Diaphorina citri psyllid: psy15374

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-----

MLAWSPEEAGEMIETYKVFENKPPDLIMEKQDVDPHSKTWNFDPVPAAQNSATSESVQPSRAGASKSSNAILVNPRQKGNPLLKHIGKVPWEYDDSIIPDYVMGRTTCALFLSIKYHALKPDYIADRIKALGKLYKLQVDSKDPHHALKYLTRVCLLCDLTLMLAWSPEEAGEMIETYKVFENKPPDLIMEKQDVDPHSKTWNFG

cccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccCECcccccccEEEcccEEEEEEEccccccccHHHHHHHHHHccEEEEEEccccHHHHHHHHHHHHHHHccEEEEEccHHHHHHHHHHHHHHHccccHHHcccccccccccccccc

MLAWS**EAGE**********************************************************AILVNPRQKGNPLLKHIGKVPWEYDDSIIPDYVMGRTTCALFLSIKYHALKPDYIADRIKALGKLYKLQVDSKDPHHALKYLTRVCLLCDLTLMLAWSPEEAGEMIETYKVFEN*************PHSKTWNF*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
DNA excision repair protein ERCC-1	Structure-specific DNA repair endonuclease responsible for the 5'-incision during DNA repair.	confident	P07903
DNA excision repair protein ERCC-1	Structure-specific DNA repair endonuclease responsible for the 5'-incision during DNA repair.	confident	Q1LZ75

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005669 [CC]	transcription factor TFIID complex	probable	GO:0030880, GO:0000428, GO:0031974, GO:0043229, GO:0016591, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0055029, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0005667, GO:0044424, GO:0044422
GO:0000014 [MF]	single-stranded DNA specific endodeoxyribonuclease activity	probable	GO:0016787, GO:0003824, GO:0004536, GO:0004519, GO:0004520, GO:0016788, GO:0004518, GO:0003674
GO:0006296 [BP]	nucleotide-excision repair, DNA incision, 5'-to lesion	probable	GO:0090304, GO:0090305, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0033683, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006289, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0000733 [BP]	DNA strand renaturation	probable	GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:0006259, GO:1901360, GO:0046483
GO:0048812 [BP]	neuron projection morphogenesis	probable	GO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0071840, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0008150
GO:0046982 [MF]	protein heterodimerization activity	probable	GO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0003697 [MF]	single-stranded DNA binding	probable	GO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0007131 [BP]	reciprocal meiotic recombination	probable	GO:0048610, GO:0090304, GO:0034641, GO:0006807, GO:0022402, GO:0044699, GO:0006139, GO:0007126, GO:0007127, GO:0051321, GO:0000003, GO:0044260, GO:0071704, GO:1901360, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0035825, GO:0046483, GO:0006310, GO:0044238, GO:0007049, GO:0044237, GO:0043170, GO:0006259, GO:0044763
GO:0000784 [CC]	nuclear chromosome, telomeric region	probable	GO:0031974, GO:0000781, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0000109 [CC]	nucleotide-excision repair complex	probable	GO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0001094 [MF]	TFIID-class transcription factor binding	probable	GO:0001085, GO:0001091, GO:0008134, GO:0001098, GO:0001099, GO:0003674, GO:0005488, GO:0005515
GO:0006312 [BP]	mitotic recombination	probable	GO:0006310, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:0006259, GO:1901360, GO:0046483
GO:0003684 [MF]	damaged DNA binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2A1I, chain A
Confidence level:very confident
Coverage over the Query: 69-193
View the alignment between query and template
View the model in PyMOL

Template: 2A1J, chain B
Confidence level:probable
Coverage over the Query: 22-42
View the alignment between query and template
View the model in PyMOL