Query         psy15390
Match_columns 142
No_of_seqs    125 out of 1173
Neff          11.1
Searched_HMMs 46136
Date          Fri Aug 16 19:47:13 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15390.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15390hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3513|consensus               99.9 3.7E-23 8.1E-28  152.2  15.3  134    4-142   327-514 (1051)
  2 KOG3513|consensus               99.9 3.2E-20   7E-25  137.0  14.2  131    6-142   238-421 (1051)
  3 cd05762 Ig8_MLCK Eighth immuno  99.8 1.6E-17 3.5E-22   94.1  11.5   90    9-141     1-90  (98)
  4 cd05851 Ig3_Contactin-1 Third   99.8 1.8E-17 3.9E-22   92.2  11.1   88    8-142     1-88  (88)
  5 PHA02826 IL-1 receptor-like pr  99.7 2.4E-16 5.3E-21  101.5  12.5  122   19-141    30-226 (227)
  6 cd05747 Ig5_Titin_like M5, fif  99.7 2.9E-16 6.4E-21   88.1  11.4   90    7-139     2-91  (92)
  7 cd05737 Ig_Myomesin_like_C C-t  99.7 2.8E-16 6.1E-21   88.1  10.8   86   17-141     7-92  (92)
  8 cd07693 Ig1_Robo First immunog  99.7 6.2E-16 1.4E-20   87.9  11.9   96    8-141     1-99  (100)
  9 cd04975 Ig4_SCFR_like Fourth i  99.7 8.5E-16 1.8E-20   87.3  11.4   91   17-142     9-100 (101)
 10 cd05865 Ig1_NCAM-1 First immun  99.7 6.8E-16 1.5E-20   87.0  10.9   89   17-141     6-95  (96)
 11 PF07679 I-set:  Immunoglobulin  99.7 5.7E-16 1.2E-20   86.5  10.5   90    9-141     1-90  (90)
 12 cd04968 Ig3_Contactin_like Thi  99.7 1.7E-15 3.6E-20   84.3  12.0   88    8-142     1-88  (88)
 13 cd05870 Ig5_NCAM-2 Fifth immun  99.7 1.6E-15 3.4E-20   86.1  11.6   97    7-141     1-98  (98)
 14 cd05730 Ig3_NCAM-1_like Third   99.7 1.8E-15 3.9E-20   85.3  11.5   83   18-141    10-92  (95)
 15 cd05894 Ig_C5_MyBP-C C5 immuno  99.7 2.1E-15 4.7E-20   83.4  11.4   84   19-141     3-86  (86)
 16 cd05869 Ig5_NCAM-1 Fifth immun  99.7 2.6E-15 5.7E-20   85.0  11.9   97    7-141     1-97  (97)
 17 cd05740 Ig_CEACAM_D4 Fourth im  99.7 1.7E-15 3.7E-20   84.6  10.8   83   17-142     9-91  (91)
 18 KOG4194|consensus               99.7 9.9E-16 2.2E-20  108.1  11.5  131    6-141   501-703 (873)
 19 cd05745 Ig3_Peroxidasin Third   99.7 4.7E-16   1E-20   83.8   7.8   74   25-141     1-74  (74)
 20 cd05722 Ig1_Neogenin First imm  99.7 2.9E-15 6.4E-20   84.5  11.3   90   17-141     5-95  (95)
 21 cd05866 Ig1_NCAM-2 First immun  99.7 2.1E-15 4.6E-20   84.2  10.5   86   17-141     6-91  (92)
 22 KOG4221|consensus               99.7 4.3E-15 9.2E-20  111.0  14.2  109   17-128   146-313 (1381)
 23 cd05728 Ig4_Contactin-2-like F  99.7 1.9E-15 4.1E-20   83.5   9.6   81   17-141     5-85  (85)
 24 cd05732 Ig5_NCAM-1_like Fifth   99.7 5.1E-15 1.1E-19   83.6  11.5   96    7-141     1-96  (96)
 25 KOG4194|consensus               99.7 1.7E-15 3.6E-20  107.0  11.2  124    4-131   608-786 (873)
 26 cd05867 Ig4_L1-CAM_like Fourth  99.7 3.6E-15 7.9E-20   80.7  10.0   74   26-141     1-75  (76)
 27 cd05848 Ig1_Contactin-5 First   99.7 5.1E-15 1.1E-19   83.3  10.9   87    9-139     2-92  (94)
 28 cd04977 Ig1_NCAM-1_like First   99.7 6.5E-15 1.4E-19   82.5  11.1   87   17-141     6-92  (92)
 29 cd05892 Ig_Myotilin_C C-termin  99.7   3E-15 6.4E-20   80.6   9.2   75   29-141     1-75  (75)
 30 cd04972 Ig_TrkABC_d4 Fourth do  99.7 7.3E-15 1.6E-19   82.0  11.1   85   17-141     6-90  (90)
 31 cd05852 Ig5_Contactin-1 Fifth   99.7 1.7E-15 3.6E-20   81.3   8.1   73   26-141     1-73  (73)
 32 cd05891 Ig_M-protein_C C-termi  99.7 8.9E-15 1.9E-19   82.0  11.3   86   17-141     7-92  (92)
 33 cd05868 Ig4_NrCAM Fourth immun  99.6 3.9E-15 8.4E-20   80.6   9.5   75   26-141     1-75  (76)
 34 cd05859 Ig4_PDGFR-alpha Fourth  99.6   6E-15 1.3E-19   83.9  10.4   88   20-141    12-99  (101)
 35 cd05850 Ig1_Contactin-2 First   99.6 1.4E-14 3.1E-19   81.5  11.7   88    9-140     2-93  (94)
 36 PHA02785 IL-beta-binding prote  99.6 7.4E-15 1.6E-19   99.7  12.5  105   22-131    37-202 (326)
 37 cd05738 Ig2_RPTP_IIa_LAR_like   99.6 4.2E-15   9E-20   80.1   8.9   74   29-142     1-74  (74)
 38 cd05724 Ig2_Robo Second immuno  99.6 9.7E-15 2.1E-19   80.8  10.1   84   17-141     2-86  (86)
 39 KOG4221|consensus               99.6 2.5E-15 5.4E-20  112.2   9.5  120   17-139   243-413 (1381)
 40 cd05893 Ig_Palladin_C C-termin  99.6 6.1E-15 1.3E-19   79.5   8.5   75   29-141     1-75  (75)
 41 cd05723 Ig4_Neogenin Fourth im  99.6 1.2E-14 2.5E-19   77.7   9.5   71   28-141     1-71  (71)
 42 cd04973 Ig1_FGFR First immunog  99.6 1.5E-14 3.3E-19   78.8  10.0   78   19-141     2-79  (79)
 43 cd05748 Ig_Titin_like Immunogl  99.6 1.7E-14 3.7E-19   77.7   9.7   74   28-141     1-74  (74)
 44 cd05857 Ig2_FGFR Second immuno  99.6 2.1E-14 4.4E-19   79.4  10.1   82   21-141     4-85  (85)
 45 cd04978 Ig4_L1-NrCAM_like Four  99.6 1.5E-14 3.2E-19   78.3   9.4   75   26-141     1-75  (76)
 46 cd05735 Ig8_DSCAM Eight immuno  99.6 3.5E-14 7.7E-19   78.9  10.8   82   26-142     1-82  (88)
 47 cd05863 Ig2_VEGFR-3 Second imm  99.6 9.7E-15 2.1E-19   76.8   7.9   64   29-140     1-64  (67)
 48 cd05744 Ig_Myotilin_C_like Imm  99.6 3.4E-14 7.4E-19   76.6   9.5   75   29-141     1-75  (75)
 49 cd04969 Ig5_Contactin_like Fif  99.6 2.1E-14 4.5E-19   77.1   8.5   73   26-141     1-73  (73)
 50 cd05876 Ig3_L1-CAM Third immun  99.6 1.6E-14 3.4E-19   77.2   7.9   71   29-142     1-71  (71)
 51 cd05749 Ig2_Tyro3_like Second   99.6 3.8E-14 8.2E-19   77.4   9.1   76   17-139     4-80  (81)
 52 cd05773 Ig8_hNephrin_like Eigh  99.6 1.2E-13 2.6E-18   79.7  11.5   99    5-141     1-104 (109)
 53 PHA02785 IL-beta-binding prote  99.6 7.5E-14 1.6E-18   94.8  12.2  107   21-132   131-318 (326)
 54 KOG4222|consensus               99.6 1.6E-14 3.5E-19  107.4   9.5  124   17-142   137-313 (1281)
 55 cd04974 Ig3_FGFR Third immunog  99.6 6.3E-14 1.4E-18   78.2   9.7   86   26-142     1-90  (90)
 56 KOG4222|consensus               99.6 2.6E-14 5.6E-19  106.4  10.3  131    7-142    30-223 (1281)
 57 cd05849 Ig1_Contactin-1 First   99.6 9.2E-14   2E-18   77.9  10.3   86    9-139     2-91  (93)
 58 cd05856 Ig2_FGFRL1-like Second  99.6 4.3E-14 9.4E-19   77.4   8.7   79   21-141     4-82  (82)
 59 cd05743 Ig_Perlecan_D2_like Im  99.6 4.7E-14   1E-18   76.7   8.5   67   26-131     1-67  (78)
 60 cd05763 Ig_1 Subgroup of the i  99.6 8.5E-14 1.8E-18   75.1   9.0   73   29-141     1-74  (75)
 61 cd05764 Ig_2 Subgroup of the i  99.6 7.2E-14 1.6E-18   75.2   8.6   74   26-141     1-74  (74)
 62 cd05756 Ig1_IL1R_like First im  99.6 8.6E-14 1.9E-18   78.2   9.0   83   19-141     7-94  (94)
 63 cd05854 Ig6_Contactin-2 Sixth   99.5   2E-13 4.3E-18   75.4   9.9   80   27-142     1-82  (85)
 64 cd05760 Ig2_PTK7 Second immuno  99.5   7E-14 1.5E-18   75.8   7.9   73   29-141     1-74  (77)
 65 cd05726 Ig4_Robo Fhird immunog  99.5 1.5E-13 3.2E-18   76.7   9.4   82   26-142     1-82  (90)
 66 cd05752 Ig1_FcgammaR_like Frst  99.5 9.3E-14   2E-18   75.4   7.9   61   17-88      6-67  (78)
 67 cd05731 Ig3_L1-CAM_like Third   99.5 8.4E-14 1.8E-18   74.3   7.2   71   29-142     1-71  (71)
 68 cd05736 Ig2_Follistatin_like S  99.5 2.8E-13 6.1E-18   73.2   9.3   74   29-142     1-74  (76)
 69 cd05858 Ig3_FGFR-2 Third immun  99.5   3E-13 6.4E-18   75.5   9.6   86   26-141     1-89  (90)
 70 cd05855 Ig_TrkB_d5 Fifth domai  99.5 2.4E-13 5.2E-18   73.6   8.9   75   31-140     3-77  (79)
 71 cd05733 Ig6_L1-CAM_like Sixth   99.5 1.5E-13 3.3E-18   74.5   8.1   72   29-139     1-76  (77)
 72 cd05725 Ig3_Robo Third immunog  99.5 1.8E-13   4E-18   72.6   8.1   69   29-141     1-69  (69)
 73 cd05734 Ig7_DSCAM Seventh immu  99.5 2.9E-13 6.4E-18   73.7   8.7   79   29-141     1-79  (79)
 74 cd05758 Ig5_KIRREL3-like Fifth  99.5 4.2E-13   9E-18   76.1   9.4   94    8-139     2-97  (98)
 75 cd05874 Ig6_NrCAM Sixth immuno  99.5 2.9E-13 6.3E-18   73.3   8.2   25   29-54      1-25  (77)
 76 cd04970 Ig6_Contactin_like Six  99.5 4.7E-13   1E-17   73.9   9.0   80   27-142     1-82  (85)
 77 cd04979 Ig_Semaphorin_C Immuno  99.5 7.3E-13 1.6E-17   73.8   9.9   83   17-141     2-86  (89)
 78 cd05864 Ig2_VEGFR-2 Second imm  99.5 1.2E-13 2.7E-18   73.3   6.0   68   29-140     1-69  (70)
 79 cd05873 Ig_Sema4D_like Immunog  99.5 3.9E-13 8.4E-18   74.1   7.9   69   17-89      2-70  (87)
 80 cd05875 Ig6_hNeurofascin_like   99.5 5.9E-13 1.3E-17   72.1   8.5   72   29-139     1-76  (77)
 81 cd05882 Ig1_Necl-1 First (N-te  99.5 3.6E-12 7.7E-17   71.7  11.5   92   18-141     4-95  (95)
 82 cd05746 Ig4_Peroxidasin Fourth  99.5 1.8E-13 3.8E-18   72.7   5.9   68   29-139     1-68  (69)
 83 cd04976 Ig2_VEGFR Second immun  99.5 2.2E-13 4.7E-18   72.7   6.2   60   29-131     1-60  (71)
 84 cd05853 Ig6_Contactin-4 Sixth   99.5 7.6E-13 1.6E-17   72.7   8.1   79   27-142     1-82  (85)
 85 cd07702 Ig2_VEGFR-1 Second imm  99.5 2.3E-13 4.9E-18   72.5   5.8   57   29-88      1-57  (72)
 86 cd05765 Ig_3 Subgroup of the i  99.5 1.1E-12 2.4E-17   71.7   8.7   81   26-141     1-81  (81)
 87 cd05753 Ig2_FcgammaR_like Seco  99.5 7.4E-13 1.6E-17   72.7   7.7   77   18-141     6-83  (83)
 88 cd05739 Ig3_RPTP_IIa_LAR_like   99.5 8.3E-13 1.8E-17   70.0   7.6   27   26-53      1-27  (69)
 89 cd04967 Ig1_Contactin First Ig  99.4 2.4E-12 5.3E-17   71.9   9.7   42    9-54      2-46  (91)
 90 cd07701 Ig1_Necl-3 First (N-te  99.4   3E-12 6.5E-17   72.1   9.4   34   17-50      3-36  (95)
 91 cd04971 Ig_TrKABC_d5 Fifth dom  99.4 1.8E-12   4E-17   70.8   7.4   77   31-140     3-79  (81)
 92 cd05742 Ig1_VEGFR_like First i  99.4 8.8E-12 1.9E-16   68.6   9.5   81   26-141     1-83  (84)
 93 cd05861 Ig1_PDGFR-alphabeta Fr  99.4 2.2E-11 4.7E-16   67.1  10.9   81   26-141     1-82  (84)
 94 cd05729 Ig2_FGFR_like Second i  99.4 1.8E-11 3.8E-16   67.4  10.6   82   21-141     4-85  (85)
 95 cd05727 Ig2_Contactin-2-like S  99.4 4.2E-12 9.1E-17   71.1   7.3   71   18-89     10-82  (96)
 96 cd05754 Ig3_Perlecan_like Thir  99.4 4.4E-12 9.5E-17   70.0   7.1   34   17-51      7-41  (85)
 97 cd05898 Ig5_KIRREL3 Fifth immu  99.4 5.1E-11 1.1E-15   67.1  11.2   93    8-138     2-96  (98)
 98 cd05845 Ig2_L1-CAM_like Second  99.3 8.7E-12 1.9E-16   69.7   7.3   71   17-89      9-81  (95)
 99 cd05717 Ig1_Necl-1-3_like Firs  99.3 3.2E-11 6.9E-16   67.9   9.1   93   17-141     3-95  (95)
100 PF00047 ig:  Immunoglobulin do  99.3 1.1E-11 2.3E-16   64.7   6.5   60   26-86      1-64  (64)
101 cd05750 Ig_Pro_neuregulin Immu  99.3 9.8E-12 2.1E-16   66.9   6.5   72   29-137     1-73  (75)
102 smart00408 IGc2 Immunoglobulin  99.3 2.5E-11 5.5E-16   62.6   7.6   60   25-88      1-60  (63)
103 PF13895 Ig_2:  Immunoglobulin   99.3 3.8E-11 8.3E-16   65.1   8.1   32   21-53      9-40  (80)
104 cd05757 Ig2_IL1R_like Second i  99.3 1.6E-11 3.5E-16   68.6   6.4   63   21-87      5-72  (92)
105 cd07690 Ig1_CD4 First immunogl  99.3   3E-11 6.6E-16   67.6   7.4   89   21-131     2-90  (94)
106 cd05881 Ig1_Necl-2 First (N-te  99.3 1.1E-10 2.3E-15   65.4   9.5   73   18-90      4-85  (95)
107 cd05895 Ig_Pro_neuregulin-1 Im  99.3 2.6E-11 5.7E-16   65.4   6.7   73   29-137     1-74  (76)
108 cd05864 Ig2_VEGFR-2 Second imm  99.2   8E-11 1.7E-15   62.5   6.9   24   67-90     34-57  (70)
109 cd05871 Ig_Semaphorin_classIII  99.2 1.7E-10 3.6E-15   64.4   8.1   28   19-47      4-31  (91)
110 smart00410 IG_like Immunoglobu  99.2 1.4E-09   3E-14   59.2  11.0   83   20-142     3-86  (86)
111 smart00409 IG Immunoglobulin.   99.2 1.4E-09   3E-14   59.2  11.0   83   20-142     3-86  (86)
112 cd05897 Ig2_IL1R2_like Second   99.2 1.4E-10   3E-15   64.9   6.8   66   22-88      6-76  (95)
113 cd05860 Ig4_SCFR Fourth immuno  99.2 3.7E-09 7.9E-14   59.5  11.9   90   18-142    10-100 (101)
114 cd04976 Ig2_VEGFR Second immun  99.2 3.9E-10 8.4E-15   60.1   7.7   23   67-89     35-57  (71)
115 cd05746 Ig4_Peroxidasin Fourth  99.2 3.6E-10 7.8E-15   59.8   7.3   21   69-89     38-58  (69)
116 PHA02826 IL-1 receptor-like pr  99.2 2.2E-10 4.8E-15   74.1   7.7   68   19-88    137-209 (227)
117 cd05760 Ig2_PTK7 Second immuno  99.1 1.3E-09 2.9E-14   58.9   9.2   21   69-89     40-60  (77)
118 cd05862 Ig1_VEGFR First immuno  99.1 1.6E-09 3.6E-14   59.8   8.9   35  106-141    50-84  (86)
119 cd05900 Ig_Aggrecan Immunoglob  99.1 6.6E-09 1.4E-13   60.1  11.7   38  104-142    72-109 (112)
120 cd05879 Ig_P0 Immunoglobulin (  99.1 1.2E-08 2.6E-13   59.4  12.2  108   17-141     4-116 (116)
121 cd04971 Ig_TrKABC_d5 Fifth dom  99.1 1.4E-09 3.1E-14   59.3   7.6   23   68-90     47-69  (81)
122 PF13927 Ig_3:  Immunoglobulin   99.1 4.7E-10   1E-14   60.0   5.4   74    8-88      1-75  (75)
123 cd05759 Ig2_KIRREL3-like Secon  99.1 6.8E-09 1.5E-13   56.8   9.7   80   28-141     1-82  (82)
124 cd04983 IgV_TCR_alpha_like Imm  99.1 2.6E-09 5.6E-14   61.6   8.3  103   17-142     4-109 (109)
125 cd05751 Ig1_LILRB1_like First   99.0 1.3E-09 2.9E-14   60.8   6.7   40    8-53      2-41  (91)
126 cd05714 Ig_CSPGs_LP Immunoglob  99.0 2.3E-08 5.1E-13   57.3  12.0   38  104-142    66-103 (106)
127 cd05872 Ig_Sema4B_like Immunog  99.0 2.1E-09 4.5E-14   59.0   6.9   65   18-87      3-67  (85)
128 cd05899 IgV_TCR_beta Immunoglo  99.0 5.1E-09 1.1E-13   60.5   8.8   31   17-48      4-34  (110)
129 cd05877 Ig_LP_like Immunoglobu  99.0 1.3E-08 2.9E-13   58.3  10.2   37  105-142    67-103 (106)
130 cd05885 Ig2_Necl-4 Second immu  99.0   3E-09 6.5E-14   57.6   7.0   76   29-141     2-80  (80)
131 cd05713 Ig_MOG_like Immunoglob  99.0 1.5E-08 3.3E-13   57.5  10.1   36  105-141    64-99  (100)
