 190
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens}
Probab=37.64  E-value=14  Score=18.47  Aligned_cols=17  Identities=12%  Similarity=0.098  Sum_probs=13.2

Q ss_pred             cceeEeCCCCccccccC
Q psy15340         53 EGDLECPESGRKFPISS   69 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~d   69 (81)
                      +....|+.|++.|.-..
T Consensus        30 ~~~~~C~~C~~~f~~~~   46 (57)
T 3uk3_C           30 EKPYKCEFCEYAAAQKT   46 (57)
T ss_dssp             CCCEECSSSSCEESSHH
T ss_pred             CCCcCCCCCcchhCCHH
Confidence            45689999999997543


No 191
>2wx4_A DCP1, decapping protein 1; asymmetric assembly, trimerization module, mRNA decapping, P-BODY component, structural protein; 2.80A {Drosophila melanogaster}
Probab=37.49  E-value=8  Score=21.47  Aligned_cols=16  Identities=44%  Similarity=0.758  Sum_probs=12.5

Q ss_pred             cccHHHHHHhhhhcee
Q psy15340         33 EKDSEFLKKVHHALLE   48 (81)
Q Consensus        33 ~~~e~~l~~lh~~ll~   48 (81)
                      .+|++|++.+|.+-+.
T Consensus        23 knD~~Fl~~iHeAYl~   38 (46)
T 2wx4_A           23 QNDKEFANKLHKAYLN   38 (46)
T ss_dssp             HHCTTHHHHHHHHHHC
T ss_pred             HcCHHHHHHHHHHHHH
Confidence            4578899999998543


No 192
>2v3b_B Rubredoxin 2, rubredoxin; alkane degradation, iron-sulfur protein, oxidoreductase, ELE transfer, electron transport, FAD, NAD, iron; HET: FAD; 2.45A {Pseudomonas aeruginosa}
Probab=37.10  E-value=21  Score=19.94  Aligned_cols=18  Identities=22%  Similarity=0.527  Sum_probs=13.5

Q ss_pred             eeEeCCCCccccccCCcc
Q psy15340         55 DLECPESGRKFPISSGIP   72 (81)
Q Consensus        55 ~L~C~~c~~~ypI~dGIP   72 (81)
                      .-+|+.||..|.=..|-|
T Consensus         3 ~y~C~~CGyvYd~~~Gdp   20 (55)
T 2v3b_B            3 KWQCVVCGFIYDEALGLP   20 (55)
T ss_dssp             EEEETTTCCEEETTTCBT
T ss_pred             cEEeCCCCeEECCCcCCc
Confidence            468999999997665544


No 193
>2qpz_A Naphthalene 1,2-dioxygenase system ferredoxin subunit; rieske ferredoxin, 2Fe-2S, aromatic hydrocarbons catabolism, electron transport, iron; 1.85A {Pseudomonas putida}
Probab=37.06  E-value=18  Score=21.29  Aligned_cols=24  Identities=21%  Similarity=0.475  Sum_probs=19.7

Q ss_pred             eeccceeEeCCCCccccccCCccc
Q psy15340         50 EVVEGDLECPESGRKFPISSGIPN   73 (81)
Q Consensus        50 ~v~eg~L~C~~c~~~ypI~dGIP~   73 (81)
                      .+.++.++||--|-.|.+++|-..
T Consensus        55 ~~~~~~i~Cp~Hg~~Fd~~~G~~~   78 (103)
T 2qpz_A           55 YLEGREIECPLHQGRFDVCTGKAL   78 (103)
T ss_dssp             EEETTEEECTTTTCEEETTTCCEE
T ss_pred             eEeCCEEECCCCCCEEeCCCCCEe
Confidence            345678999999999999999654


No 194
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=36.18  E-value=14  Score=19.95  Aligned_cols=12  Identities=25%  Similarity=0.459  Sum_probs=5.8

Q ss_pred             eeEeCCCCcccc
Q psy15340         55 DLECPESGRKFP   66 (81)
Q Consensus        55 ~L~C~~c~~~yp   66 (81)
                      ...|+.|++.|.
T Consensus        15 ~~~C~~C~k~f~   26 (77)
T 2ct1_A           15 PYECYICHARFT   26 (77)
T ss_dssp             SEECTTTCCEES
T ss_pred             CeECCCcCchhC
Confidence            344555555543


No 195
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A
Probab=36.04  E-value=15  Score=18.35  Aligned_cols=16  Identities=13%  Similarity=0.189  Sum_probs=12.9

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-.
T Consensus        27 ~~~~~C~~C~~~f~~~   42 (57)
T 1bbo_A           27 VRPYHCTYCNFSFKTK   42 (57)
T ss_dssp             CCCEECSSSSCEESSH
T ss_pred             CCCccCCCCCchhcCH
Confidence            4568999999999654


No 196
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=35.89  E-value=9.5  Score=18.56  Aligned_cols=16  Identities=31%  Similarity=0.567  Sum_probs=12.2

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2ytm_A           10 EKPYKCMECGKAFGDN   25 (46)
T ss_dssp             CCSSSBTTTTBCCSSH
T ss_pred             CCCcCCCCCCchhCCH
Confidence            3457899999999643


No 197
>1yk4_A Rubredoxin, RD; electron transport; 0.69A {Pyrococcus abyssi} PDB: 2pya_A 1yk5_A 1bq8_A 1bq9_A* 3kyu_A 3kyv_A 3kyw_A 3kyx_A 3kyy_A 3ryg_A 3rz6_A 3rzt_A 3ss2_A 1brf_A 1caa_A 1cad_A 1vcx_A 1zrp_A 1iu5_A 1iu6_A ...
Probab=35.68  E-value=22  Score=19.61  Aligned_cols=18  Identities=28%  Similarity=0.528  Sum_probs=13.6

Q ss_pred             eeEeCCCCccccccCCcc
Q psy15340         55 DLECPESGRKFPISSGIP   72 (81)
Q Consensus        55 ~L~C~~c~~~ypI~dGIP   72 (81)
                      ..+|..||..|.=..|-|
T Consensus         2 ~~~C~~CGyvYd~~~Gdp   19 (52)
T 1yk4_A            2 KLSCKICGYIYDEDEGDP   19 (52)
T ss_dssp             EEEESSSSCEEETTTCBG
T ss_pred             cEEeCCCCeEECCCcCCc
Confidence            468999999997665544


No 198
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1
Probab=35.26  E-value=12  Score=18.00  Aligned_cols=16  Identities=31%  Similarity=0.636  Sum_probs=12.2

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus         8 ~k~~~C~~C~k~f~~~   23 (45)
T 2epq_A            8 EKPYSCPVCGLRFKRK   23 (45)
T ss_dssp             CCSSEETTTTEECSCH
T ss_pred             CCCCcCCCCCcccCCH
Confidence            3457899999999643


No 199
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1
Probab=35.10  E-value=16  Score=18.51  Aligned_cols=17  Identities=24%  Similarity=0.358  Sum_probs=13.3

Q ss_pred             cceeEeCCCCccccccC
Q psy15340         53 EGDLECPESGRKFPISS   69 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~d   69 (81)
                      +....|+.|++.|.-+.
T Consensus        28 ~~~~~C~~C~~~f~~~~   44 (60)
T 2adr_A           28 EKPYPCGLCNRAFTRRD   44 (60)
T ss_dssp             SCSEECTTTCCEESSHH
T ss_pred             CCCccCCCCCCccCCHH
Confidence            45689999999997543


No 200
>1gh9_A 8.3 kDa protein (gene MTH1184); beta+alpha complex structure, structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: g.41.6.1
Probab=35.07  E-value=15  Score=21.75  Aligned_cols=13  Identities=23%  Similarity=0.547  Sum_probs=6.2

Q ss_pred             eEeCCCCccccccC
Q psy15340         56 LECPESGRKFPISS   69 (81)
Q Consensus        56 L~C~~c~~~ypI~d   69 (81)
                      +.|| ||+.+-+++
T Consensus         5 v~C~-C~~~~~~~~   17 (71)
T 1gh9_A            5 FRCD-CGRALYSRE   17 (71)
T ss_dssp             EEET-TSCCEEEET
T ss_pred             EECC-CCCEEEEcC
Confidence            3455 555544443


No 201
>3h0g_I DNA-directed RNA polymerases I, II, and III subunit rpabc5; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe}
Probab=34.94  E-value=22  Score=22.19  Aligned_cols=16  Identities=13%  Similarity=0.198  Sum_probs=14.7

Q ss_pred             eeEeCCCCccccccCC
Q psy15340         55 DLECPESGRKFPISSG   70 (81)
Q Consensus        55 ~L~C~~c~~~ypI~dG   70 (81)
                      .++|+.|+..++|.+.
T Consensus        26 ~~~C~~C~y~~~~~~~   41 (113)
T 3h0g_I           26 RLACRNCDYSEIAATS   41 (113)
T ss_dssp             CEECSSSCCEECCSCS
T ss_pred             EEECCCCCCeEEcCCC
Confidence            7999999999999876


No 202
>1e8j_A Rubredoxin; iron-sulfur-protein, zinc-substitution, thermostability; NMR {Desulfovibrio gigas} SCOP: g.41.5.1 PDB: 1rdg_A 2dsx_A 1spw_A
Probab=34.43  E-value=23  Score=19.53  Aligned_cols=18  Identities=22%  Similarity=0.436  Sum_probs=13.5

