Diaphorina citri psyllid: psy15362


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200
MIASGQVQTSVNGIVLQNGLATNQTNTKTATGEEVPQSIVITSRQQYGLPEDAIVYCNFNQLYKIDPSTLQMWVNVLKAVPNSILWLLKFPAVGEANIQATAQALGLDQHRILFSNVAAKEEHVRRGQLADVCLDTPLCNGHTTSMDVLWTGTPVVTLPGETLASRVAASQLATLGCPELIARTHKEYQDIAIRLGTDRD
ccccccccEEcccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHcccccccEEEEcccccHHHHHHcccccEECccccccccHHHHHHHHccccEEECccccccccHHHHHHHHccccccccccHHHHHHHHHHHHcccc
******VQTSVNGIVLQNGLATNQTNTKTATGEEVP*SIVITSRQQYGLPEDAIVYCNFNQLYKIDPSTLQMWVNVLKAVPNSILWLLKFPAVGEANIQATAQALGLDQHRILFSNVAAKEEHVRRGQLADVCLDTPLCNGHTTSMDVLWTGTPVVTLPGETLASRVAASQLATLGCPELIARTHKEYQDIAIRLGTD**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIASGQVQTSVNGIVLQNGLATNQTNTKTATGEEVPQSIVITSRQQYGLPEDAIVYCNFNQLYKIDPSTLQMWVNVLKAVPNSILWLLKFPAVGEANIQATAQALGLDQHRILFSNVAAKEEHVRRGQLADVCLDTPLCNGHTTSMDVLWTGTPVVTLPGETLASRVAASQLATLGCPELIARTHKEYQDIAIRLGTDRD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit Catalyzes the transfer of a single N-acetylglucosamine from UDP-GlcNAc to a serine or threonine residue in cytoplasmic and nuclear proteins resulting in their modification with a beta-linked N-acetylglucosamine (O-GlcNAc). Glycosylates a large and diverse number of proteins including histone H2B, AKT1, MLL5, MAPT/TAU and HCFC1. Can regulate their cellular processes via cross-talk between glycosylation and phosphorylation or by affecting proteolytic processing. Involved in insulin resistance in muscle and adipocyte cells via glycosylating insulin signaling components and inhibiting the 'Thr-308' phosphorylation of AKT1, enhancing IRS1 phosphorylation and attenuating insulin signaling. Component of a THAP1/THAP3-HCFC1-OGT complex that is required for the regulation of the transcriptional activity of RRM1. As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues.confidentQ27HV0
UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit Catalyzes the transfer of a single N-acetylglucosamine from UDP-GlcNAc to a serine or threonine residue in cytoplasmic and nuclear proteins resulting in their modification with a beta-linked N-acetylglucosamine (O-GlcNAc). Glycosylates a large and diverse number of proteins including histone H2B, AKT1, MLL5, MAPT/TAU and HCFC1. Can regulate their cellular processes via cross-talk between glycosylation and phosphorylation or by affecting proteolytic processing. Involved in insulin resistance in muscle and adipocyte cells via glycosylating insulin signaling components and inhibiting the 'Thr-308' phosphorylation of AKT1, enhancing IRS1 phosphorylation and attenuating insulin signaling. Component of a THAP1/THAP3-HCFC1-OGT complex that is required for the regulation of the transcriptional activity of RRM1. As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues.confidentP81436
UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit Isoform 2, the mitochondrial isoform (mOGT), is cytotoxic and triggers apoptosis in several cell types including INS1, an insulinoma cell line.confidentO15294

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0046972 [MF]histone acetyltransferase activity (H4-K16 specific)probableGO:0008080, GO:0004402, GO:0016740, GO:0003824, GO:0016407, GO:0016746, GO:0016747, GO:0016410, GO:0003674, GO:0010485
GO:0006110 [BP]regulation of glycolysisprobableGO:0043470, GO:0043471, GO:0043467, GO:0031329, GO:0060255, GO:0031323, GO:0009894, GO:0050794, GO:0010906, GO:0065007, GO:0010675, GO:0008150, GO:0019222, GO:0006109, GO:0050789, GO:0080090
GO:0070207 [BP]protein homotrimerizationprobableGO:0051259, GO:0022607, GO:0070206, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0051260, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0000123 [CC]histone acetyltransferase complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0043981 [BP]histone H4-K5 acetylationprobableGO:0043543, GO:0006473, GO:0006475, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018394, GO:0018193, GO:0071704, GO:0016570, GO:0016573, GO:0018393, GO:0043967, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044237, GO:0043170, GO:0019538, GO:0044763, GO:0016568, GO:0016569
GO:0051571 [BP]positive regulation of histone H3-K4 methylationprobableGO:0033044, GO:0009893, GO:0019222, GO:0033043, GO:0031325, GO:0031323, GO:0051128, GO:0051569, GO:0031056, GO:0031058, GO:0050789, GO:0080090, GO:0010604, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0051130, GO:0060255, GO:0050794, GO:0031060, GO:0031062, GO:0032268, GO:0031401, GO:0010638, GO:0008150, GO:2001252, GO:0048522
GO:0005547 [MF]phosphatidylinositol-3,4,5-trisphosphate bindingprobableGO:0043168, GO:0035091, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:1901981