132 cd05878 Ig_Aggrecan_like Immun  99.0 3.2E-08 6.9E-13   57.2  11.5   37  104-141    70-106 (110)
133 cd05774 Ig_CEACAM_D1 First imm  99.0 3.1E-09 6.6E-14   60.7   7.1  101   18-141     5-105 (105)
134 cd05741 Ig_CEACAM_D1_like Firs  99.0 1.5E-08 3.2E-13   56.5   9.1   37  105-141    56-92  (92)
135 cd05715 Ig_P0-like Immunoglobu  99.0 6.6E-08 1.4E-12   56.4  12.0  108   17-141     4-116 (116)
136 cd04980 IgV_L_kappa Immunoglob  99.0 4.8E-08   1E-12   56.0  11.0   32   17-48      6-38  (106)
137 cd05896 Ig1_IL1RAPL-1_like Fir  99.0 6.5E-09 1.4E-13   58.7   7.0   34   19-53      8-52  (104)
138 cd05775 Ig_SLAM-CD84_like_N N-  98.9 1.6E-08 3.4E-13   57.1   8.2   37  105-141    60-96  (97)
139 cd05846 Ig1_MRC-OX-2_like Firs  98.9 4.7E-08   1E-12   55.2  10.0   39  104-142    59-97  (97)
140 cd05739 Ig3_RPTP_IIa_LAR_like   98.9   2E-08 4.4E-13   53.1   7.8   58   79-139     3-68  (69)
141 cd07702 Ig2_VEGFR-1 Second imm  98.9 1.2E-08 2.5E-13   54.4   6.9   49   82-130     3-60  (72)
142 cd05880 Ig_EVA1 Immunoglobulin  98.9 3.8E-08 8.2E-13   57.3   9.5  107   17-141     4-115 (115)
143 cd04982 IgV_TCR_gamma Immunogl  98.9 2.2E-08 4.7E-13   58.4   8.4   32   17-48      4-37  (116)
144 cd00099 IgV Immunoglobulin var  98.9 1.4E-08 3.1E-13   57.9   7.2   27   22-48      2-29  (105)
145 cd05718 Ig1_PVR_like First imm  98.9 9.8E-08 2.1E-12   53.9  10.2   38  104-141    60-97  (98)
146 cd05887 Ig1_Nectin-3_like Firs  98.9 1.2E-07 2.7E-12   53.2  10.3   38  104-141    58-95  (96)
147 cd05752 Ig1_FcgammaR_like Frst  98.9 1.3E-08 2.9E-13   55.1   6.2   64   74-141    12-78  (78)
148 cd05750 Ig_Pro_neuregulin Immu  98.8 2.4E-08 5.2E-13   53.5   6.7   22   68-89     44-65  (75)
149 cd05888 Ig1_Nectin-4_like Frst  98.8 2.1E-07 4.5E-12   52.8  10.7   39  104-142    62-100 (100)
150 cd05711 Ig_FcalphaRI Immunoglo  98.8 2.4E-08 5.2E-13   56.1   6.7   39    8-52      1-39  (94)
151 cd05895 Ig_Pro_neuregulin-1 Im  98.8 2.6E-08 5.6E-13   53.6   6.5   24   67-90     44-67  (76)
152 cd05901 Ig_Versican Immunoglob  98.8 5.3E-07 1.1E-11   52.3  12.1   38  104-142    77-114 (117)
153 PHA03376 BARF1; Provisional     98.8 3.6E-07 7.7E-12   56.7  11.9  118   18-137    18-160 (221)
154 PF07686 V-set:  Immunoglobulin  98.8 1.2E-07 2.6E-12   54.6   9.3   31   17-47      7-38  (114)
155 cd05886 Ig1_Nectin-1_like Firs  98.8   4E-07 8.6E-12   51.5  11.0   39  104-142    61-99  (99)
156 cd05757 Ig2_IL1R_like Second i  98.8 3.1E-08 6.6E-13   55.4   6.3   57   75-131     8-77  (92)
157 cd05902 Ig_Neurocan Immunoglob  98.8   2E-07 4.4E-12   53.7   9.6   37  104-141    70-106 (110)
158 cd04967 Ig1_Contactin First Ig  98.8 1.1E-07 2.3E-12   53.1   8.2   58   78-135    20-88  (91)
159 KOG3515|consensus               98.8 2.8E-08 6.1E-13   73.1   7.0   63   22-89     18-81  (741)
160 cd04984 IgV_L_lambda Immunoglo  98.8 8.1E-08 1.8E-12   54.3   7.1   27   22-48      2-30  (98)
161 cd05754 Ig3_Perlecan_like Thir  98.8 7.8E-08 1.7E-12   52.9   6.9   65   74-139    13-84  (85)
162 PHA02987 Ig domain OX-2-like p  98.7 5.3E-07 1.2E-11   55.9  10.8   30   19-48     23-53  (189)
163 cd05758 Ig5_KIRREL3-like Fifth  98.7 1.4E-07 3.1E-12   53.3   7.8   27   74-100    13-40  (98)
164 cd07701 Ig1_Necl-3 First (N-te  98.7 2.5E-07 5.5E-12   52.0   8.7   66   74-141     9-95  (95)
165 cd07706 IgV_TCR_delta Immunogl  98.7 1.7E-07 3.7E-12   54.6   8.2   32   17-48      5-37  (116)
166 cd05712 Ig_Siglec_N Immunoglob  98.7 3.9E-07 8.4E-12   53.4   9.6   32   17-48      5-42  (119)
167 cd05897 Ig2_IL1R2_like Second   98.7 1.2E-07 2.6E-12   53.2   5.9   67   75-141     8-93  (95)
168 cd05883 Ig2_Necl-2 Second immu  98.7 8.2E-07 1.8E-11   48.3   8.8   25   29-54      2-27  (82)
169 cd07700 IgV_CD8_beta Immunoglo  98.6 1.6E-06 3.5E-11   49.8  10.4   27   22-48      2-29  (107)
170 cd05871 Ig_Semaphorin_classIII  98.6 5.3E-07 1.1E-11   50.3   7.6   63   77-141    11-88  (91)
171 cd05761 Ig2_Necl-1-4_like Seco  98.6 1.7E-06 3.8E-11   47.2   9.4   25   29-54      2-27  (82)
172 cd05716 Ig_pIgR Immunoglobulin  98.6 3.5E-07 7.6E-12   51.6   6.3   28   21-48      2-30  (98)
173 cd05889 Ig1_DNAM-1_like First   98.6 5.5E-06 1.2E-10   46.6  10.9   35  104-138    58-92  (96)
174 cd07705 Ig2_Necl-1 Second immu  98.6 3.6E-06 7.8E-11   46.1   9.8   25   29-54      2-27  (83)
175 smart00408 IGc2 Immunoglobulin  98.5 7.2E-07 1.6E-11   45.5   6.5   53   78-130     3-63  (63)
176 cd04981 IgV_H Immunoglobulin (  98.5 1.1E-06 2.3E-11   51.4   7.7   32   17-48      3-36  (117)
177 cd05771 IgC_Tapasin_R Tapasin-  98.5 7.3E-06 1.6E-10   49.3  10.8   44    4-51     34-79  (139)
178 cd05720 Ig_CD8_alpha Immunoglo  98.5 1.2E-06 2.5E-11   50.1   6.9   27   22-48      2-28  (104)
179 cd05717 Ig1_Necl-1-3_like Firs  98.5 2.7E-06 5.9E-11   47.7   7.9   22   68-89     63-84  (95)
180 cd05755 Ig2_ICAM-1_like Second  98.4 2.9E-06 6.3E-11   47.9   7.2   37   17-54      7-46  (100)
181 cd00098 IgC Immunoglobulin Con  98.4 1.1E-06 2.3E-11   49.3   5.3   31   24-55     11-43  (95)
182 cd05873 Ig_Sema4D_like Immunog  98.4 1.2E-06 2.6E-11   48.3   5.0   54   75-129     9-71  (87)
183 cd07694 Ig2_CD4 Second immunog  98.3 4.7E-06   1E-10   45.5   6.8   61   21-87      9-71  (88)
184 cd05772 IgC_SIRP Signal-regula  98.3 9.7E-06 2.1E-10   46.8   8.2   47    5-54      2-50  (111)
185 PF00047 ig:  Immunoglobulin do  98.3 6.8E-06 1.5E-10   42.4   6.6   47   79-125     3-64  (64)
186 cd00096 Ig Immunoglobulin doma  98.3 3.9E-06 8.5E-11   43.3   5.7   59   29-88      1-64  (74)
187 PF13927 Ig_3:  Immunoglobulin   98.3 2.6E-06 5.7E-11   45.1   4.9   48   80-127    18-75  (75)
188 cd07698 IgC_MHC_I_alpha3 Class  98.3 2.3E-05   5E-10   43.8   8.6   25   26-51     14-40  (93)
189 cd05884 Ig2_Necl-3 Second immu  98.3 3.4E-05 7.4E-10   42.2   9.0   25   29-54      2-27  (83)
190 cd05741 Ig_CEACAM_D1_like Firs  98.2 1.8E-05 3.8E-10   44.0   7.4   29   63-91     53-81  (92)
191 cd07690 Ig1_CD4 First immunogl  98.2 8.1E-06 1.8E-10   45.7   5.5   21   77-97      7-27  (94)
192 smart00406 IGv Immunoglobulin   98.2 1.2E-05 2.6E-10   43.3   6.1   20  105-124    61-80  (81)
193 cd05845 Ig2_L1-CAM_like Second  98.2 7.9E-06 1.7E-10   45.8   5.3   59   73-131    14-84  (95)
194 cd05751 Ig1_LILRB1_like First   98.1 2.2E-05 4.7E-10   43.7   6.9   68   74-142    13-91  (91)
195 cd07699 IgC_L Immunoglobulin C  98.1 3.1E-05 6.8E-10   43.9   7.4   32   22-54     13-46  (100)
196 cd05896 Ig1_IL1RAPL-1_like Fir  98.1 1.8E-05   4E-10   44.8   6.1   37  104-141    68-104 (104)
197 cd05774 Ig_CEACAM_D1 First imm  98.1 4.7E-05   1E-09   43.5   7.8   31   60-90     63-93  (105)
198 cd05727 Ig2_Contactin-2-like S  98.1 1.7E-05 3.6E-10   44.6   5.8   55   77-131    18-85  (96)
199 smart00407 IGc1 Immunoglobulin  98.1 0.00015 3.3E-09   38.8   8.9   24   29-53      2-27  (75)
200 KOG1480|consensus               98.1 1.1E-05 2.3E-10   59.6   5.5  128    8-141    24-218 (909)
201 cd05771 IgC_Tapasin_R Tapasin-  98.0 5.4E-05 1.2E-09   45.5   7.7   70   68-137     2-76  (139)
202 PF08205 C2-set_2:  CD80-like C  98.0 6.6E-05 1.4E-09   41.5   6.7   27   26-53     14-41  (89)
203 cd05881 Ig1_Necl-2 First (N-te  97.9  0.0003 6.5E-09   39.5   8.8   65   75-141    10-95  (95)
204 cd05770 IgC_beta2m Class I maj  97.9 0.00037   8E-09   39.0   8.7   30   24-54     13-44  (93)
205 cd04983 IgV_TCR_alpha_like Imm  97.9 0.00017 3.8E-09   41.3   7.7   22   68-89     71-92  (109)
206 cd00099 IgV Immunoglobulin var  97.9  0.0001 2.2E-09   41.9   6.5   26  105-130    66-91  (105)
207 cd05766 IgC_MHC_II_beta Class   97.8 0.00037 8.1E-09   39.0   8.3   31   24-55     12-44  (94)
208 cd05769 IgC_TCR_beta T cell re  97.8 0.00047   1E-08   40.1   8.0   33   22-55     14-48  (115)
209 cd05768 IgC_CH4 CH4 domain (fo  97.8  0.0003 6.6E-09   40.0   7.1   31   23-54     13-45  (102)
210 cd05853 Ig6_Contactin-4 Sixth   97.8 2.1E-05 4.5E-10   43.2   2.1   25   65-89     45-69  (85)
211 cd07692 Ig_CD3_epsilon Immunog  97.7 0.00013 2.8E-09   37.6   4.7   52   23-88      4-55  (65)
212 cd04984 IgV_L_lambda Immunoglo  97.7 0.00058 1.3E-08   38.4   7.6   23  106-128    63-85  (98)
213 cd05719 Ig2_PVR_like Second im  97.7  0.0013 2.7E-08   37.0   8.8   23   25-47     14-37  (95)
214 cd05725 Ig3_Robo Third immunog  97.7 4.9E-05 1.1E-09   39.9   2.9   22   69-90     37-58  (69)
215 cd05854 Ig6_Contactin-2 Sixth   97.7 5.2E-05 1.1E-09   41.6   2.8   26   66-91     46-71  (85)
216 cd05892 Ig_Myotilin_C C-termin  97.6 6.1E-05 1.3E-09   40.4   2.8   23   68-90     42-64  (75)
217 cd05721 IgV_CTLA-4 Immunoglobu  97.6  0.0022 4.7E-08   37.1   9.1   31   18-48      5-38  (115)
218 cd05865 Ig1_NCAM-1 First immun  97.6 7.3E-05 1.6E-09   42.1   3.1   24   66-89     59-82  (96)
219 cd05713 Ig_MOG_like Immunoglob  97.6 0.00042 9.1E-09   39.1   6.1   66   26-91      1-89  (100)
220 cd05880 Ig_EVA1 Immunoglobulin  97.6 0.00019 4.1E-09   41.8   4.6   26   66-91     78-103 (115)
221 cd05855 Ig_TrkB_d5 Fifth domai  97.6 0.00011 2.4E-09   39.8   3.2   23   67-89     44-66  (79)
222 cd05767 IgC_MHC_II_alpha Class  97.6  0.0031 6.7E-08   35.3   9.1   29   25-54     14-44  (94)
223 cd05866 Ig1_NCAM-2 First immun  97.6 8.1E-05 1.8E-09   41.5   2.7   24   67-90     56-79  (92)
224 cd04977 Ig1_NCAM-1_like First   97.5 0.00012 2.6E-09   40.8   3.3   24   66-89     56-79  (92)
225 cd05742 Ig1_VEGFR_like First i  97.5 8.3E-05 1.8E-09   40.6   2.6   25   66-90     48-72  (84)
226 cd05861 Ig1_PDGFR-alphabeta Fr  97.5 0.00012 2.7E-09   40.0   3.2   25   66-90     45-69  (84)
227 cd04974 Ig3_FGFR Third immunog  97.5 0.00011 2.4E-09   40.7   3.0   24   67-90     55-78  (90)
228 cd05893 Ig_Palladin_C C-termin  97.5 8.3E-05 1.8E-09   39.8   2.4   23   68-90     42-64  (75)
229 PHA02633 hypothetical protein;  97.5  0.0004 8.6E-09   35.3   4.6   36  105-141    17-52  (63)
230 cd05870 Ig5_NCAM-2 Fifth immun  97.5 0.00014 3.1E-09   40.9   3.4   24   67-90     64-87  (98)
231 cd05735 Ig8_DSCAM Eight immuno  97.5 0.00013 2.9E-09   40.3   3.0   23   67-89     47-69  (88)
232 cd05858 Ig3_FGFR-2 Third immun  97.5 8.8E-05 1.9E-09   41.1   2.2   24   67-90     55-78  (90)
233 cd05763 Ig_1 Subgroup of the i  97.5 0.00019 4.2E-09   38.2   3.5   22   68-89     41-62  (75)
234 cd05744 Ig_Myotilin_C_like Imm  97.5 0.00016 3.5E-09   38.7   3.1   23   68-90     42-64  (75)
235 cd05879 Ig_P0 Immunoglobulin (  97.5  0.0013 2.9E-08   38.3   7.1   26   66-91     79-104 (116)
236 cd05862 Ig1_VEGFR First immuno  97.5 0.00017 3.6E-09   39.7   3.2   64   26-89      1-72  (86)
237 PF07654 C1-set:  Immunoglobuli  97.5  0.0018 3.8E-08   35.3   7.3   30   25-55      7-38  (83)
238 cd05740 Ig_CEACAM_D4 Fourth im  97.5 0.00014 3.1E-09   40.4   2.9   24   68-91     56-79  (91)
239 cd07703 Ig2_Nectin-2_like Seco  97.4  0.0042   9E-08   34.9   8.7   22   26-47     15-37  (95)
240 cd05869 Ig5_NCAM-1 Fifth immun  97.4  0.0002 4.2E-09   40.3   3.3   24   67-90     63-86  (97)
241 cd05732 Ig5_NCAM-1_like Fifth   97.4 0.00019 4.2E-09   40.1   3.3   24   67-90     62-85  (96)
242 cd05748 Ig_Titin_like Immunogl  97.4 0.00021 4.5E-09   38.0   3.2   22   68-89     41-62  (74)
243 cd07697 IgC_TCR_gamma T cell r  97.4  0.0015 3.2E-08   36.8   6.7   31   23-54     13-45  (96)
244 cd05886 Ig1_Nectin-1_like Firs  97.4 0.00027 5.8E-09   40.0   3.7   25   67-91     63-87  (99)
245 cd05872 Ig_Sema4B_like Immunog  97.4 0.00069 1.5E-08   37.2   5.2   47   79-126    13-67  (85)
246 cd05899 IgV_TCR_beta Immunoglo  97.4  0.0016 3.5E-08   37.4   7.1   25  105-129    71-95  (110)
247 cd05847 IgC_CH2_IgE CH2 domain  97.4  0.0016 3.4E-08   36.5   6.7   28   25-53     13-42  (94)
248 cd07696 IgC_CH3 CH3 domain (th  97.4 0.00038 8.1E-09   39.2   4.2   29   22-51     10-41  (96)
249 cd05711 Ig_FcalphaRI Immunoglo  97.4   0.002 4.4E-08   36.0   7.0   37  105-141    54-94  (94)
250 cd05851 Ig3_Contactin-1 Third   97.4 0.00023 5.1E-09   39.3   2.9   24   68-91     54-77  (88)
251 cd05902 Ig_Neurocan Immunoglob  97.4   0.001 2.2E-08   38.4   5.6   63   26-88      2-93  (110)
252 cd05743 Ig_Perlecan_D2_like Im  97.3 0.00022 4.7E-09   38.4   2.7   23   68-90     43-65  (78)
253 cd05894 Ig_C5_MyBP-C C5 immuno  97.3 0.00032 6.9E-09   38.6   3.3   24   66-89     51-74  (86)
254 cd05901 Ig_Versican Immunoglob  97.3  0.0043 9.3E-08   36.2   8.1   23   67-89     79-101 (117)
255 cd05859 Ig4_PDGFR-alpha Fourth  97.3 0.00021 4.6E-09   40.6   2.6   26   65-90     63-88  (101)
256 cd05765 Ig_3 Subgroup of the i  97.3 0.00031 6.8E-09   37.9   3.1   25   65-89     45-69  (81)
257 cd05737 Ig_Myomesin_like_C C-t  97.3  0.0003 6.6E-09   39.1   3.0   22   68-89     59-80  (92)
258 cd04968 Ig3_Contactin_like Thi  97.3 0.00038 8.3E-09   38.3   3.3   23   68-90     54-76  (88)
259 cd05888 Ig1_Nectin-4_like Frst  97.3 0.00045 9.7E-09   39.1   3.6   63   28-90      2-87  (100)
260 cd05882 Ig1_Necl-1 First (N-te  97.3 0.00034 7.4E-09   39.3   3.0   22   67-88     62-83  (95)
261 cd05889 Ig1_DNAM-1_like First   97.3 0.00054 1.2E-08   38.5   3.7   66   27-92      1-85  (96)
262 cd07689 Ig2_VCAM-1 Second immu  97.3  0.0024 5.3E-08   35.9   6.2   30   23-53     12-44  (99)
263 cd05887 Ig1_Nectin-3_like Firs  97.2 0.00068 1.5E-08   38.1   3.7   65   27-91      1-84  (96)
264 cd04973 Ig1_FGFR First immunog  97.2 0.00043 9.4E-09   37.3   2.8   21   69-89     47-67  (79)
265 cd04985 IgC_CH1 CH1 domain (fi  97.2  0.0034 7.4E-08   35.2   6.4   27   25-52     15-43  (95)
266 cd05775 Ig_SLAM-CD84_like_N N-  97.2   0.001 2.2E-08   37.5   4.2   67   24-91      2-85  (97)