Q ss_pred             eeEeCCCCccccccCCcc
Q psy15340         55 DLECPESGRKFPISSGIP   72 (81)
Q Consensus        55 ~L~C~~c~~~ypI~dGIP   72 (81)
                      .-+|+.||..|.=..|-|
T Consensus         3 ~y~C~~CGyvYd~~~Gdp   20 (52)
T 1e8j_A            3 IYVCTVCGYEYDPAKGDP   20 (52)
T ss_dssp             CEECSSSCCCCCTTTCCT
T ss_pred             cEEeCCCCeEEcCCcCCc
Confidence            468999999997655544


No 203
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori}
Probab=34.14  E-value=15  Score=25.75  Aligned_cols=13  Identities=31%  Similarity=0.685  Sum_probs=10.5

Q ss_pred             cceeEeCCCCccc
Q psy15340         53 EGDLECPESGRKF   65 (81)
Q Consensus        53 eg~L~C~~c~~~y   65 (81)
                      ++-.+||.|||.-
T Consensus       220 ~~Iv~Cp~CgRIL  232 (256)
T 3na7_A          220 GDMITCPYCGRIL  232 (256)
T ss_dssp             SSCEECTTTCCEE
T ss_pred             CCEEECCCCCeeE
Confidence            4569999999853


No 204
>3gce_A Ferredoxin component of carbazole 1,9A- dioxygenase; rieske ferredoxin, 2Fe-2S, electron transfer, oxidoreductase; 2.00A {Nocardioides aromaticivorans}
Probab=34.05  E-value=22  Score=21.83  Aligned_cols=26  Identities=27%  Similarity=0.589  Sum_probs=20.6

Q ss_pred             eeccceeEeCCCCccccccCCccccC
Q psy15340         50 EVVEGDLECPESGRKFPISSGIPNML   75 (81)
Q Consensus        50 ~v~eg~L~C~~c~~~ypI~dGIP~ml   75 (81)
                      .+.++.++||--|-.|-+++|-..-.
T Consensus        64 ~~~~~~i~CP~Hg~~Fdl~tG~~~~~   89 (121)
T 3gce_A           64 HAESLEIECPLHVGRFDVRTGAPTAL   89 (121)
T ss_dssp             ETTTTEEECTTTCCEEETTTCCEEET
T ss_pred             eecCCEEEcCCCCCEEcCCCccEeCC
Confidence            44577899999999999999865433


No 205
>2nn6_I 3'-5' exoribonuclease CSL4 homolog; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: b.40.4.5 b.84.4.2
Probab=34.04  E-value=17  Score=25.06  Aligned_cols=15  Identities=20%  Similarity=0.348  Sum_probs=12.1

Q ss_pred             ccceeEeCCCCcccc
Q psy15340         52 VEGDLECPESGRKFP   66 (81)
Q Consensus        52 ~eg~L~C~~c~~~yp   66 (81)
                      .+.+|.||.||+..+
T Consensus       182 ~~~~m~cp~cg~~E~  196 (209)
T 2nn6_I          182 SWCEMQCPKTHTKEF  196 (209)
T ss_dssp             ETTEEECTTTTCCBC
T ss_pred             cCCEEECCCCCCEEe
Confidence            358999999998764


No 206
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=33.79  E-value=14  Score=17.87  Aligned_cols=16  Identities=38%  Similarity=0.700  Sum_probs=12.3

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2ytt_A           10 EKPYQCSECGKSFSGS   25 (46)
T ss_dssp             CCTTCCSSSCCCCSSH
T ss_pred             CCCeeCCCCCcccCCH
Confidence            3457899999999743


No 207
>1s5p_A NAD-dependent deacetylase; protein deacetylase, SIR2 homologue, hydrolase; HET: ALY; 1.96A {Escherichia coli} SCOP: c.31.1.5
Probab=33.38  E-value=21  Score=24.73  Aligned_cols=26  Identities=12%  Similarity=0.311  Sum_probs=18.6

Q ss_pred             ceeeeeccceeEeCCCCccccccCCc
Q psy15340         46 LLEVEVVEGDLECPESGRKFPISSGI   71 (81)
Q Consensus        46 ll~~~v~eg~L~C~~c~~~ypI~dGI   71 (81)
                      +++.+-.-..+.|..|++.|+..+-+
T Consensus       104 v~elHG~~~~~~C~~C~~~~~~~~~~  129 (235)
T 1s5p_A          104 VIHMHGELLKVRCSQSGQVLDWTGDV  129 (235)
T ss_dssp             CEETTEEEEEEEETTTCCEEECCSCC
T ss_pred             EEEecCCceEEEeCCCCCcccchhhc
Confidence            44444455678999999999976533


No 208
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=33.20  E-value=18  Score=19.21  Aligned_cols=15  Identities=33%  Similarity=0.629  Sum_probs=10.5

Q ss_pred             cceeEeCCCCccccc
Q psy15340         53 EGDLECPESGRKFPI   67 (81)
Q Consensus        53 eg~L~C~~c~~~ypI   67 (81)
                      +....|+.|++.|.-
T Consensus        12 ~k~~~C~~C~k~f~~   26 (72)
T 1x6e_A           12 EKPYGCVECGKAFSR   26 (72)
T ss_dssp             CCCEECSSSCCEESS
T ss_pred             CCCccCCCCCCccCC
Confidence            345778888887754


No 209
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=33.20  E-value=17  Score=19.13  Aligned_cols=13  Identities=15%  Similarity=0.253  Sum_probs=8.1

Q ss_pred             eeEeCCCCccccc
Q psy15340         55 DLECPESGRKFPI   67 (81)
Q Consensus        55 ~L~C~~c~~~ypI   67 (81)
                      ...|+.|++.|.-
T Consensus         9 ~~~C~~C~k~f~~   21 (70)
T 1x5w_A            9 PEKCSECSYSCSS   21 (70)
T ss_dssp             SEECSSSSCEESS
T ss_pred             CeECCCCCcccCC
Confidence            4566777766653


No 210
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1
Probab=33.09  E-value=11  Score=20.15  Aligned_cols=19  Identities=21%  Similarity=0.735  Sum_probs=15.0

Q ss_pred             ceeEeCCCCccccccCCcc
Q psy15340         54 GDLECPESGRKFPISSGIP   72 (81)
Q Consensus        54 g~L~C~~c~~~ypI~dGIP   72 (81)
                      ....||.|+..+.+.++-.
T Consensus        36 ~~~~CP~Cr~~~~~~~~~~   54 (56)
T 1bor_A           36 SGMQCPICQAPWPLGADTP   54 (56)
T ss_dssp             SSSSCSSCCSSSSCCSSCC
T ss_pred             CCCCCCcCCcEeecCCcCc
Confidence            5778999999998876543


No 211
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1
Probab=32.98  E-value=18  Score=19.94  Aligned_cols=13  Identities=23%  Similarity=0.616  Sum_probs=7.8

Q ss_pred             ceeEeCCCCcccc
Q psy15340         54 GDLECPESGRKFP   66 (81)
Q Consensus        54 g~L~C~~c~~~yp   66 (81)
                      ....|+.|++.|.
T Consensus         6 ~~~~C~~C~~~f~   18 (95)
T 2yt9_A            6 SGVACEICGKIFR   18 (95)
T ss_dssp             SCEECSSSCCEES
T ss_pred             CCeECCCCCCccC
Confidence            3456666666664


No 212
>3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe}
Probab=32.83  E-value=15  Score=21.32  Aligned_cols=23  Identities=17%  Similarity=0.361  Sum_probs=14.8

Q ss_pred             cceeEeCCCCccccccCCccccC
Q psy15340         53 EGDLECPESGRKFPISSGIPNML   75 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~dGIP~ml   75 (81)
                      ...+.|+.||.+.-.+.--+.|+
T Consensus        36 ~~~iRC~~CG~RILyK~Rt~r~~   58 (63)
T 3h0g_L           36 KEVIRCRECGHRVMYKMRTKRMV   58 (63)
T ss_dssp             SSCCCCSSSCCCCCBCCCCCCCE
T ss_pred             CCceECCCCCcEEEEEecCCceE
Confidence            35677777777766665555554


No 213
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=32.80  E-value=18  Score=19.42  Aligned_cols=12  Identities=25%  Similarity=0.445  Sum_probs=6.3

Q ss_pred             eeEeCCCCcccc
Q psy15340         55 DLECPESGRKFP   66 (81)
Q Consensus        55 ~L~C~~c~~~yp   66 (81)
                      ...|+.|++.|.
T Consensus         7 ~~~C~~C~k~f~   18 (78)
T 2d9h_A            7 GLQCEICGFTCR   18 (78)
T ss_dssp             CEECSSSCCEES
T ss_pred             CeECCCCCCeeC
Confidence            345555555553


No 214
>2i7f_A Ferredoxin component of dioxygenase; rieske ferredoxin, oxidoreductase; HET: CIT; 1.90A {Sphingobium yanoikuyae}
Probab=32.59  E-value=23  Score=21.05  Aligned_cols=24  Identities=29%  Similarity=0.475  Sum_probs=19.5

Q ss_pred             eeccceeEeCCCCccccccCCccc
Q psy15340         50 EVVEGDLECPESGRKFPISSGIPN   73 (81)
Q Consensus        50 ~v~eg~L~C~~c~~~ypI~dGIP~   73 (81)
                      .+.++.++||--|-.|-+++|-..
T Consensus        56 ~~~~~~i~Cp~Hg~~Fdl~tG~~~   79 (108)
T 2i7f_A           56 YQDGTIIECPFHGGSFDIATGAAK   79 (108)
T ss_dssp             EEETTEEECSSTTCEEETTTCCBC
T ss_pred             EEeCCEEEcCCCCCEEeCCCcCEe
Confidence            345678999999999999888654