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0080182 [BP]histone H3-K4 trimethylationprobableGO:0006479, GO:0018023, GO:0018022, GO:0008213, GO:0016043, GO:0051568, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018193, GO:0071704, GO:0034968, GO:0016571, GO:0016570, GO:0032259, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0043414, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044763, GO:0044237, GO:0043170, GO:0019538, GO:0008150, GO:0016568, GO:0016569
GO:0043982 [BP]histone H4-K8 acetylationprobableGO:0043543, GO:0006473, GO:0006475, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018394, GO:0018193, GO:0071704, GO:0016570, GO:0016573, GO:0018393, GO:0043967, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044237, GO:0043170, GO:0019538, GO:0044763, GO:0016568, GO:0016569
GO:0043984 [BP]histone H4-K16 acetylationprobableGO:0043543, GO:0006473, GO:0006475, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018394, GO:0018193, GO:0071704, GO:0016570, GO:0016573, GO:0018393, GO:0043967, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044237, GO:0043170, GO:0019538, GO:0044763, GO:0016568, GO:0016569
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0008047 [MF]enzyme activator activityprobableGO:0030234, GO:0003674
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0046626 [BP]regulation of insulin receptor signaling pathwayprobableGO:0009966, GO:1900076, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0048015 [BP]phosphatidylinositol-mediated signalingprobableGO:0044700, GO:0051716, GO:0044699, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0048017
GO:0035020 [BP]regulation of Rac protein signal transductionprobableGO:0051056, GO:0009966, GO:0048583, GO:0046578, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0042277 [MF]peptide bindingprobableGO:0033218, GO:0003674, GO:0005488
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0043995 [MF]histone acetyltransferase activity (H4-K5 specific)probableGO:0008080, GO:0004402, GO:0016740, GO:0003824, GO:0016407, GO:0016746, GO:0016747, GO:0016410, GO:0003674, GO:0010485
GO:0043996 [MF]histone acetyltransferase activity (H4-K8 specific)probableGO:0008080, GO:0004402, GO:0016740, GO:0003824, GO:0016407, GO:0016746, GO:0016747, GO:0016410, GO:0003674, GO:0010485
GO:0070688 [CC]MLL5-L complexprobableGO:0031974, GO:0043229, GO:0005623, GO:0043227, GO:0043226, GO:0034708, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0035097, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0006917 [BP]induction of apoptosisprobableGO:0050789, GO:0043067, GO:0050794, GO:0043065, GO:0048518, GO:0012502, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0016262 [MF]protein N-acetylglucosaminyltransferase activityprobableGO:0003824, GO:0016740, GO:0003674, GO:0016757, GO:0016758, GO:0008375, GO:0008194
GO:0048029 [MF]monosaccharide bindingprobableGO:0003674, GO:0030246, GO:0005488
GO:0043085 [BP]positive regulation of catalytic activityprobableGO:0019222, GO:0050790, GO:0065007, GO:0044093, GO:0008150, GO:0065009, GO:0050789
GO:0045862 [BP]positive regulation of proteolysisprobableGO:0009893, GO:0032268, GO:0080090, GO:0019222, GO:0060255, GO:0031323, GO:0031325, GO:0051246, GO:0051247, GO:0050794, GO:0008150, GO:0065007, GO:0030162, GO:0048518, GO:0032270, GO:0010604, GO:0050789, GO:0048522
GO:0032868 [BP]response to insulin stimulusprobableGO:1901700, GO:0009719, GO:0050896, GO:0009725, GO:0010243, GO:1901698, GO:0008150, GO:1901652, GO:0042221, GO:0043434, GO:0010033
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0030854 [BP]positive regulation of granulocyte differentiationprobableGO:0002761, GO:1902107, GO:0002763, GO:0051094, GO:0050793, GO:0065007, GO:0045597, GO:0045595, GO:0050794, GO:0030852, GO:0050789, GO:1902105, GO:0045639, GO:0002682, GO:0008150, GO:0051239, GO:0048518, GO:2000026, GO:0045637, GO:0048522
GO:0006493 [BP]protein O-linked glycosylationprobableGO:0044249, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0009058, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0044238, GO:0005975, GO:0006486, GO:1901137, GO:1901135, GO:0043412, GO:0009059, GO:0043170, GO:0019538, GO:0043413
GO:0007584 [BP]response to nutrientprobableGO:0009991, GO:0009605, GO:0050896, GO:0031667, GO:0008150, GO:0042221
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0035220 [BP]wing disc developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007444, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0071300 [BP]cellular response to retinoic acidprobableGO:1901700, GO:1901701, GO:0032526, GO:0033993, GO:0050896, GO:0009987, GO:0071396, GO:0051716, GO:0008150, GO:0071310, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GYW, chain A
Confidence level:very confident
Coverage over the Query: 2-200
View the alignment between query and template
View the model in PyMOL