267 cd05863 Ig2_VEGFR-3 Second imm  97.1 0.00032   7E-09   36.7   1.9   22   69-90     33-54  (67)
268 PHA02982 hypothetical protein;  97.1   0.028   6E-07   36.0  10.5  117   21-138    34-170 (251)
269 cd05730 Ig3_NCAM-1_like Third   97.1 0.00058 1.3E-08   38.1   2.9   24   68-91     59-82  (95)
270 cd05715 Ig_P0-like Immunoglobu  97.1 0.00092   2E-08   38.9   3.8   25   67-91     80-104 (116)
271 cd07691 Ig_CD3_gamma_delta Imm  97.1  0.0018 3.9E-08   33.7   4.3   49   26-88      6-54  (69)
272 cd05747 Ig5_Titin_like M5, fif  97.1 0.00074 1.6E-08   37.5   3.2   23   67-89     59-81  (92)
273 cd05762 Ig8_MLCK Eighth immuno  97.1 0.00058 1.3E-08   38.5   2.7   23   68-90     57-79  (98)
274 cd05736 Ig2_Follistatin_like S  97.1 0.00084 1.8E-08   35.8   3.2   22   68-89     40-61  (76)
275 PF07679 I-set:  Immunoglobulin  97.1 0.00063 1.4E-08   37.4   2.7   22   68-89     57-78  (90)
276 cd05756 Ig1_IL1R_like First im  97.1 0.00068 1.5E-08   37.9   2.8   24   66-89     59-82  (94)
277 PF07354 Sp38:  Zona-pellucida-  97.0  0.0015 3.2E-08   43.0   4.6   49   38-88     10-58  (271)
278 cd07694 Ig2_CD4 Second immunog  97.0   0.015 3.3E-07   31.9   7.9   47   82-128    19-73  (88)
279 cd04982 IgV_TCR_gamma Immunogl  97.0  0.0064 1.4E-07   35.2   6.8   24  105-128    76-99  (116)
280 cd05857 Ig2_FGFR Second immuno  97.0  0.0011 2.4E-08   36.1   3.3   23   67-89     51-73  (85)
281 cd05900 Ig_Aggrecan Immunoglob  97.0  0.0039 8.5E-08   36.1   5.7   64   25-88      1-95  (112)
282 cd05728 Ig4_Contactin-2-like F  97.0 0.00079 1.7E-08   36.8   2.7   23   69-91     53-75  (85)
283 cd04972 Ig_TrkABC_d4 Fourth do  97.0  0.0011 2.4E-08   36.6   3.3   23   68-90     57-79  (90)
284 cd05714 Ig_CSPGs_LP Immunoglob  97.0 0.00072 1.6E-08   38.6   2.5   65   25-89      1-90  (106)
285 cd05852 Ig5_Contactin-1 Fifth   97.0 0.00062 1.3E-08   36.2   2.1   22   69-90     41-62  (73)
286 cd05718 Ig1_PVR_like First imm  97.0  0.0014 3.1E-08   36.6   3.7   63   27-89      1-84  (98)
287 cd05745 Ig3_Peroxidasin Third   97.0 0.00075 1.6E-08   35.9   2.3   21   69-89     42-62  (74)
288 cd07706 IgV_TCR_delta Immunogl  96.9   0.014   3E-07   33.8   7.8   24  105-128    71-94  (116)
289 KOG3515|consensus               96.9  0.0048   1E-07   46.5   6.8  121   18-140   307-491 (741)
290 cd05878 Ig_Aggrecan_like Immun  96.9  0.0085 1.8E-07   34.5   6.5   65   25-89      1-94  (110)
291 cd05876 Ig3_L1-CAM Third immun  96.9 0.00077 1.7E-08   35.5   2.0   23   68-90     37-59  (71)
292 cd00096 Ig Immunoglobulin doma  96.9  0.0066 1.4E-07   30.7   5.6   48   82-129     3-66  (74)
293 cd05846 Ig1_MRC-OX-2_like Firs  96.9  0.0014   3E-08   36.9   3.0   65   26-90      1-84  (97)
294 cd05773 Ig8_hNephrin_like Eigh  96.8  0.0018 3.9E-08   37.2   3.4   25   66-90     68-93  (109)
295 cd05723 Ig4_Neogenin Fourth im  96.8  0.0014   3E-08   34.5   2.7   21   69-89     39-59  (71)
296 cd04969 Ig5_Contactin_like Fif  96.8 0.00095 2.1E-08   35.3   2.0   21   69-89     41-61  (73)
297 cd05731 Ig3_L1-CAM_like Third   96.8 0.00081 1.8E-08   35.2   1.5   23   68-90     37-59  (71)
298 cd04970 Ig6_Contactin_like Six  96.8 0.00088 1.9E-08   36.6   1.7   26   65-90     45-70  (85)
299 PF11465 Receptor_2B4:  Natural  96.8  0.0069 1.5E-07   34.4   5.2   37  105-141    70-106 (108)
300 cd07704 Ig2_Nectin-3-4_like Se  96.7   0.014   3E-07   32.9   6.3   30   18-47      8-39  (97)
301 cd05877 Ig_LP_like Immunoglobu  96.7  0.0017 3.7E-08   37.0   2.7   64   25-88      1-89  (106)
302 cd05726 Ig4_Robo Fhird immunog  96.7  0.0016 3.5E-08   36.0   2.5   28   64-91     44-71  (90)
303 cd04975 Ig4_SCFR_like Fourth i  96.7  0.0014   3E-08   37.2   2.2   24   66-89     64-87  (101)
304 cd05734 Ig7_DSCAM Seventh immu  96.7   0.002 4.4E-08   34.6   2.7   26   65-90     42-67  (79)
305 KOG1480|consensus               96.7  0.0021 4.7E-08   48.1   3.5   79   17-98    135-214 (909)
306 cd04986 IgC_CH2 CH2 domain (se  96.7   0.012 2.5E-07   33.3   5.7   30   22-52     15-47  (99)
307 cd05724 Ig2_Robo Second immuno  96.7  0.0024 5.2E-08   34.8   2.9   23   69-91     53-75  (86)
308 cd05867 Ig4_L1-CAM_like Fourth  96.7  0.0016 3.5E-08   34.7   2.2   23   68-90     42-64  (76)
309 cd05738 Ig2_RPTP_IIa_LAR_like   96.6  0.0018 3.9E-08   34.4   2.3   23   69-91     40-62  (74)
310 cd05733 Ig6_L1-CAM_like Sixth   96.5  0.0045 9.7E-08   33.1   3.4   23   69-91     41-67  (77)
311 cd04978 Ig4_L1-NrCAM_like Four  96.5  0.0021 4.5E-08   34.2   2.0   24   67-90     41-64  (76)
312 cd05764 Ig_2 Subgroup of the i  96.4  0.0032 6.9E-08   33.3   2.4   22   69-90     42-63  (74)
313 cd05868 Ig4_NrCAM Fourth immun  96.4  0.0029 6.4E-08   33.8   2.0   22   69-90     43-64  (76)
314 cd05716 Ig_pIgR Immunoglobulin  96.3  0.0062 1.3E-07   34.1   3.4   22  107-128    65-86  (98)
315 cd05856 Ig2_FGFRL1-like Second  96.3   0.003 6.6E-08   33.9   2.0   23   68-90     49-71  (82)
316 PF07686 V-set:  Immunoglobulin  96.3  0.0035 7.5E-08   35.7   2.3   23   67-89     79-101 (114)
317 cd00098 IgC Immunoglobulin Con  96.2   0.026 5.6E-07   31.2   5.6   54   77-130    13-86  (95)
318 cd05898 Ig5_KIRREL3 Fifth immu  96.2  0.0072 1.6E-07   34.1   3.0   23   67-89     64-87  (98)
319 cd05753 Ig2_FcgammaR_like Seco  96.2  0.0043 9.4E-08   33.8   2.0   21   69-89     50-70  (83)
320 cd05891 Ig_M-protein_C C-termi  96.1  0.0051 1.1E-07   34.2   2.2   23   67-89     58-80  (92)
321 cd05874 Ig6_NrCAM Sixth immuno  96.1   0.011 2.5E-07   31.6   3.4   24  116-139    53-76  (77)
322 smart00409 IG Immunoglobulin.   96.1   0.011 2.5E-07   31.3   3.4   24   66-89     50-73  (86)
323 smart00410 IG_like Immunoglobu  96.1   0.011 2.5E-07   31.3   3.4   24   66-89     50-73  (86)
324 cd04979 Ig_Semaphorin_C Immuno  95.9  0.0058 1.3E-07   33.6   1.8   21   69-89     53-73  (89)
325 PF05790 C2-set:  Immunoglobuli  95.9    0.12 2.6E-06   28.0   6.8   36  105-141    42-78  (80)
326 cd05875 Ig6_hNeurofascin_like   95.8   0.018 3.9E-07   30.8   3.5   23   69-91     41-67  (77)
327 cd04980 IgV_L_kappa Immunoglob  95.8  0.0065 1.4E-07   34.6   1.9   21   68-88     72-92  (106)
328 cd05712 Ig_Siglec_N Immunoglob  95.8   0.013 2.8E-07   34.2   3.0   22  106-127    80-101 (119)
329 PF06328 Lep_receptor_Ig:  Ig-l  95.7    0.14 3.1E-06   28.3   6.9   65   18-85     10-80  (89)
330 smart00406 IGv Immunoglobulin   95.7   0.006 1.3E-07   32.5   1.3   59   28-86      1-81  (81)
331 cd05848 Ig1_Contactin-5 First   95.7   0.013 2.8E-07   32.7   2.6   23   69-91     60-83  (94)
332 cd05860 Ig4_SCFR Fourth immuno  95.5   0.018   4E-07   32.6   2.9   25   65-89     63-87  (101)
333 PF08204 V-set_CD47:  CD47 immu  95.5  0.0072 1.6E-07   35.8   1.2   31   22-53     23-58  (130)
334 cd05729 Ig2_FGFR_like Second i  95.5   0.019 4.2E-07   30.8   2.9   23   67-89     51-73  (85)
335 PHA02633 hypothetical protein;  95.5   0.021 4.5E-07   29.1   2.7   25   65-89     16-40  (63)
336 PHA02987 Ig domain OX-2-like p  95.5   0.018   4E-07   36.2   3.0   24   66-89     84-107 (189)
337 cd07693 Ig1_Robo First immunog  95.4   0.019 4.1E-07   31.9   2.7   21   71-91     68-88  (100)
338 cd05849 Ig1_Contactin-1 First   95.4   0.021 4.5E-07   31.8   2.8   22   69-90     59-81  (93)
339 cd05720 Ig_CD8_alpha Immunoglo  95.1   0.018 3.9E-07   32.7   2.0   20  107-126    70-89  (104)
340 cd05850 Ig1_Contactin-2 First   95.0   0.029 6.3E-07   31.2   2.7   23   69-91     60-83  (94)
341 cd07700 IgV_CD8_beta Immunoglo  95.0   0.018   4E-07   32.9   1.9   20   68-87     73-92  (107)
342 PF13895 Ig_2:  Immunoglobulin   94.7   0.029 6.2E-07   29.6   2.0   30  112-141    51-80  (80)
343 PHA03376 BARF1; Provisional     94.6     0.1 2.2E-06   33.1   4.4   26  103-128    84-109 (221)
344 KOG4597|consensus               94.4    0.14   3E-06   36.9   5.2   28   20-47    205-232 (560)
345 cd04981 IgV_H Immunoglobulin (  94.4   0.065 1.4E-06   31.2   3.2   17   69-85     78-94  (117)
346 PHA02914 Immunoglobulin-like d  94.3    0.58 1.3E-05   33.2   7.9   70   19-89    272-368 (500)
347 cd05755 Ig2_ICAM-1_like Second  94.3    0.41 8.8E-06   27.2   6.2   56   75-131    14-87  (100)
348 cd05749 Ig2_Tyro3_like Second   94.2    0.08 1.7E-06   28.7   3.1   15   77-91     57-71  (81)
349 PHA03042 CD47-like protein; Pr  93.6    0.34 7.3E-06   32.5   5.6   59   23-88     28-91  (286)
350 PHA02865 MHC-like TNF binding   93.2    0.83 1.8E-05   31.8   7.1   21   28-49    216-238 (338)
351 cd05722 Ig1_Neogenin First imm  93.1   0.097 2.1E-06   29.0   2.4   15   75-89     67-81  (95)
352 PF07354 Sp38:  Zona-pellucida-  92.7    0.24 5.3E-06   33.0   4.0   30  100-129    31-60  (271)
353 cd05885 Ig2_Necl-4 Second immu  92.4    0.21 4.5E-06   27.1   2.9   27   65-91     41-67  (80)
354 PHA03240 envelope glycoprotein  92.0    0.62 1.4E-05   30.1   5.0   66   19-84     31-122 (258)
355 cd05759 Ig2_KIRREL3-like Secon  91.4    0.24 5.3E-06   26.6   2.5   24   67-90     46-69  (82)
356 cd07691 Ig_CD3_gamma_delta Imm  91.0    0.92   2E-05   23.8   4.2   36   92-127    17-54  (69)
357 cd07698 IgC_MHC_I_alpha3 Class  90.6     1.8 3.9E-05   23.9   6.3   53   77-129    14-83  (93)
358 PHA03052 Hypothetical protein;  90.4     1.6 3.4E-05   22.8   5.2   35   18-53      4-41  (69)
359 PHA03189 UL14 tegument protein  90.0     4.7  0.0001   27.8   8.2   21   18-38     59-79  (348)
360 PHA03270 envelope glycoprotein  87.3     9.2  0.0002   27.8  11.2   34   20-54    228-264 (466)
361 PF05790 C2-set:  Immunoglobuli  86.5     3.6 7.9E-05   22.3   6.0   22   66-87     42-63  (80)
362 PHA02982 hypothetical protein;  84.6     8.8 0.00019   25.1   7.4   31  101-131    95-125 (251)
363 PF11465 Receptor_2B4:  Natural  84.5     1.7 3.6E-05   25.0   3.0   26   65-90     69-94  (108)
364 PHA03042 CD47-like protein; Pr  83.2      12 0.00026   25.4   7.0   50   80-130    34-94  (286)
365 PHA03282 envelope glycoprotein  81.5     4.7  0.0001   29.5   4.8   49   92-141   111-160 (540)
366 PHA02914 Immunoglobulin-like d  79.2       6 0.00013   28.4   4.7   24   68-91     82-105 (500)
367 PHA03271 envelope glycoprotein  79.0      15 0.00032   26.7   6.5   34   21-55    255-291 (490)
368 cd05721 IgV_CTLA-4 Immunoglobu  77.4     3.5 7.6E-05   24.1   2.7   20  107-126    75-94  (115)
369 PF02440 Adeno_E3_CR1:  Adenovi  75.7     9.2  0.0002   19.7   5.7   21   23-47      2-22  (63)
370 cd05766 IgC_MHC_II_beta Class   73.0      14  0.0003   20.5   6.5   53   77-129    14-83  (94)
371 cd07697 IgC_TCR_gamma T cell r  72.3      15 0.00032   20.6   6.2   23   77-99     16-40  (96)
372 cd05770 IgC_beta2m Class I maj  71.3      16 0.00034   20.4   6.4   48   81-128    19-82  (93)
373 PHA03269 envelope glycoprotein  70.9      41  0.0009   25.1  10.8   35   20-55    336-373 (566)
374 PHA03286 envelope glycoprotein  70.6      13 0.00029   27.1   4.7   38  104-141   125-162 (492)
375 PHA03283 envelope glycoprotein  66.6      28  0.0006   26.1   5.7   39  103-142   131-169 (542)
376 PF06832 BiPBP_C:  Penicillin-B  66.5      19 0.00042   19.6   6.6   45    7-54      9-55  (89)
377 PF02480 Herpes_gE:  Alphaherpe  64.2     2.2 4.8E-05   31.0   0.0   37  105-141    88-124 (439)
378 PF11049 KSHV_K1:  Glycoprotein  63.9      19 0.00042   18.7   3.6   44   30-88      2-45  (71)
379 cd05767 IgC_MHC_II_alpha Class  63.5      24 0.00052   19.6   6.7   51   79-129    17-84  (94)
380 PF15096 G6B:  G6B family        62.6      15 0.00032   23.5   3.3   15   74-88     81-95  (224)
381 cd05890 Ig2_Nectin-1_like Seco  58.8      32 0.00069   19.5   5.8   18   30-47     24-42  (98)
382 PHA03273 envelope glycoprotein  58.2      75  0.0016   23.6   6.8   34   20-54    244-280 (486)
383 KOG3611|consensus               51.5      25 0.00054   27.7   3.6   61   28-89    571-634 (737)
384 PHA03281 envelope glycoprotein  49.9      60  0.0013   24.7   5.1   39  104-142   296-334 (642)
385 PHA03286 envelope glycoprotein  46.0      72  0.0016   23.6   4.9   31  107-138   308-338 (492)
386 PHA02935 Hypothetical protein;  43.1      41 0.00089   21.9   3.1   18   69-86    104-121 (349)
387 PF03921 ICAM_N:  Intercellular  40.6      67  0.0015   17.9   7.7   30   17-47      9-39  (91)
388 PF01688 Herpes_gI:  Alphaherpe  35.8 1.1E+02  0.0025   19.1   4.8   25  105-129   123-147 (161)
389 PHA03282 envelope glycoprotein  35.5 1.1E+02  0.0024   22.9   4.5   32  106-138   333-364 (540)
390 PF10572 UPF0556:  Uncharacteri  34.9 1.2E+02  0.0025   19.0   6.8   12  117-128    71-82  (158)
391 PF12988 DUF3872:  Domain of un  30.7      92   0.002   18.9   3.1   30   22-51     43-77  (137)
392 PF11327 DUF3129:  Protein of u  28.4 1.3E+02  0.0027   19.3   3.6   26   68-93     94-119 (184)
393 PF02480 Herpes_gE:  Alphaherpe  27.9      83  0.0018   23.3   3.1   35  104-139   267-301 (439)
394 COG5475 Uncharacterized small   26.9      96  0.0021   15.6   2.3   13  119-131    29-41  (60)
395 PF11781 RRN7:  RNA polymerase   23.5      43 0.00094   15.0   0.7   10  115-124    20-29  (36)
396 KOG3743|consensus               22.3 1.1E+02  0.0024   23.3   2.8   29   19-47    376-404 (622)
397 PRK15372 pathogenicity island   22.3      66  0.0014   21.8   1.6   12  112-123    79-90  (292)
398 PHA03290 envelope glycoprotein  22.2 1.4E+02   0.003   21.3   3.1   25  104-128   127-151 (357)
399 PHA03283 envelope glycoprotein  20.7 3.2E+02  0.0069   21.0   4.8   33  105-138   314-346 (542)
400 PHA03292 envelope glycoprotein  20.2 3.5E+02  0.0077   19.8   4.7   26  104-129   126-151 (413)

