Diaphorina citri psyllid: psy15368

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520--

MGKLLLISFLLLFLLDLVRGTLLYNSNFTDPSLDFLNDTFNGTACPHSTGPTLFFATQTIYLIICITGLLGNTLVIYVVLRFSKMQTVTNMYIVNLAIADECFLIGIPFLMITIKMQTVTNMYIVNLAIADECFLIGIPFLMITMSISYWHYILVSLFRVASLSSYWPFGDLMCKIYMTTTSINQFTSSIFLTIMSADRYVAVCHPITAPNLRTPFISKVVSFIAWTASAIFMIPVIMYASIIDSENTKSCNIMWPETENLNGQSAFILYTFILGFAIPLVLIFVFYYLVIRKLRTVGPKNKPKEKKKSHRKVTKLVLTVITLRTVGPKNKPKEKKKSHRKVTKLVLTVITVYVLCWLPYWITQIALIFTPPRQCQSSITVIVFLIAGALSYSNSAMNPILYAFLSDNFKKSFLKACTCAAGKDVNATLHLENSVTCLNSVFPRKRNSERYHTRPRGAATSSRPDEECNEIGSRGGQSTTALTSRSNITMSTDSGVAMGTKDQFSNGLGTNTNGNSMIATTV

ccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccEEEEEEEEEccccccHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHEEECccccccEECccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHccHHHHHHHccccHHHHHHHHHcccccccccccccccccccEECcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

***LLLISFLLLFLLDLVRGTLLYNSNFTDPSLDFLNDTFNGTACPHSTGPTLFFATQTIYLIICITGLLGNTLVIYVVLRFSKMQTVTNMYIVNLAIADECFLIGIPFLMITIKMQTVTNMYIVNLAIADECFLIGIPFLMITMSISYWHYILVSLFRVASLSSYWPFGDLMCKIYMTTTSINQFTSSIFLTIMSADRYVAVCHPITAPNLRTPFISKVVSFIAWTASAIFMIPVIMYASIIDSENTKSCNIMWPETENLNGQSAFILYTFILGFAIPLVLIFVFYYLVIRKLRT*********************************************VTKLVLTVITVYVLCWLPYWITQIALIFTPPRQCQSSITVIVFLIAGALSYSNSAMNPILYAFLSDNFKKSFLKACTCAAG****************************************************************************************************

xxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005488 [MF]	binding	probable	GO:0003674
GO:0031253 [CC]	cell projection membrane	probable	GO:0016020, GO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0042995, GO:0044459
GO:0038003 [BP]	opioid receptor signaling pathway	probable	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007186, GO:0050789, GO:0044699
GO:0004985 [MF]	opioid receptor activity	probable	GO:0008528, GO:0004930, GO:0038023, GO:0060089, GO:0004888, GO:0001653, GO:0003674, GO:0004872, GO:0004871
GO:0019222 [BP]	regulation of metabolic process	probable	GO:0008150, GO:0065007, GO:0050789
GO:0007193 [BP]	adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway	probable	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0050789, GO:0007188, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007186, GO:0007187, GO:0044699
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0007200 [BP]	phospholipase C-activating G-protein coupled receptor signaling pathway	probable	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007186, GO:0050789, GO:0044699
GO:0048523 [BP]	negative regulation of cellular process	probable	GO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0032870 [BP]	cellular response to hormone stimulus	probable	GO:0071495, GO:0009719, GO:0051716, GO:0009725, GO:0050896, GO:0009987, GO:0008150, GO:0071310, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0065008 [BP]	regulation of biological quality	probable	GO:0008150, GO:0065007

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DKL, chain A
Confidence level:very confident
Coverage over the Query: 51-112,161-418
View the alignment between query and template
View the model in PyMOL

Template: 4EA3, chain A
Confidence level:confident
Coverage over the Query: 116-136
View the alignment between query and template
View the model in PyMOL

Template: 1JFP, chain A
Confidence level:probable
Coverage over the Query: 104-137,152-326,356-428
View the alignment between query and template
View the model in PyMOL