No 215
>1dx8_A Rubredoxin; electron transport, zinc-substitution; NMR {Guillardia theta} SCOP: g.41.5.1 PDB: 1h7v_A
Probab=32.57  E-value=27  Score=20.40  Aligned_cols=19  Identities=26%  Similarity=0.510  Sum_probs=13.3

Q ss_pred             ceeEeCCCCccccccCCcc
Q psy15340         54 GDLECPESGRKFPISSGIP   72 (81)
Q Consensus        54 g~L~C~~c~~~ypI~dGIP   72 (81)
                      ..-+|+.||..|.=..|-|
T Consensus         6 ~~y~C~vCGyiYd~~~Gdp   24 (70)
T 1dx8_A            6 GKYECEACGYIYEPEKGDK   24 (70)
T ss_dssp             SCEEETTTCCEECTTTCCT
T ss_pred             ceEEeCCCCEEEcCCCCCc
Confidence            4678888888887555443


No 216
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1
Probab=32.23  E-value=20  Score=18.13  Aligned_cols=15  Identities=20%  Similarity=0.434  Sum_probs=11.0

Q ss_pred             cceeEeCCCCccccc
Q psy15340         53 EGDLECPESGRKFPI   67 (81)
Q Consensus        53 eg~L~C~~c~~~ypI   67 (81)
                      +....|+.|++.|.-
T Consensus        10 ~k~~~C~~C~k~f~~   24 (54)
T 2eps_A           10 GKPYICQSCGKGFSR   24 (54)
T ss_dssp             SCCEECSSSCCEESS
T ss_pred             CCCeECCCCCcccCC
Confidence            445788888888854


No 217
>2kn9_A Rubredoxin; metalloprotein, ssgcid, structural genomics, seattle structural genomics center for infectious electron transport, iron; NMR {Mycobacterium tuberculosis}
Probab=32.08  E-value=26  Score=21.24  Aligned_cols=19  Identities=21%  Similarity=0.452  Sum_probs=14.8

Q ss_pred             ceeEeCCCCccccccCCcc
Q psy15340         54 GDLECPESGRKFPISSGIP   72 (81)
Q Consensus        54 g~L~C~~c~~~ypI~dGIP   72 (81)
                      ...+|+.||..|.=..|-|
T Consensus        26 ~~y~C~vCGyvYD~~~Gdp   44 (81)
T 2kn9_A           26 KLFRCIQCGFEYDEALGWP   44 (81)
T ss_dssp             CEEEETTTCCEEETTTCBT
T ss_pred             ceEEeCCCCEEEcCCcCCc
Confidence            4789999999998655443


No 218
>1qyp_A RNA polymerase II; transcription, RPB9, Zn ribbon, hyperthermophilic, extremophIle; NMR {Thermococcus celer} SCOP: g.41.3.1
Probab=32.01  E-value=21  Score=19.48  Aligned_cols=13  Identities=15%  Similarity=0.457  Sum_probs=9.6

Q ss_pred             eeEeCCCCccccc
Q psy15340         55 DLECPESGRKFPI   67 (81)
Q Consensus        55 ~L~C~~c~~~ypI   67 (81)
                      -.+|..||+.|..
T Consensus        43 fy~C~~Cg~~w~~   55 (57)
T 1qyp_A           43 FYKCTKCGHTWRS   55 (57)
T ss_dssp             EEEESSSCCEEEC
T ss_pred             EEEcCCCCCEecc
Confidence            4678888887754


No 219
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens}
Probab=31.42  E-value=15  Score=19.57  Aligned_cols=15  Identities=13%  Similarity=0.386  Sum_probs=10.5

Q ss_pred             cceeEeCCCCccccc
Q psy15340         53 EGDLECPESGRKFPI   67 (81)
Q Consensus        53 eg~L~C~~c~~~ypI   67 (81)
                      +....|+.|++.|.-
T Consensus        15 ~~~~~C~~C~k~f~~   29 (74)
T 2lce_A           15 DKPYKCDRCQASFRY   29 (74)
T ss_dssp             CCSBCCTTSSCCBSC
T ss_pred             CCCeECCCCCceeCC
Confidence            345678888888764


No 220
>4rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.20A {Clostridium pasteurianum} SCOP: g.41.5.1 PDB: 5rxn_A 1bfy_A 1fhh_A 1fhm_A 1irn_A 1iro_A 1r0f_A 1r0g_A 1r0h_A 1r0i_A 1r0j_A 1t9q_A 1c09_A 1b2j_A 1b13_A 1smm_A 1smu_A 1smw_A 1be7_A 1t9o_A ...
Probab=31.37  E-value=27  Score=19.51  Aligned_cols=18  Identities=22%  Similarity=0.479  Sum_probs=13.1

Q ss_pred             eeEeCCCCccccccCCcc
Q psy15340         55 DLECPESGRKFPISSGIP   72 (81)
Q Consensus        55 ~L~C~~c~~~ypI~dGIP   72 (81)
                      ..+|+.||..|.=..|-|
T Consensus         3 ~y~C~vCGyvYd~~~Gdp   20 (54)
T 4rxn_A            3 KYTCTVCGYIYDPEDGDP   20 (54)
T ss_dssp             CEEETTTCCEECTTTCBG
T ss_pred             ceECCCCCeEECCCcCCc
Confidence            468999999997655533


No 221
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=31.22  E-value=28  Score=17.92  Aligned_cols=20  Identities=20%  Similarity=0.326  Sum_probs=14.7

Q ss_pred             ccceeEeCCCCccccccCCc
Q psy15340         52 VEGDLECPESGRKFPISSGI   71 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~dGI   71 (81)
                      .+....|+.|++.|.-+...
T Consensus        15 ~~~~~~C~~C~k~f~~~~~l   34 (73)
T 2ctu_A           15 GDRSQKCSKCGIIFIRRSTL   34 (73)
T ss_dssp             CCSEEECSSSCCEEECCCCC
T ss_pred             CCCCeeCCcccchhCCHHHh
Confidence            34568999999999765543


No 222
>1k81_A EIF-2-beta, probable translation initiation factor 2 beta subunit; zinc ribbon; NMR {Methanocaldococcus jannaschii} SCOP: g.59.1.1
Probab=31.19  E-value=15  Score=18.85  Aligned_cols=14  Identities=36%  Similarity=0.536  Sum_probs=12.1

Q ss_pred             eeEeCCCCcccccc
Q psy15340         55 DLECPESGRKFPIS   68 (81)
Q Consensus        55 ~L~C~~c~~~ypI~   68 (81)
                      .|.|..||...+|+
T Consensus        21 ~l~C~aCG~~~~v~   34 (36)
T 1k81_A           21 LLKCMACGAIRPIR   34 (36)
T ss_dssp             EEEEETTTEEEEEC
T ss_pred             EEEhhcCCCccccc
Confidence            68899999999884


No 223
>3qxb_A Putative xylose isomerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 1.90A {Rhodospirillum rubrum}
Probab=31.16  E-value=72  Score=21.81  Aligned_cols=17  Identities=0%  Similarity=-0.361  Sum_probs=15.3

Q ss_pred             cccHHHHHHHHHHhCCC
Q psy15340          4 KLDWSAFYKATLMLGDA   20 (81)
Q Consensus         4 kldw~al~~aa~~lg~~   20 (81)
                      .+||..+.++.++.|+.
T Consensus       263 ~id~~~i~~~L~~~gy~  279 (316)
T 3qxb_A          263 VVTPQRLQDFWDKYALT  279 (316)
T ss_dssp             SCCHHHHHHHHHHTTCS
T ss_pred             eECHHHHHHHHHHcCCC
Confidence            58999999999999973


No 224
>3m7n_A Putative uncharacterized protein AF_0206; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 2ba1_A 3m85_A
Probab=30.60  E-value=20  Score=23.95  Aligned_cols=15  Identities=40%  Similarity=0.594  Sum_probs=11.9

Q ss_pred             ccceeEeCCCCcccc
Q psy15340         52 VEGDLECPESGRKFP   66 (81)
Q Consensus        52 ~eg~L~C~~c~~~yp   66 (81)
                      .+.+|.||.||..-+
T Consensus       153 ~~~~~~cp~~g~~e~  167 (179)
T 3m7n_A          153 EGDILKCPECGRVEK  167 (179)
T ss_dssp             CSSSEECSSSCCEEC
T ss_pred             CCCEEECCCCCCEEE
Confidence            448999999998654


No 225
>2de6_D Ferredoxin component of carbazole; electron transfer complex, rieske non-heme iron oxygenase system, terminal oxygenase; 1.80A {Pseudomonas resinovorans} PDB: 2de5_D 1vck_A 2de7_D*
Probab=30.57  E-value=26  Score=21.25  Aligned_cols=24  Identities=29%  Similarity=0.681  Sum_probs=19.5

Q ss_pred             eeccceeEeCCCCccccccCCccc
Q psy15340         50 EVVEGDLECPESGRKFPISSGIPN   73 (81)
Q Consensus        50 ~v~eg~L~C~~c~~~ypI~dGIP~   73 (81)
                      .+.++.++||--|-.|-+++|-..
T Consensus        57 ~~~~~~i~CP~Hg~~Fdl~tG~~~   80 (115)
T 2de6_D           57 TLDGDVIECPFHGGAFNVCTGMPA   80 (115)
T ss_dssp             EEETTEEECTTTCCEEETTTCCEE
T ss_pred             EEeCCEEECCCCCCEEcCCCcCEe
Confidence            345678999999999999988654


No 226
>1b0n_B Protein (SINI protein); transcription regulator, antagonist, sporulation; 1.90A {Bacillus subtilis} SCOP: a.34.1.1
Probab=30.42  E-value=28  Score=19.72  Aligned_cols=16  Identities=6%  Similarity=0.156  Sum_probs=14.3