No 1  
>KOG3513|consensus
Probab=99.91  E-value=3.7e-23  Score=152.25  Aligned_cols=134  Identities=26%  Similarity=0.491  Sum_probs=112.6

Q ss_pred             cccCCCeeeecCCCCceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEE
Q psy15390          4 YKSVPPNILDTESTPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYL   83 (142)
Q Consensus         4 ~~~~~p~~~~~~~~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~   83 (142)
                      .+..+|++..   .++...+..|++++|.|.+.|.|.|.+.|++ +|.++....+..-.....+.|+|.+++..|+|+|+
T Consensus       327 ~v~a~P~w~~---~~~d~~~~~gs~v~~eC~a~g~P~p~v~Wlk-Ng~pl~~~~r~~~~~i~~g~L~is~v~~~dsg~YQ  402 (1051)
T KOG3513|consen  327 TVYAPPYWLQ---KPQDTEADTGSNVTLECKASGKPNPTVKWLK-NGEPLEPAERDPRYKIDDGTLIISNVQESDSGVYQ  402 (1051)
T ss_pred             EEecCchhhc---ccceeEecCCCCeEEEEEecCCCCCceEEee-CCeecCccCCCcceEEeCCEEEEEecccccCeEEE
Confidence            4567899998   8999999999999999999999999999999 99888754432223445678999999999999999


Q ss_pred             EEEEec---------------------------------------------CCccEEEEE---------EEeccccceEE
Q psy15390         84 CIATKI---------------------------------------------GPLKIFWEI---------IFHMHYGEQLN  109 (142)
Q Consensus        84 C~~~~~---------------------------------------------~~~~~~w~~---------~~~~~~~~~l~  109 (142)
                      |.+.|.                                             +.+.++|.+         ++.+..+++|.
T Consensus       403 C~A~Nk~G~i~anA~L~V~a~~P~f~~~p~~~~~~a~~g~~v~i~C~~~asP~p~~~W~k~~~~~~~~~r~~i~edGtL~  482 (1051)
T KOG3513|consen  403 CIAENKYGTIYANAELKVLASAPVFPLNPVERKVMAVVGGTVTIDCKPFASPKPKVSWLKGGEKLLQSGRIRILEDGTLE  482 (1051)
T ss_pred             eeeecccceEeeeeEEEEEccCCCCCCCccceEEEEEeCCeEEEeeccCCCCcceEEEEcCCcccccCceEEECCCCcEE
Confidence            999986                                             446788964         34455688999


Q ss_pred             EccCCCCCCeEEEEEEecCCCCCeeeEEEEEEC
Q psy15390        110 ITKISRTEMGAYLCIATNNVPPSVSKRITVDVE  142 (142)
Q Consensus       110 i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V~  142 (142)
                      |.+++.+|+|.|+|.|.|..|. +.....|.|+
T Consensus       483 I~n~t~~DaG~YtC~A~N~~G~-a~~~~~L~Vk  514 (1051)
T KOG3513|consen  483 ISNVTRSDAGKYTCVAENKLGK-AESTGNLIVK  514 (1051)
T ss_pred             ecccCcccCcEEEEEEEcccCc-cceEEEEEEe
Confidence            9999999999999999999996 6777888775