Q ss_pred             ccHHHHHHHHHHhCCC
Q psy15340          5 LDWSAFYKATLMLGDA   20 (81)
Q Consensus         5 ldw~al~~aa~~lg~~   20 (81)
                      ++|=.|...|+++|++
T Consensus        13 ~ewl~LI~~Ak~lGls   28 (57)
T 1b0n_B           13 QEWVELMVEAKEANIS   28 (57)
T ss_dssp             HHHHHHHHHHHHTTCC
T ss_pred             HHHHHHHHHHHHcCCC
Confidence            5799999999999983


No 227
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=30.36  E-value=20  Score=20.87  Aligned_cols=14  Identities=21%  Similarity=0.430  Sum_probs=12.2

Q ss_pred             ccceeEeCCCCccc
Q psy15340         52 VEGDLECPESGRKF   65 (81)
Q Consensus        52 ~eg~L~C~~c~~~y   65 (81)
                      .+....|+.|++.|
T Consensus        31 ~~~~~~C~~C~k~F   44 (96)
T 2ctd_A           31 DKGSVSCPTCQAVG   44 (96)
T ss_dssp             HTSCEECTTTCSCE
T ss_pred             CCCCcCCCCCCCCc
Confidence            46678999999999


No 228
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=30.33  E-value=15  Score=21.06  Aligned_cols=15  Identities=20%  Similarity=0.388  Sum_probs=12.6

Q ss_pred             ccceeEeCCCCcccc
Q psy15340         52 VEGDLECPESGRKFP   66 (81)
Q Consensus        52 ~eg~L~C~~c~~~yp   66 (81)
                      .+....|+.|++.|.
T Consensus        21 ~~~~~~C~~C~k~f~   35 (98)
T 2gqj_A           21 ERGEAVCPTCNVVTR   35 (98)
T ss_dssp             TTSCCCCTTTCCCCS
T ss_pred             cCCCcCCCCCCCChh
Confidence            356789999999997


No 229
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus}
Probab=30.00  E-value=21  Score=18.91  Aligned_cols=16  Identities=31%  Similarity=0.567  Sum_probs=11.8

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        55 ~~~~~C~~C~~~f~~~   70 (82)
T 2kmk_A           55 EKPHKCQVCGKAFSQS   70 (82)
T ss_dssp             CCCEECTTTSCEESSH
T ss_pred             CCCCcCCCcchhhCCh
Confidence            4568899998888643


No 230
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4
Probab=29.40  E-value=16  Score=23.72  Aligned_cols=16  Identities=25%  Similarity=0.252  Sum_probs=13.5

Q ss_pred             eccceeEeCCCCcccc
Q psy15340         51 VVEGDLECPESGRKFP   66 (81)
Q Consensus        51 v~eg~L~C~~c~~~yp   66 (81)
                      .-++.+.|..|++.|-
T Consensus        46 tGekpfyC~~C~K~F~   61 (124)
T 1zr9_A           46 PGGGLHRCLACARYFI   61 (124)
T ss_dssp             GGGGCSEETTTTEECS
T ss_pred             CCCcceEcccCcchhC
Confidence            3467999999999995


No 231
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1
Probab=29.30  E-value=18  Score=15.67  Aligned_cols=13  Identities=15%  Similarity=0.422  Sum_probs=10.1

Q ss_pred             eEeC--CCCcccccc
Q psy15340         56 LECP--ESGRKFPIS   68 (81)
Q Consensus        56 L~C~--~c~~~ypI~   68 (81)
                      ..|+  .|++.|.-.
T Consensus         4 ~~C~~~~C~k~f~~~   18 (32)
T 1zfd_A            4 YSCDHPGCDKAFVRN   18 (32)
T ss_dssp             BCCCCTTCCCCBSSS
T ss_pred             CcCcCCCCCCccCCH
Confidence            5688  899999643


No 232
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A*
Probab=29.01  E-value=26  Score=21.72  Aligned_cols=17  Identities=24%  Similarity=0.405  Sum_probs=12.2

Q ss_pred             ccce--eEeCCCCcccccc
Q psy15340         52 VEGD--LECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~--L~C~~c~~~ypI~   68 (81)
                      .+|+  ..|+.|++.|.-.
T Consensus        17 h~Gek~y~C~~C~k~F~~~   35 (133)
T 2lt7_A           17 VDGRVYYICIVCKRSYVCL   35 (133)
T ss_dssp             ETTEEEEEETTTCCEESCH
T ss_pred             cCCCcCeECCCCCCCcCCH
Confidence            4454  6899999988643


No 233
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A
Probab=28.89  E-value=23  Score=19.17  Aligned_cols=17  Identities=24%  Similarity=0.458  Sum_probs=12.9

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-.
T Consensus        62 ~~~~~~C~~C~~~f~~~   78 (89)
T 2wbs_A           62 GHRPFQCQKCDRAFSRS   78 (89)
T ss_dssp             CCCCEECSSSSCEESSH
T ss_pred             CCCCccCCCCCcccCCH
Confidence            34568999999998654


No 234
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4
Probab=28.69  E-value=26  Score=20.58  Aligned_cols=11  Identities=27%  Similarity=0.718  Sum_probs=5.2

Q ss_pred             eEeCCCCcccc
Q psy15340         56 LECPESGRKFP   66 (81)
Q Consensus        56 L~C~~c~~~yp   66 (81)
                      .+|+.|++.|=
T Consensus        44 v~C~~C~~~FC   54 (86)
T 2ct7_A           44 ATCPQCHQTFC   54 (86)
T ss_dssp             EECTTTCCEEC
T ss_pred             eEeCCCCCccc
Confidence            44555554443


No 235
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=28.67  E-value=18  Score=19.47  Aligned_cols=12  Identities=17%  Similarity=0.576  Sum_probs=6.1

Q ss_pred             eeEeCCCCcccc
Q psy15340         55 DLECPESGRKFP   66 (81)
Q Consensus        55 ~L~C~~c~~~yp   66 (81)
                      ...|+.|++.|.
T Consensus        15 ~~~C~~C~~~f~   26 (86)
T 1x6h_A           15 PYACSHCDKTFR   26 (86)
T ss_dssp             CEECSSSSCEES
T ss_pred             CCcCCCCCCccC
Confidence            345555555553


No 236
>1s24_A Rubredoxin 2; electron transport; NMR {Pseudomonas oleovorans} SCOP: g.41.5.1
Probab=28.52  E-value=30  Score=21.27  Aligned_cols=20  Identities=15%  Similarity=0.119  Sum_probs=15.2

Q ss_pred             cceeEeCCCCccccccCCcc
Q psy15340         53 EGDLECPESGRKFPISSGIP   72 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~dGIP   72 (81)
                      ....+|..||..|.=..|-|
T Consensus        33 m~~y~C~vCGyvYD~~~Gdp   52 (87)
T 1s24_A           33 YLKWICITCGHIYDEALGDE   52 (87)
T ss_dssp             CCEEEETTTTEEEETTSCCT
T ss_pred             CceEECCCCCeEecCCcCCc
Confidence            35789999999998655443


No 237
>2b9d_A E7 protein; zinc finger, homodimer, transcription, viral protein; 1.60A {Human papillomavirus type 1A} SCOP: g.91.1.1
Probab=27.90  E-value=27  Score=19.41  Aligned_cols=27  Identities=19%  Similarity=0.353  Sum_probs=20.7

Q ss_pred             cccHHHHHHhhhhceeeeeccceeEeCCCCc
Q psy15340         33 EKDSEFLKKVHHALLEVEVVEGDLECPESGR   63 (81)
Q Consensus        33 ~~~e~~l~~lh~~ll~~~v~eg~L~C~~c~~   63 (81)
                      ..+++-+|.++..|++    +=.++||.|..
T Consensus        23 ~at~~~IR~lqqLLl~----~L~lvCp~Ca~   49 (52)
T 2b9d_A           23 LADHSAIRQLEEMLLR----SLNIVCPLCTL   49 (52)
T ss_dssp             EECHHHHHHHHHHHHH----TCCCCCTTTTT
T ss_pred             EeCchhHHHHHHHhhC----CceEECcchhc
Confidence            3456679999999873    44789999975


No 238
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C
Probab=27.57  E-value=25  Score=19.02  Aligned_cols=16  Identities=44%  Similarity=0.700  Sum_probs=11.8

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-+
T Consensus        60 ~~~~~C~~C~~~f~~~   75 (90)
T 1a1h_A           60 EKPFACDICGRKFARS   75 (90)
T ss_dssp             CCCEECTTTCCEESSH
T ss_pred             CCCccCCCCCchhCCH
Confidence            4458888888888643


No 239
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A
Probab=27.28  E-value=24  Score=23.56  Aligned_cols=19  Identities=21%  Similarity=0.338  Sum_probs=14.0

Q ss_pred             cceeEeCCCCccccccCCccc
Q psy15340         53 EGDLECPESGRKFPISSGIPN   73 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~dGIP~   73 (81)
                      +..-+|+.||..|.  .-.|.
T Consensus       136 ~~~~~C~~CG~i~~--~~~p~  154 (170)
T 3pwf_A          136 KKVYICPICGYTAV--DEAPE  154 (170)
T ss_dssp             SCEEECTTTCCEEE--SCCCS
T ss_pred             CCeeEeCCCCCeeC--CCCCC
Confidence            34678999999997  34554


No 240
>2l9z_A PR domain zinc finger protein 4; zinc-binding domain, transcription; NMR {Homo sapiens}
Probab=27.17  E-value=28  Score=18.59  Aligned_cols=25  Identities=16%  Similarity=0.280  Sum_probs=19.2