No 2  
>KOG3513|consensus
Probab=99.85  E-value=3.2e-20  Score=137.02  Aligned_cols=131  Identities=27%  Similarity=0.477  Sum_probs=105.7

Q ss_pred             cCCCeeeecCCCCceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEE
Q psy15390          6 SVPPNILDTESTPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCI   85 (142)
Q Consensus         6 ~~~p~~~~~~~~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~   85 (142)
                      ..+|.+..+  .++.....+|+.|.|.|.+.|.|.|++.|.+.+|..+.   +.......+..|.|.+++.+|+|.|.|.
T Consensus       238 ~~~P~i~~~--~p~~~~a~~G~~v~LECfA~G~P~P~i~W~k~~g~~~~---~r~~~~~~~~vL~I~nv~~~D~G~Y~C~  312 (1051)
T KOG3513|consen  238 EYAPKILVP--FPETETALKGQSVKLECFALGNPTPQIKWRKVDGKPPP---RRATYSNYGKVLKIPNVQYEDAGEYECI  312 (1051)
T ss_pred             ccCCccccC--CCCcccccCCCeEEEEEEecCCCCCcEEEEeCCCCCCC---cceeeeccccEEEecccCcCCCeEEEEE
Confidence            457887764  45577888999999999999999999999996665432   2222355667899999999999999999


Q ss_pred             EEec------------------------------------------CCccEEEEEEE-----------eccccceEEEcc
Q psy15390         86 ATKI------------------------------------------GPLKIFWEIIF-----------HMHYGEQLNITK  112 (142)
Q Consensus        86 ~~~~------------------------------------------~~~~~~w~~~~-----------~~~~~~~l~i~~  112 (142)
                      +.|.                                          +.+.+.|.++.           .....+.|.|++
T Consensus       313 AeN~~G~~~~~~~v~v~a~P~w~~~~~d~~~~~gs~v~~eC~a~g~P~p~v~WlkNg~pl~~~~r~~~~~i~~g~L~is~  392 (1051)
T KOG3513|consen  313 AENSRGSATHSGHVTVYAPPYWLQKPQDTEADTGSNVTLECKASGKPNPTVKWLKNGEPLEPAERDPRYKIDDGTLIISN  392 (1051)
T ss_pred             EecccccceeeEEEEEecCchhhcccceeEecCCCCeEEEEEecCCCCCceEEeeCCeecCccCCCcceEEeCCEEEEEe
Confidence            9986                                          44788897653           333467899999