Q ss_pred             ceeEeCCCCcccc---ccCCccccCCCC
Q psy15340         54 GDLECPESGRKFP---ISSGIPNMLLKE   78 (81)
Q Consensus        54 g~L~C~~c~~~yp---I~dGIP~ml~~e   78 (81)
                      ..|-|..|++.|+   ...|=|.++++.
T Consensus        10 ~yl~CE~C~~~~~~~Cp~HGP~~fV~D~   37 (39)
T 2l9z_A           10 FTIWCTLCDRAYPSDCPEHGPVTFVPDT   37 (39)
T ss_dssp             CSEEEGGGTEEESSSBTTTBSCSCCCCC
T ss_pred             hhhHHHHHhhhchhhchhcCCCcccCCC
Confidence            4689999999997   457777777654


No 241
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1
Probab=27.07  E-value=23  Score=20.80  Aligned_cols=23  Identities=17%  Similarity=0.221  Sum_probs=17.2

Q ss_pred             cceeEeCCCCccccccCCccccC
Q psy15340         53 EGDLECPESGRKFPISSGIPNML   75 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~dGIP~ml   75 (81)
                      .+...||.|+..+...+=.++..
T Consensus        56 ~~~~~CP~Cr~~~~~~~~~~~~~   78 (112)
T 1jm7_A           56 KGPSQCPLCKNDITKRSLQESTR   78 (112)
T ss_dssp             SSSCCCTTTSCCCCTTTCBCCCS
T ss_pred             CCCCCCcCCCCcCCHhhcCccHH
Confidence            35578999999988776666543


No 242
>3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B* 2kz8_A
Probab=26.70  E-value=17  Score=22.17  Aligned_cols=11  Identities=27%  Similarity=0.827  Sum_probs=6.4

Q ss_pred             ceeEeCCCCcc
Q psy15340         54 GDLECPESGRK   64 (81)
Q Consensus        54 g~L~C~~c~~~   64 (81)
                      |.+.||.||..
T Consensus         1 ~~M~Cp~Cg~~   11 (133)
T 3o9x_A            1 GHMKCPVCHQG   11 (133)
T ss_dssp             -CCBCTTTSSS
T ss_pred             CCcCCCcCCCC
Confidence            45567777654


No 243
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus}
Probab=26.70  E-value=26  Score=19.02  Aligned_cols=9  Identities=22%  Similarity=0.645  Sum_probs=4.3

Q ss_pred             EeCCCCccc
Q psy15340         57 ECPESGRKF   65 (81)
Q Consensus        57 ~C~~c~~~y   65 (81)
                      .|+.||+.|
T Consensus         6 ~C~~C~k~F   14 (60)
T 4gzn_C            6 FCNFCGKTY   14 (60)
T ss_dssp             ECTTTCCEE
T ss_pred             cCCCCCCEe
Confidence            444444444


No 244
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1
Probab=26.59  E-value=19  Score=20.25  Aligned_cols=16  Identities=31%  Similarity=0.532  Sum_probs=12.1

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +.-..|..|++.|.-+
T Consensus        11 ekpy~C~~CgK~F~~~   26 (66)
T 2epp_A           11 AGILPCGLCGKVFTDA   26 (66)
T ss_dssp             CCCCCCTTTCCCCSCH
T ss_pred             ccCcCCCCCCCccCCH
Confidence            3457899999999643


No 245
>1m2k_A Silent information regulator 2; protein-ligand complex, gene regulation; HET: APR; 1.47A {Archaeoglobus fulgidus} SCOP: c.31.1.5 PDB: 1m2g_A* 1m2h_A* 1m2j_A* 1m2n_A* 1ici_A*
Probab=26.38  E-value=27  Score=24.38  Aligned_cols=26  Identities=12%  Similarity=0.302  Sum_probs=18.9

Q ss_pred             hhceeeeeccceeEeCCCCccccccC
Q psy15340         44 HALLEVEVVEGDLECPESGRKFPISS   69 (81)
Q Consensus        44 ~~ll~~~v~eg~L~C~~c~~~ypI~d   69 (81)
                      .-+++.+-.-..+.|..|++.|+..+
T Consensus       110 ~~v~elHG~~~~~~C~~C~~~~~~~~  135 (249)
T 1m2k_A          110 RNVIHLHGSLRVVRCTSCNNSFEVES  135 (249)
T ss_dssp             CSEEETTEEEEEEEESSSSCEEECSS
T ss_pred             CcEEEecCCcceeEeCCCCCcccchh
Confidence            34555555556889999999998755


No 246
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=26.12  E-value=26  Score=18.74  Aligned_cols=18  Identities=33%  Similarity=0.512  Sum_probs=13.7

Q ss_pred             ccceeEeCCCCccccccC
Q psy15340         52 VEGDLECPESGRKFPISS   69 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~d   69 (81)
                      .+....|+.|++.|.-+.
T Consensus        43 ~~~~~~C~~C~~~f~~~~   60 (77)
T 2cot_A           43 GEKPYKCDECGKAFIQRS   60 (77)
T ss_dssp             CSCSEECSSSCCEESSHH
T ss_pred             CCcCeeCCCCCCccCCHH
Confidence            345689999999997543


No 247
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=25.72  E-value=30  Score=18.89  Aligned_cols=19  Identities=11%  Similarity=0.272  Sum_probs=14.6

Q ss_pred             eeEeCCCCccccccCCccc
Q psy15340         55 DLECPESGRKFPISSGIPN   73 (81)
Q Consensus        55 ~L~C~~c~~~ypI~dGIP~   73 (81)
                      ...||.|+..+..++-+++
T Consensus        50 ~~~CP~Cr~~~~~~~~~~~   68 (72)
T 2djb_A           50 SNRCPKCNIVVHQTQPLSG   68 (72)
T ss_dssp             CSSCTTTCCCCCSSCSCCC
T ss_pred             CCcCCCcCcccCccccccc
Confidence            4679999998887776654


No 248
>2con_A RUH-035 protein, NIN one binding protein; ribosome, RNA binding protein, unknown function, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.41.15.1
Probab=25.46  E-value=20  Score=21.66  Aligned_cols=21  Identities=19%  Similarity=0.330  Sum_probs=15.0

Q ss_pred             hhceeeeeccceeEeCCCCcc
Q psy15340         44 HALLEVEVVEGDLECPESGRK   64 (81)
Q Consensus        44 ~~ll~~~v~eg~L~C~~c~~~   64 (81)
                      |+.+.+-..-...-||.||..
T Consensus        19 ~aCf~~t~~~~k~FCp~CGn~   39 (79)
T 2con_A           19 HGCFKTTSDMNRVFCGHCGNK   39 (79)
T ss_dssp             SSSCCEESCSSCCSCSSSCCS
T ss_pred             cccceECCCcccccccccCcc
Confidence            455566666678889999864


No 249
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A*
Probab=25.29  E-value=30  Score=23.17  Aligned_cols=21  Identities=24%  Similarity=0.482  Sum_probs=16.8

Q ss_pred             ccceeEeCCCCccccccCCcc
Q psy15340         52 VEGDLECPESGRKFPISSGIP   72 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~dGIP   72 (81)
                      ..|..+|+.||+.|.+...-|
T Consensus       121 l~~R~~~~~~g~~y~~~~~pp  141 (206)
T 3sr0_A          121 LSGRRINPETGEVYHVKYNPP  141 (206)
T ss_dssp             HHTEEECTTTCCEEETTTBCC
T ss_pred             HhCCccccCCCceeeeeccCC
Confidence            458899999999998865444


No 250
>3u31_A SIR2A, transcriptional regulatory protein SIR2 homologue; Zn-binding domain, rossmann fold domain; HET: MYK NAD; 2.20A {Plasmodium falciparum} PDB: 3u3d_A* 3jwp_A*
Probab=25.09  E-value=29  Score=25.15  Aligned_cols=24  Identities=4%  Similarity=0.095  Sum_probs=17.1

Q ss_pred             ceeeeeccceeEeCCCCccccccC
Q psy15340         46 LLEVEVVEGDLECPESGRKFPISS   69 (81)
Q Consensus        46 ll~~~v~eg~L~C~~c~~~ypI~d   69 (81)
                      +++.+-.=....|..|++.|+..+
T Consensus       145 vielHGs~~~~~C~~C~~~~~~~~  168 (290)
T 3u31_A          145 VISLHGNVFEAVCCTCNKIVKLNK  168 (290)
T ss_dssp             EEETTEEEEEEEETTTCCEEECCT
T ss_pred             EEEecCCcCcceeCCCCCcCChhH
Confidence            344444445789999999998765


No 251
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=24.99  E-value=33  Score=19.11  Aligned_cols=25  Identities=28%  Similarity=0.440  Sum_probs=16.2

Q ss_pred             eccceeEeCCCCccccccCCccccC
Q psy15340         51 VVEGDLECPESGRKFPISSGIPNML   75 (81)
Q Consensus        51 v~eg~L~C~~c~~~ypI~dGIP~ml   75 (81)
                      ..+..+.|+.|...|.-.+-.|.++
T Consensus        11 ~~~~~~~C~IC~~~~~~~~~~~~~~   35 (88)
T 2ct2_A           11 ALREVLECPICMESFTEEQLRPKLL   35 (88)
T ss_dssp             CCCSCCBCTTTCCBCCTTSSCEEEC
T ss_pred             hccCCCCCccCCccccccCCCeEEC
Confidence            3455677888887776655556554