Q ss_pred             CCCCCCeEEEEEEecCCCCCeeeEEEEEEC
Q psy15390        113 ISRTEMGAYLCIATNNVPPSVSKRITVDVE  142 (142)
Q Consensus       113 ~~~~d~g~y~C~a~n~~~~~~s~~~~l~V~  142 (142)
                      ++.+|+|.|.|.|+|..|. +...+.|.|.
T Consensus       393 v~~~dsg~YQC~A~Nk~G~-i~anA~L~V~  421 (1051)
T KOG3513|consen  393 VQESDSGVYQCIAENKYGT-IYANAELKVL  421 (1051)
T ss_pred             cccccCeEEEeeeecccce-EeeeeEEEEE
Confidence            9999999999999999996 7778888773


No 3  
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). Ig8_MLCK: the eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). MLCK is a key regulator of different forms of cell motility involving actin and myosin II.  Agonist stimulation of smooth muscle cells increases cytosolic Ca2+, which binds calmodulin.  This Ca2+-calmodulin complex in turn binds to and activates MLCK. Activated MLCK leads to the phosphorylation of the 20 kDa myosin regulatory light chain (RLC) of myosin II and the stimulation of actin-activated myosin MgATPase activity. MLCK is widely present in vertebrate tissues; it phosphorylates the 20 kDa RLC of both smooth and nonmuscle myosin II. Phosphorylation leads to the activation of the myosin motor domain and altered structural properties of myosin II. In smooth muscle MLCK it is involved in initiating contraction. In nonmuscle cells, MLCK may participate in cell division and cell motility; it has
Probab=99.77  E-value=1.6e-17  Score=94.12  Aligned_cols=90  Identities=21%  Similarity=0.361  Sum_probs=67.6

Q ss_pred             CeeeecCCCCceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEe
Q psy15390          9 PNILDTESTPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATK   88 (142)
Q Consensus         9 p~~~~~~~~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~   88 (142)
                      |.|..   .++.+.+..|+.+.|.|.+.|.|.+.+.|++ +++.+....+.++...                        
T Consensus         1 p~~~~---~p~~~~v~~G~~v~l~C~~~G~p~p~v~W~k-dg~~l~~~~~~~~~~~------------------------   52 (98)
T cd05762           1 PQIIQ---FPEDMKVRAGESVELFCKVTGTQPITCTWMK-FRKQIQEGEGIKIENT------------------------   52 (98)
T ss_pred             CceEE---CCcCEEEECCCEEEEEEEEcccCCCceEEEE-CCEEecCCCcEEEEec------------------------
Confidence            55666   7788899999999999999999999999999 8887753321111100                        


Q ss_pred             cCCccEEEEEEEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390         89 IGPLKIFWEIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus        89 ~~~~~~~w~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                                    ...+.|.|..+..+|+|.|+|.|.|..|. ....+.|.|
T Consensus        53 --------------~~~s~L~I~~~~~~D~G~Ytc~a~N~~G~-~~~~~~l~V   90 (98)
T cd05762          53 --------------ENSSKLTITEGQQEHCGCYTLEVENKLGS-RQAQVNLTV   90 (98)
T ss_pred             --------------CCeeEEEECCCChhhCEEEEEEEEcCCCc-eeEEEEEEE
Confidence                          01235788888888999999999998886 566777766


No 4  
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig3_Contactin-1: Third Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=99.77  E-value=1.8e-17  Score=92.18  Aligned_cols=88  Identities=28%  Similarity=0.423  Sum_probs=68.0

Q ss_pred             CCeeeecCCCCceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEE
Q psy15390          8 PPNILDTESTPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIAT   87 (142)
Q Consensus         8 ~p~~~~~~~~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~   87 (142)
                      ||.+..   .+....+.+|+.+.|.|.+.|.|.|.+.|++ ++..+....  ++.                         
T Consensus         1 ~p~i~~---~~~~~~~~~G~~v~l~C~~~G~P~P~v~W~k-~~~~~~~~~--~~~-------------------------   49 (88)
T cd05851           1 PADINV---KFKDTYALKGQNVTLECFALGNPVPVIRWRK-ILEPMPATA--EIS-------------------------   49 (88)
T ss_pred             CCceEE---ccccEEEeCCCcEEEEEEecccCCCEEEEEE-CCcCCCCCC--EEe-------------------------
Confidence            577777   7778889999999999999999999999999 665442210  000                         


Q ss_pred             ecCCccEEEEEEEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEEC
Q psy15390         88 KIGPLKIFWEIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDVE  142 (142)
Q Consensus        88 ~~~~~~~~w~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V~  142 (142)
                                     ..+..|.|.+++.+|+|.|+|.|.|..|. .+..+.|.|+
T Consensus        50 ---------------~~~~~L~I~~v~~~D~G~Y~C~A~N~~G~-~~~~~~l~V~   88 (88)
T cd05851          50 ---------------MSGAVLKIFNIQPEDEGTYECEAENIKGK-DKHQARVYVQ   88 (88)
T ss_pred             ---------------cCCCEEEECcCChhhCEEEEEEEEcCCCc-eEEEEEEEEC
Confidence                           01235888889999999999999999996 6777888875


No 5  
>PHA02826 IL-1 receptor-like protein; Provisional
Probab=99.72  E-value=2.4e-16  Score=101.54  Aligned_cols=122  Identities=17%  Similarity=0.308  Sum_probs=84.3

Q ss_pred             ceeEEecCCcEEEEEEEecC-----------CCCeeEEEecCCcce--ec-CCc---c----eEEeeccceEEEeecCCC
Q psy15390         19 SSVAVREEFNITLTCKAEGF-----------PAPEIKWRREDNQPI--SI-NKR---K----KVHMHYGEQLNITKISRT   77 (142)
Q Consensus        19 ~~~~~~~g~~v~l~C~~~~~-----------~~~~~~w~~~~~~~~--~~-~~~---~----~~~~~~~~~l~i~~v~~~   77 (142)
                      ..+.+.+|+++.|.|.+.+.           ..+.+.|++ ++...  .. +.+   .    .....++..|.|.+++.+
T Consensus        30 ~~~~v~eGe~v~L~C~~~~~~~~~~~~~~~~~~~~V~W~k-~~s~~~v~~~~~~~~~~~i~~~~~~~r~~~L~I~~v~~~  108 (227)
T PHA02826         30 TPVYAKFGDPMVLLCTGKHYKKSIFFDKTFITSYNVTWSK-TDSLAFVRDSGARTKIKKITHNEIGDRSENLWIGNVINI  108 (227)
T ss_pred             ceEEecCCCCEEEEccccccccccccccccCCCccEEEEe-CCeEEEEEcCCCccccccccccceecCCCeEEECCCChH
Confidence            46788999999999997653           345899999 55432  11 111   0    000123568999999999


Q ss_pred             CCeEEEEEEEec-----------------------------------------CCccEEEEEEEec----------cccc
Q psy15390         78 EMGAYLCIATKI-----------------------------------------GPLKIFWEIIFHM----------HYGE  106 (142)
Q Consensus        78 d~G~y~C~~~~~-----------------------------------------~~~~~~w~~~~~~----------~~~~  106 (142)
                      |+|.|.|++.|.                                         +.+.++|.+....          ...+
T Consensus       109 DsG~Y~C~a~N~~~~~~~~i~L~V~~~~~~~~~~~G~~v~L~C~~~~~~~~~~p~p~I~WyKng~~l~~~~r~~~~~~~~  188 (227)
T PHA02826        109 DEGIYICTISSGNICEESTIRLTFDSGTINYQFNSGKDSKLHCYGTDGISSTFKDYTLTWYKNGNIVLYTDRIQLRNNNS  188 (227)
T ss_pred             HCEEEEEEEEECCcceEEEEEEEEecCCccceEecCCCEEEEeeCCCCccccCCCceEEEEECCEECCCCCCEEEeCCCC
Confidence            999999999875                                         1367899763221          1245


Q ss_pred             eEEEccCCCCCCeEEEEEEecCC-CC--CeeeEEEEEE
Q psy15390        107 QLNITKISRTEMGAYLCIATNNV-PP--SVSKRITVDV  141 (142)
Q Consensus       107 ~l~i~~~~~~d~g~y~C~a~n~~-~~--~~s~~~~l~V  141 (142)
                      .|.|.+++.+|+|.|+|.|.... |.  .++..+.|+|
T Consensus       189 ~L~I~~V~~~DsG~YtC~a~~~~~g~~y~~t~~~~~~~  226 (227)
T PHA02826        189 TLVIKSATHDDSGIYTCNLRFNKNSNNYNITKEYKVTI  226 (227)
T ss_pred             EEEECcCCHHhCEEEEEEEEEeECCEEEEEEEEEEEEE
Confidence            79999999999999999998753 22  3455555543


No 6  
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins. Ig5_Titin_like: domain similar to the M5, fifth immunoglobulin (Ig)-like domain from the human titin C terminus. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic; depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone, and appears to function similar to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching.
Probab=99.72  E-value=2.9e-16  Score=88.06  Aligned_cols=90  Identities=27%  Similarity=0.556  Sum_probs=64.6

Q ss_pred             CCCeeeecCCCCceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEE
Q psy15390          7 VPPNILDTESTPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIA   86 (142)
Q Consensus         7 ~~p~~~~~~~~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~   86 (142)
                      +||.+..   .+....+.+|+.+.|.|.+.+.|.+.+.|++ ++..+....+..+..                       
T Consensus         2 ~~~~~~~---~p~~~~~~~G~~~~L~C~~~g~P~p~v~W~k-~g~~l~~~~~~~~~~-----------------------   54 (92)
T cd05747           2 LPATILT---KPRSLTVSEGESARFSCDVDGEPAPTVTWMR-EGQIIVSSQRHQITS-----------------------   54 (92)
T ss_pred             CCCcccc---cCccEEEeCCCcEEEEEEEeecCCCEEEEEE-CCEECCCCCcEEEEE-----------------------
Confidence            5788887   7788899999999999999999999999999 776553221111100                       


Q ss_pred             EecCCccEEEEEEEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEE
Q psy15390         87 TKIGPLKIFWEIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITV  139 (142)
Q Consensus        87 ~~~~~~~~~w~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l  139 (142)
                                     ....+.|.|.++..+|+|.|+|.|.|..|. .+..+.|
T Consensus        55 ---------------~~~~~~L~i~~~~~~D~G~Y~C~a~N~~G~-~~~~~~l   91 (92)
T cd05747          55 ---------------TEYKSTFEISKVQMSDEGNYTVVVENSEGK-QEAQFTL   91 (92)
T ss_pred             ---------------cCCeeEEEECCCCcccCEeEEEEEEcCCCC-EeEEEEe
Confidence                           011235777888888888888888888875 4555544


No 7  
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Ig_Myomesin_like_C: domain similar to the C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Myomesin and M-protein are both structural proteins localized to the M-band, a transverse structure in the center of the sarcomere, and are candidates for M-band bridges. Both proteins are modular, consisting mainly of repetitive Ig-like and fibronectin type III (FnIII) domains. Myomesin is expressed in all types of vertebrate striated muscle; M-protein has a muscle-type specific expression pattern. Myomesin is present in both slow and fast fibers; M-protein is present only in fast fibers. It has been suggested that myomesin acts as a molecular spring with alternative splicing as a means of modifying its elasticity.
Probab=99.72  E-value=2.8e-16  Score=88.14  Aligned_cols=86  Identities=27%  Similarity=0.480  Sum_probs=61.2