No 252
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B
Probab=24.84  E-value=45  Score=19.19  Aligned_cols=17  Identities=18%  Similarity=0.552  Sum_probs=13.6

Q ss_pred             cceeEeCCCCccccccC
Q psy15340         53 EGDLECPESGRKFPISS   69 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~d   69 (81)
                      ++...||.|++.|.-++
T Consensus        48 ~~~~~CP~CR~~~~~~~   64 (78)
T 1e4u_A           48 DENGLCPACRKPYPEDP   64 (78)
T ss_dssp             SSCSBCTTTCCBCSSCS
T ss_pred             cCCCCCCCCCCccCCCc
Confidence            35689999999998654


No 253
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1
Probab=24.67  E-value=34  Score=16.67  Aligned_cols=20  Identities=20%  Similarity=0.379  Sum_probs=14.4

Q ss_pred             eeccceeEeC--CCCccccccC
Q psy15340         50 EVVEGDLECP--ESGRKFPISS   69 (81)
Q Consensus        50 ~v~eg~L~C~--~c~~~ypI~d   69 (81)
                      +-.+....|+  .|++.|.-+.
T Consensus        13 H~~~k~~~C~~~~C~k~F~~~~   34 (47)
T 1ncs_A           13 EMPDKTFECLFPGCTKTFKRRY   34 (47)
T ss_dssp             EETTTEEECCCTTCCCEECSSS
T ss_pred             cCCCCCeECCCCCCCCccCCHH
Confidence            3445678994  8999997554


No 254
>1twf_I B12.6, DNA-directed RNA polymerase II 14.2 kDa polypepti; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.3.1 g.41.3.1 PDB: 1i3q_I 1i6h_I 1k83_I* 1nik_I 1nt9_I 1pqv_I 1r5u_I 1r9s_I* 1r9t_I* 1sfo_I* 1twa_I* 1twc_I* 1i50_I* 1twg_I* 1twh_I* 1wcm_I 1y1v_I 1y1w_I 1y1y_I 1y77_I* ...
Probab=24.54  E-value=30  Score=21.86  Aligned_cols=18  Identities=17%  Similarity=0.019  Sum_probs=15.1

Q ss_pred             cceeEeCCCCccccccCC
Q psy15340         53 EGDLECPESGRKFPISSG   70 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~dG   70 (81)
                      .+.+.|+.|+..+++.+-
T Consensus        24 ~~~~~C~~C~y~~~~~~~   41 (122)
T 1twf_I           24 RLLFECRTCSYVEEAGSP   41 (122)
T ss_dssp             EEEEECSSSSCEEECSCS
T ss_pred             CCEEECCcCCCeeecCcc
Confidence            468999999999998753


No 255
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens}
Probab=24.51  E-value=34  Score=15.57  Aligned_cols=15  Identities=13%  Similarity=0.344  Sum_probs=11.2

Q ss_pred             ceeEeC--CCCcccccc
Q psy15340         54 GDLECP--ESGRKFPIS   68 (81)
Q Consensus        54 g~L~C~--~c~~~ypI~   68 (81)
                      ....|+  .|++.|.-+
T Consensus         7 k~~~C~~~~C~k~f~~~   23 (37)
T 1va1_A            7 KQHICHIQGCGKVYGKT   23 (37)
T ss_dssp             CCEECCSTTCCCEESCH
T ss_pred             CCCCCCCCCCCCccCCH
Confidence            457897  599999643


No 256
>3ttc_A HYPF, transcriptional regulatory protein; Zn finger, nucleotide binding, hydrogenase maturation factor transferase; HET: ADP; 1.86A {Escherichia coli} PDB: 3tsp_A* 3tsu_A* 3ttf_A* 3ttd_A 3tsq_A
Probab=24.44  E-value=25  Score=28.54  Aligned_cols=18  Identities=28%  Similarity=0.787  Sum_probs=16.2

Q ss_pred             eEeCCCCccccccCCccc
Q psy15340         56 LECPESGRKFPISSGIPN   73 (81)
Q Consensus        56 L~C~~c~~~ypI~dGIP~   73 (81)
                      ..|..||=+|.|..++|-
T Consensus        40 ~nCt~CGPR~tii~~lPY   57 (657)
T 3ttc_A           40 INCTHCGPRFTIIRAMPY   57 (657)
T ss_dssp             CCBTTBBCSGGGBSSSSC
T ss_pred             ccCcCCCchHHhcccCCC
Confidence            469999999999999993


No 257
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1
Probab=24.34  E-value=24  Score=19.45  Aligned_cols=13  Identities=31%  Similarity=0.726  Sum_probs=7.6

Q ss_pred             ceeEeCCCCcccc
Q psy15340         54 GDLECPESGRKFP   66 (81)
Q Consensus        54 g~L~C~~c~~~yp   66 (81)
                      +...|+.|++.|.
T Consensus         7 ~~~~C~~C~~~f~   19 (96)
T 2dmd_A            7 GPHKCEVCGKCFS   19 (96)
T ss_dssp             CCCCBTTTTBCCC
T ss_pred             cCeECCCCCCccC
Confidence            3455666666664


No 258
>1lv3_A Hypothetical protein YACG; zinc finger, rubredoxin knuckle, C4 tetrahedral Zn+2, antiparallel beta strand and alpha helix, NESG project; NMR {Escherichia coli} SCOP: g.39.1.9
Probab=24.33  E-value=30  Score=20.39  Aligned_cols=15  Identities=20%  Similarity=0.525  Sum_probs=11.8

Q ss_pred             ceeEeCCCCcccccc
Q psy15340         54 GDLECPESGRKFPIS   68 (81)
Q Consensus        54 g~L~C~~c~~~ypI~   68 (81)
                      -...||.||+.+.-+
T Consensus         8 ~~~~CP~Cgkp~~W~   22 (68)
T 1lv3_A            8 ITVNCPTCGKTVVWG   22 (68)
T ss_dssp             CEEECTTTCCEEECS
T ss_pred             CcCcCCCCCCccccc
Confidence            356899999998754


No 259
>4g9i_A Hydrogenase maturation protein HYPF; zinc finger, ATP binding, carbamoyla transferase; 4.50A {Thermococcus kodakarensis}
Probab=24.15  E-value=27  Score=28.66  Aligned_cols=18  Identities=28%  Similarity=0.750  Sum_probs=15.9

Q ss_pred             eEeCCCCccccccCCccc
Q psy15340         56 LECPESGRKFPISSGIPN   73 (81)
Q Consensus        56 L~C~~c~~~ypI~dGIP~   73 (81)
                      ..|..||=+|.|..++|-
T Consensus       129 ~nCt~CGPR~tii~~lPY  146 (772)
T 4g9i_A          129 IVCTNCGPRFTIIEDLPY  146 (772)
T ss_dssp             CCCTTSSCCGGGCCSSSC
T ss_pred             ccCCCCCchhhhhhcCCC
Confidence            469999999999999983


No 260
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A*
Probab=24.09  E-value=26  Score=24.47  Aligned_cols=14  Identities=36%  Similarity=0.721  Sum_probs=12.2

Q ss_pred             cceeEeCCCCcccc
Q psy15340         53 EGDLECPESGRKFP   66 (81)
Q Consensus        53 eg~L~C~~c~~~yp   66 (81)
                      .+.|+|..|+..|.
T Consensus       167 ~~~L~C~~C~~~f~  180 (204)
T 3sp4_A          167 QEDLKCWRCGETFG  180 (204)
T ss_dssp             GSCCBCTTTCCBCT
T ss_pred             CCCceeCCCCchhh
Confidence            78999999998773


No 261
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1
Probab=23.98  E-value=34  Score=15.41  Aligned_cols=15  Identities=20%  Similarity=0.525  Sum_probs=11.3

Q ss_pred             ceeEeC--CCCcccccc
Q psy15340         54 GDLECP--ESGRKFPIS   68 (81)
Q Consensus        54 g~L~C~--~c~~~ypI~   68 (81)
                      ....|+  .|++.|.-+
T Consensus         5 k~~~C~~~~C~k~f~~~   21 (38)
T 1bhi_A            5 KPFLCTAPGCGQRFTNE   21 (38)
T ss_dssp             CCEECCCTTTCCEESSH
T ss_pred             cceECCCCCCCcccCCH
Confidence            347898  699999644


No 262
>1vm9_A Toluene-4-monooxygenase system protein C; structural genomics, CESG, protein structure initiative, PSI, ferredoxin, FES, [2Fe-2S] cluster; 1.48A {Pseudomonas mendocina} SCOP: b.33.1.1 PDB: 2q3w_A 1sjg_A
Probab=23.84  E-value=42  Score=19.94  Aligned_cols=24  Identities=17%  Similarity=0.162  Sum_probs=18.8

Q ss_pred             eeccceeEeCCCCccccccCCccc
Q psy15340         50 EVVEGDLECPESGRKFPISSGIPN   73 (81)
Q Consensus        50 ~v~eg~L~C~~c~~~ypI~dGIP~   73 (81)
                      .+.++.++||--|-.|-++.|-..
T Consensus        55 ~~~~~~i~Cp~Hg~~Fd~~tG~~~   78 (111)
T 1vm9_A           55 SYEGGVITCRAHLWTFNDGTGHGI   78 (111)
T ss_dssp             EEETTEEECTTTCCEEETTTCBBS
T ss_pred             eEcCCEEEcCCCCCEEeCCCccCC
Confidence            345678999999999999878543


No 263
>1x4s_A Protein FON, zinc finger HIT domain containing protein 2; structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.85.1.2
Probab=23.72  E-value=26  Score=20.13  Aligned_cols=14  Identities=14%  Similarity=0.524  Sum_probs=11.3

Q ss_pred             ccceeEeCCCCccc
Q psy15340         52 VEGDLECPESGRKF   65 (81)
Q Consensus        52 ~eg~L~C~~c~~~y   65 (81)
                      ....-.||.|+..|
T Consensus        23 ~~akY~CPrC~~rY   36 (59)
T 1x4s_A           23 QPARYTCPRCNAPY   36 (59)
T ss_dssp             EEECEECTTTCCEE
T ss_pred             CCccccCcCCCCCc
Confidence            45688999999887


No 264
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3
Probab=23.55  E-value=28  Score=21.29  Aligned_cols=23  Identities=17%  Similarity=0.182  Sum_probs=19.7

Q ss_pred             eeccceeEeCCCCccccccCCcc
Q psy15340         50 EVVEGDLECPESGRKFPISSGIP   72 (81)
Q Consensus        50 ~v~eg~L~C~~c~~~ypI~dGIP   72 (81)
                      -..+|.+.|+.+...|...+||+
T Consensus        98 ~~~~~~~yC~~~~~~~~~~~g~~  120 (122)
T 1m3v_A           98 GDEDERLITRLENTQFDAANGID  120 (122)
T ss_dssp             CCTTCCCCEECTTTTTTCCSCCC
T ss_pred             EecCCEeEccCcchhchhhcCCC
Confidence            35778899999999999999986


No 265
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A
Probab=23.53  E-value=33  Score=18.80  Aligned_cols=11  Identities=45%  Similarity=0.969  Sum_probs=5.3

Q ss_pred             eEeCCCCcccc
Q psy15340         56 LECPESGRKFP   66 (81)
Q Consensus        56 L~C~~c~~~yp   66 (81)
                      ..|+.|++.|.
T Consensus        32 ~~C~~C~k~f~   42 (88)
T 1llm_C           32 FACDICGRKFA   42 (88)
T ss_dssp             EECTTTCCEES
T ss_pred             ccCCCCCCccC
Confidence            34555555543


No 266
>1fqt_A Rieske-type ferredoxin of biphenyl dioxygenase; 2Fe-2S cluster, beta sandwich, oxido; 1.60A {Burkholderia xenovorans} SCOP: b.33.1.1 PDB: 2e4q_A 2e4p_A 2yvj_B*
Probab=23.34  E-value=44  Score=19.96  Aligned_cols=23  Identities=22%  Similarity=0.307  Sum_probs=18.0

Q ss_pred             eccceeEeCCCCccccccCCccc
Q psy15340         51 VVEGDLECPESGRKFPISSGIPN   73 (81)
Q Consensus        51 v~eg~L~C~~c~~~ypI~dGIP~   73 (81)
                      +.++.++||--|-.|-+++|-..
T Consensus        59 ~~~~~i~CP~Hg~~Fd~~tG~~~   81 (112)
T 1fqt_A           59 LEGDVVECSLHMGKFCVRTGKVK   81 (112)
T ss_dssp             EETTEEECTTTCCEEETTTCCEE
T ss_pred             EcCCEEECCCCCCEEeCCCCcEe
Confidence            34568999999999999888643


No 267
>3ga8_A HTH-type transcriptional regulator MQSA (YGIT/B30; helix-turn-helix, Zn-binding protein, DNA-binding, transcrip transcription regulation; HET: PE4; 1.70A {Escherichia coli k-12} PDB: 3hi2_A
Probab=23.19  E-value=31  Score=19.78  Aligned_cols=13  Identities=15%  Similarity=0.220  Sum_probs=10.0

Q ss_pred             ceeEeCCCCcccc
Q psy15340         54 GDLECPESGRKFP   66 (81)
Q Consensus        54 g~L~C~~c~~~yp   66 (81)
                      -..+|+.||-.|-
T Consensus        35 p~~~C~~CGE~~~   47 (78)
T 3ga8_A           35 HGLYCVHCEESIM   47 (78)
T ss_dssp             EEEEETTTCCEEC
T ss_pred             eeEECCCCCCEEE
Confidence            3678999998773


No 268
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=22.89  E-value=23  Score=18.81  Aligned_cols=12  Identities=33%  Similarity=0.371  Sum_probs=7.6

Q ss_pred             ceeEeCCCCccc
Q psy15340         54 GDLECPESGRKF   65 (81)
Q Consensus        54 g~L~C~~c~~~y   65 (81)
                      ....|+.|++.|
T Consensus        67 ~~~~C~~C~k~F   78 (79)
T 2dlk_A           67 RDYICEFSGPSS   78 (79)
T ss_dssp             CCCSCCSSSCCC
T ss_pred             CCeeCCCCCCCC
Confidence            446677777666


No 269
>1l1o_C Replication protein A 70 kDa DNA-binding subunit; eukaryotic SSB, ssDNA binding protein, OB-fold; 2.80A {Homo sapiens} SCOP: b.40.4.3
Probab=22.61  E-value=42  Score=22.29  Aligned_cols=15  Identities=27%  Similarity=0.676  Sum_probs=12.2

Q ss_pred             ccceeEeCCCCcccc
Q psy15340         52 VEGDLECPESGRKFP   66 (81)
Q Consensus        52 ~eg~L~C~~c~~~yp   66 (81)
                      .+|...|+.|+..||
T Consensus        59 ~~g~~~CekC~~~~~   73 (181)
T 1l1o_C           59 QNGLYRCEKCDTEFP   73 (181)
T ss_dssp             TTTEEEETTTTEEES
T ss_pred             CCCeEECCCCCCcCC
Confidence            457899999998874


No 270
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=22.51  E-value=35  Score=19.33  Aligned_cols=17  Identities=18%  Similarity=0.243  Sum_probs=12.5

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-+
T Consensus        62 ~~~~~~C~~C~~~f~~~   78 (110)
T 2csh_A           62 GIKPYECNICAKRFMWR   78 (110)
T ss_dssp             CCCCEECSSSCCEESCH
T ss_pred             CCCCeeCCCCcchhcCH
Confidence            34568899999888654


No 271
>3vth_A Hydrogenase maturation factor; carbamoyltransfer, maturation of [NIFE]-hydrogenase, carbamoylphosphate, iron, HYPE; HET: APC AP2; 2.00A {Thermoanaerobacter tengcongensis} PDB: 3vti_A
Probab=22.31  E-value=29  Score=28.59  Aligned_cols=18  Identities=33%  Similarity=0.829  Sum_probs=15.9

Q ss_pred             eEeCCCCccccccCCccc
Q psy15340         56 LECPESGRKFPISSGIPN   73 (81)
Q Consensus        56 L~C~~c~~~ypI~dGIP~   73 (81)
                      ..|..||=+|.|..++|-
T Consensus       134 ~nCt~CGPR~tii~~lPY  151 (761)
T 3vth_A          134 INCTNCGPRFSIIEDIPY  151 (761)
T ss_dssp             CCBTTBBCSGGGBCSSSC
T ss_pred             ccCCCCCcchhhhccCCC
Confidence            469999999999999983


No 272
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=22.00  E-value=32  Score=18.56  Aligned_cols=15  Identities=20%  Similarity=0.412  Sum_probs=10.7

Q ss_pred             ceeEeCCCCcccccc
Q psy15340         54 GDLECPESGRKFPIS   68 (81)
Q Consensus        54 g~L~C~~c~~~ypI~   68 (81)
                      +...||.|+..+...
T Consensus        56 ~~~~CP~Cr~~~~~~   70 (73)
T 2ysl_A           56 GFFKCPLCKTSVRKN   70 (73)
T ss_dssp             SCCCCSSSCCCCCCC
T ss_pred             CCCCCCCCCCcCCcc
Confidence            566788888877654


No 273
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=21.79  E-value=35  Score=18.70  Aligned_cols=14  Identities=36%  Similarity=0.461  Sum_probs=8.6

Q ss_pred             EeCCCCccccccCC
Q psy15340         57 ECPESGRKFPISSG   70 (81)
Q Consensus        57 ~C~~c~~~ypI~dG   70 (81)
                      .||.|+..+.-..|
T Consensus        62 ~CP~Cr~~~~~~~g   75 (75)
T 1x4j_A           62 TCPICRADSGPSSG   75 (75)
T ss_dssp             SCTTTCCCCCCCCC
T ss_pred             cCcCcCCcCCCCCC
Confidence            57777666655544


No 274
>1ma3_A SIR2-AF2, transcriptional regulatory protein, SIR2 family; enzyme-substrate complex, protein binding, transcription; HET: ALY MES; 2.00A {Archaeoglobus fulgidus} SCOP: c.31.1.5 PDB: 1s7g_A* 1yc2_A*
Probab=21.76  E-value=40  Score=23.48  Aligned_cols=26  Identities=19%  Similarity=0.369  Sum_probs=19.4

Q ss_pred             hhceeeeeccceeEeCCCCccccccC
Q psy15340         44 HALLEVEVVEGDLECPESGRKFPISS   69 (81)
Q Consensus        44 ~~ll~~~v~eg~L~C~~c~~~ypI~d   69 (81)
                      .-+++.+-.-..+.|..|++.|+..+
T Consensus       112 ~~v~elHG~~~~~~C~~C~~~~~~~~  137 (253)
T 1ma3_A          112 RRVLELHGSMDKLDCLDCHETYDWSE  137 (253)
T ss_dssp             CSEEETTEEEEEEEETTTCCEEEGGG
T ss_pred             CCEEEeCCCcCeeeeCCCCCcCcHHH
Confidence            44556665666889999999998754


No 275
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=21.68  E-value=36  Score=19.46  Aligned_cols=13  Identities=8%  Similarity=0.534  Sum_probs=8.4

Q ss_pred             ceeEeCCCCcccc
Q psy15340         54 GDLECPESGRKFP   66 (81)
Q Consensus        54 g~L~C~~c~~~yp   66 (81)
                      ....|+.|++.|.
T Consensus        18 ~~~~C~~C~k~f~   30 (115)
T 2dmi_A           18 SKFRCKDCSAAYD   30 (115)
T ss_dssp             CSEEBSSSSCEES
T ss_pred             CCEECCccCchhc
Confidence            4466777777665


No 276
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}
Probab=21.36  E-value=39  Score=20.05  Aligned_cols=23  Identities=17%  Similarity=0.224  Sum_probs=18.3

Q ss_pred             eeEeCCCCccccccCCccccCCC
Q psy15340         55 DLECPESGRKFPISSGIPNMLLK   77 (81)
Q Consensus        55 ~L~C~~c~~~ypI~dGIP~ml~~   77 (81)
                      .-.||.|+..+..++-.++.+.+
T Consensus        48 ~~~CP~Cr~~~~~~~l~~l~i~~   70 (133)
T 4ap4_A           48 ANTCPTCRKKINHKRYHPIYIGS   70 (133)
T ss_dssp             CSBCTTTCCBCTTTCEEECBCSS
T ss_pred             CCCCCCCCCcCccccccccccCC
Confidence            34899999999988887766543


No 277
>1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubre like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A
Probab=21.36  E-value=31  Score=23.22  Aligned_cols=12  Identities=17%  Similarity=0.398  Sum_probs=11.0

Q ss_pred             eeEeCCCCcccc
Q psy15340         55 DLECPESGRKFP   66 (81)
Q Consensus        55 ~L~C~~c~~~yp   66 (81)
                      .-+|+.||..|.
T Consensus       155 ~~~C~~CG~~~~  166 (191)
T 1lko_A          155 KWRCRNCGYVHE  166 (191)
T ss_dssp             EEEETTTCCEEE
T ss_pred             eEEECCCCCEee
Confidence            789999999986


No 278
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens}
Probab=21.34  E-value=31  Score=19.05  Aligned_cols=16  Identities=25%  Similarity=0.468  Sum_probs=12.0

Q ss_pred             cceeEeCCCCcccccc
Q psy15340         53 EGDLECPESGRKFPIS   68 (81)
Q Consensus        53 eg~L~C~~c~~~ypI~   68 (81)
                      +....|+.|++.|.-.
T Consensus        73 ~~~~~C~~C~~~f~~~   88 (100)
T 2ebt_A           73 AKPFQCGVCNRSFSRS   88 (100)
T ss_dssp             CCSCBCSSSCCBCSSH
T ss_pred             CCCeECCCCcCccCCH
Confidence            4568899999988643


No 279
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=21.32  E-value=43  Score=17.39  Aligned_cols=11  Identities=18%  Similarity=0.452  Sum_probs=5.9

Q ss_pred             eEeCCCCcccc
Q psy15340         56 LECPESGRKFP   66 (81)
Q Consensus        56 L~C~~c~~~yp   66 (81)
                      ..|+.|++.|.
T Consensus        11 ~~C~~C~k~f~   21 (66)
T 2eod_A           11 QPCTYCTKEFV   21 (66)
T ss_dssp             EECSSSCCEEE
T ss_pred             eeccccCCccC
Confidence            45555555554


No 280
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus}
Probab=21.11  E-value=35  Score=19.70  Aligned_cols=21  Identities=14%  Similarity=-0.126  Sum_probs=16.5

Q ss_pred             eeEeCCCCccccccCCccccC
Q psy15340         55 DLECPESGRKFPISSGIPNML   75 (81)
Q Consensus        55 ~L~C~~c~~~ypI~dGIP~ml   75 (81)
                      .-.||.|+..+...+=+||..
T Consensus        48 ~~~cP~~~~~l~~~~l~pn~~   68 (85)
T 2kr4_A           48 SPTDPFNRQMLTESMLEPVPE   68 (85)
T ss_dssp             CSBCTTTCCBCCGGGCEECHH
T ss_pred             CCCCCCCcCCCChHhcchHHH
Confidence            358999999998887777643


No 281
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82
Probab=20.87  E-value=39  Score=21.47  Aligned_cols=12  Identities=25%  Similarity=0.537  Sum_probs=10.1

Q ss_pred             ceeEeCCCCccc
Q psy15340         54 GDLECPESGRKF   65 (81)
Q Consensus        54 g~L~C~~c~~~y   65 (81)
                      -.-.|..||..|
T Consensus        66 ~p~~C~~CG~~F   77 (105)
T 2gmg_A           66 KPAQCRKCGFVF   77 (105)
T ss_dssp             CCCBBTTTCCBC
T ss_pred             ECcChhhCcCee
Confidence            345799999999


No 282
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1
Probab=20.50  E-value=34  Score=17.41  Aligned_cols=13  Identities=15%  Similarity=0.332  Sum_probs=9.4

Q ss_pred             eeEeCCCCccccc
Q psy15340         55 DLECPESGRKFPI   67 (81)
Q Consensus        55 ~L~C~~c~~~ypI   67 (81)
                      .-.||.|+..++|
T Consensus        43 ~~~CP~Cr~~~~v   55 (55)
T 1iym_A           43 HSTCPLCRLTVVV   55 (55)
T ss_dssp             CCSCSSSCCCSCC
T ss_pred             CCcCcCCCCEeEC
Confidence            4578888887764


No 283
>1yc5_A NAD-dependent deacetylase; SIR2, sirtuin, SIR2TM, SIRT1, nicotinamide, hydrolase; HET: ALY; 1.40A {Thermotoga maritima} SCOP: c.31.1.5 PDB: 2h2d_A* 2h2f_A 2h2g_A* 2h2h_A* 2h2i_A* 2h4f_A* 2h4j_A* 3d4b_A* 3d81_A* 3pdh_A* 2h4h_A* 3jr3_A* 2h59_A*
Probab=20.49  E-value=37  Score=23.54  Aligned_cols=25  Identities=12%  Similarity=0.351  Sum_probs=18.4

Q ss_pred             hhceeeeeccceeEeCCCCcccccc
Q psy15340         44 HALLEVEVVEGDLECPESGRKFPIS   68 (81)
Q Consensus        44 ~~ll~~~v~eg~L~C~~c~~~ypI~   68 (81)
                      .-+++.+-.-..+.|..|++.|+..
T Consensus       110 ~~v~elHG~~~~~~C~~C~~~~~~~  134 (246)
T 1yc5_A          110 KKVIELHGNVEEYYCVRCEKKYTVE  134 (246)
T ss_dssp             SCEEETTEEEEEEEETTTCCEEEHH
T ss_pred             CcEEEecCccceeEcCCCCCCCcHH
Confidence            3455555566688999999999864


No 284
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1
Probab=20.45  E-value=41  Score=19.16  Aligned_cols=17  Identities=18%  Similarity=0.270  Sum_probs=12.8

Q ss_pred             ccceeEeCCCCcccccc
Q psy15340         52 VEGDLECPESGRKFPIS   68 (81)
Q Consensus        52 ~eg~L~C~~c~~~ypI~   68 (81)
                      .+....|+.|++.|.-.
T Consensus        63 ~~~~~~C~~C~~~f~~~   79 (124)
T 2dlq_A           63 SEQVFTCSVCQETFRRR   79 (124)
T ss_dssp             CCCCEECSSSCCEESSH
T ss_pred             CCCCeECCCCCCccCCH
Confidence            45678899999888644


No 285
>1tfi_A Transcriptional elongation factor SII; transcription regulation; NMR {Homo sapiens} SCOP: g.41.3.1
Probab=20.40  E-value=38  Score=18.39  Aligned_cols=13  Identities=23%  Similarity=0.598  Sum_probs=8.7

Q ss_pred             eeEeCCCCccccc
Q psy15340         55 DLECPESGRKFPI   67 (81)
Q Consensus        55 ~L~C~~c~~~ypI   67 (81)
                      -.+|..||+.|.+
T Consensus        37 Fy~C~~Cg~~w~~   49 (50)
T 1tfi_A           37 FVVCNECGNRWKF   49 (50)
T ss_dssp             EEEESSSCCEEEC
T ss_pred             EEEcCCCCCeEEe
Confidence            3567778777653


No 286
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1
Probab=20.23  E-value=35  Score=19.14  Aligned_cols=14  Identities=29%  Similarity=0.593  Sum_probs=9.8

Q ss_pred             ceeEeCCCCccccc
Q psy15340         54 GDLECPESGRKFPI   67 (81)
Q Consensus        54 g~L~C~~c~~~ypI   67 (81)
                      ....|+.|++.|.-
T Consensus        16 ~~~~C~~C~~~f~~   29 (106)
T 2ee8_A           16 KEFICKFCGRHFTK   29 (106)
T ss_dssp             CCCBCSSSCCBCSS
T ss_pred             cCeECCCCCCccCC
Confidence            34678888887754


No 287
>1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1
Probab=20.03  E-value=34  Score=20.64  Aligned_cols=12  Identities=33%  Similarity=0.811  Sum_probs=8.6

Q ss_pred             eeEeCCCCcccc
Q psy15340         55 DLECPESGRKFP   66 (81)
Q Consensus        55 ~L~C~~c~~~yp   66 (81)
                      .=.||-||....
T Consensus        47 g~~CPvCgs~l~   58 (112)
T 1l8d_A           47 KGKCPVCGRELT   58 (112)
T ss_dssp             SEECTTTCCEEC
T ss_pred             CCCCCCCCCcCC
Confidence            337999998543


Done!