Q ss_pred             CCceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEE
Q psy15390         17 TPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFW   96 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w   96 (142)
                      .|..+.+.+|+++.|.|.+.+.|.|.+.|++ ++..+....+.++....+                              
T Consensus         7 lp~~v~v~~G~~v~L~C~v~G~P~p~v~W~k-~g~~l~~~~~~~~~~~~~------------------------------   55 (92)
T cd05737           7 LPDVVTIMEGKTLNLTCTVFGDPDPEVSWLK-NDQALALSDHYNVKVEQG------------------------------   55 (92)
T ss_pred             CCceEEEeCCCcEEEEEEEEecCCCeEEEEE-CCEECccCCCEEEEEcCC------------------------------
Confidence            4567789999999999999999999999999 777654322111110000                              


Q ss_pred             EEEEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390         97 EIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus        97 ~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                             ....|.|.+++.+|+|.|+|.|.|..|. .+..+.|.|
T Consensus        56 -------~~~~L~I~~v~~~D~G~Y~C~a~N~~G~-~~~~~~v~v   92 (92)
T cd05737          56 -------KYASLTIKGVSSEDSGKYGIVVKNKYGG-ETVDVTVSV   92 (92)
T ss_pred             -------CEEEEEEccCChhhCEEEEEEEEECCCc-ceEEEEEeC
Confidence                   0124788888888889999999988886 566666554


No 8  
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins. Ig1_Robo: domain similar to the first immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit res
Probab=99.71  E-value=6.2e-16  Score=87.85  Aligned_cols=96  Identities=32%  Similarity=0.623  Sum_probs=65.7

Q ss_pred             CCeeeecCCCCceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCC---cceEEeeccceEEEeecCCCCCeEEEE
Q psy15390          8 PPNILDTESTPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINK---RKKVHMHYGEQLNITKISRTEMGAYLC   84 (142)
Q Consensus         8 ~p~~~~~~~~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~---~~~~~~~~~~~l~i~~v~~~d~G~y~C   84 (142)
                      ||.+..   .+....+.+|+.+.|.|.+.+.|.+.+.|++ +|..+....   ..+.....++.+.            . 
T Consensus         1 ~P~i~~---~p~~~~v~~G~~~~l~C~~~g~P~p~i~W~k-~g~~l~~~~~~~~~~~~~~~~~~~~------------~-   63 (100)
T cd07693           1 PPRIVE---HPSDLIVSKGDPATLNCKAEGRPTPTIQWLK-NGQPLETDKDDPRSHRIVLPSGSLF------------F-   63 (100)
T ss_pred             CCeEEe---cCceeEEcCCCeEEEEeeCCcCCCCEEEEEE-CCEECccccCCCCcceEEecCCcEE------------E-
Confidence            577877   7888899999999999999999999999999 777664311   0000000000000            0 


Q ss_pred             EEEecCCccEEEEEEEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390         85 IATKIGPLKIFWEIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus        85 ~~~~~~~~~~~w~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                                           ..+....+..+|+|.|+|.|.|..|...+..+.|.|
T Consensus        64 ---------------------~~i~~~~~~~~D~G~Y~C~a~N~~G~~~s~~~~l~v   99 (100)
T cd07693          64 ---------------------LRVVHGRKGRSDEGVYVCVAHNSLGEAVSRNASLEV   99 (100)
T ss_pred             ---------------------EEeeccCCCcCcCEEEEEEEEccccceecceEEEEe
Confidence                                 002222347889999999999999986777777766


No 9  
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins. Ig4_SCFR_like; fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). In addition to SCFR this group also includes the fourth Ig domain of platelet-derived growth factor receptors (PDGFR), alpha and beta, the fourth Ig domain of macrophage colony stimulating factor (M-CSF), and the Ig domain of the receptor tyrosine kinase KIT. SCFR and the PDGFR alpha and beta have similar organization: an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR, this fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth SCFR_Ig-like domain abolishes
Probab=99.70  E-value=8.5e-16  Score=87.30  Aligned_cols=91  Identities=22%  Similarity=0.384  Sum_probs=64.2

Q ss_pred             CCceeEEecCCcEEEEEEEec-CCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEE
Q psy15390         17 TPSSVAVREEFNITLTCKAEG-FPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIF   95 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~-~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~   95 (142)
                      ....+.+.+|+++.|.|.+.+ .|.|.+.|++ +|.++.......+ ...+        + .  +               
T Consensus         9 ~~~~~~v~~G~~v~L~c~v~g~~P~p~v~W~K-dg~~i~~~~~~~~-~~~~--------~-~--~---------------   60 (101)
T cd04975           9 QNTTIFVNLGENLNLVVEVEAYPPPPHINWTY-DNRTLTNKLTEIV-TSEN--------E-S--E---------------   60 (101)
T ss_pred             CCceEEEECCCCEEEEEEEEecCCCCccEEEe-CCeeCCCCcceeE-EEec--------c-C--c---------------
Confidence            345678899999999999999 8999999999 8987753211110 0000        0 0  0               


Q ss_pred             EEEEEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEEC
Q psy15390         96 WEIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDVE  142 (142)
Q Consensus        96 w~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V~  142 (142)
                            ....+.|.|.++..+|+|.|+|.|.|..|. .+..+.|.|+
T Consensus        61 ------~~~~~~L~i~~v~~~D~G~Ytc~A~N~~G~-~~~t~~L~V~  100 (101)
T cd04975          61 ------YRYVSELKLVRLKESEAGTYTFLASNSDAS-KSLTFELYVN  100 (101)
T ss_pred             ------ceEEEEEEEeecCHhhCeeEEEEEECCCcc-EEEEEEEEEE
Confidence                  001235888899999999999999999985 6777777663


No 10 
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. Ig1_NCAM-1: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (trans
Probab=99.70  E-value=6.8e-16  Score=86.99  Aligned_cols=89  Identities=17%  Similarity=0.378  Sum_probs=61.5

Q ss_pred             CCceeEEecCCcEEEEEEEecCCC-CeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEE
Q psy15390         17 TPSSVAVREEFNITLTCKAEGFPA-PEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIF   95 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~~~~-~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~   95 (142)
                      .|....+..|++++|.|.+.+.|. +.+.|+++++..+..... ++....           .+.                
T Consensus         6 ~p~~~~v~~G~~v~l~C~v~G~P~~p~i~W~~~~g~~l~~~~~-r~~v~~-----------~~~----------------   57 (96)
T cd05865           6 VPSQGEISVGESKFFLCQVAGEAKDKDISWFSPNGEKLTPNQQ-RISVVR-----------NDD----------------   57 (96)
T ss_pred             eCCccEECCCCeEEEEEEEeCCCCCCEEEEECCCCcCccccCC-eEEEEe-----------CCC----------------
Confidence            455667889999999999999985 699999856665432111 111000           000                


Q ss_pred             EEEEEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390         96 WEIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus        96 w~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                              ..+.|.|.+++.+|+|.|+|.|.|..+...+.++.|.|
T Consensus        58 --------~~~~L~I~~v~~~D~G~YtC~A~N~~~g~~~~s~~l~v   95 (96)
T cd05865          58 --------YSSTLTIYNANIDDAGIYKCVVSNEDEGESEATVNVKI   95 (96)
T ss_pred             --------CceEEEEeccChhhCEEEEEEEEcCCCCcEEEEEEEEE
Confidence                    02358888899999999999999987445777887776


No 11 
>PF07679 I-set:  Immunoglobulin I-set domain;  InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents I-set domains, which are found in several cell adhesion molecules, including vascular (VCAM), intercellular (ICAM), neural (NCAM) and mucosal addressin (MADCAM) cell adhesion molecules, as well as junction adhesion molecules (JAM). I-set domains are also present in several other diverse protein families, including several tyrosine-protein kinase receptors, the hemolymph protein hemolin, the muscle proteins titin, telokin, and twitchin, the neuronal adhesion molecule axonin-1 [], and the signalling molecule semaphorin 4D that is involved in axonal guidance, immune function and angiogenesis [].; PDB: 3MTR_A 2EDK_A 3DMK_B 1KOA_A 3NCM_A 2NCM_A 2V9Q_A 2CR3_A 3QQN_A 3QR2_A ....
Probab=99.70  E-value=5.7e-16  Score=86.47  Aligned_cols=90  Identities=26%  Similarity=0.607  Sum_probs=65.3

Q ss_pred             CeeeecCCCCceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEe
Q psy15390          9 PNILDTESTPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATK   88 (142)
Q Consensus         9 p~~~~~~~~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~   88 (142)
                      |.|..   .+..+.+.+|+++.|.|.+.+.|.+.+.|++ ++..+....+..+....                       
T Consensus         1 P~~~~---~~~~~~v~~G~~~~l~c~~~~~p~~~v~W~~-~~~~l~~~~~~~~~~~~-----------------------   53 (90)
T PF07679_consen    1 PVFTK---KPKDVTVKEGESVTLECEVSGNPPPTVTWYK-NGRPLTSSQRYQIESDG-----------------------   53 (90)
T ss_dssp             EEEEE---ESSEEEEETTSEEEEEEEEEESSSSEEEEEE-TTEEEESSSSEEEEEET-----------------------
T ss_pred             CEEEE---ecCCEEEeCCCEEEEEEEEEeCCCCcccccc-cccceeeeeeeeeeccc-----------------------
Confidence            56666   6788999999999999999999999999999 78877654333322221                       


Q ss_pred             cCCccEEEEEEEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390         89 IGPLKIFWEIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus        89 ~~~~~~~w~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                                     ....|.|.++..+|+|.|+|.|.|..|. .+..+.|.|
T Consensus        54 ---------------~~~~L~I~~v~~~D~G~Y~C~~~n~~g~-~~~~~~l~V   90 (90)
T PF07679_consen   54 ---------------GSSSLTIKNVTREDAGTYTCVASNSSGE-ATASVNLTV   90 (90)
T ss_dssp             ---------------TEEEEEESSESGGGSEEEEEEEEETTEE-EEEEEEEEE
T ss_pred             ---------------ceeEEccCCCChhhCEEEEEEEEECCCE-EEEEEEEEC
Confidence                           1334777777777777788888777664 566666654


No 12 
>cd04968 Ig3_Contactin_like Third Ig domain of contactin. Ig3_Contactin_like: Third Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=99.70  E-value=1.7e-15  Score=84.31  Aligned_cols=88  Identities=28%  Similarity=0.441  Sum_probs=65.4

Q ss_pred             CCeeeecCCCCceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEE
Q psy15390          8 PPNILDTESTPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIAT   87 (142)
Q Consensus         8 ~p~~~~~~~~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~   87 (142)
                      ||.+..   .+....+.+|+.+.|.|.+.+.|.+.+.|++ ++..+....  .. .                        
T Consensus         1 p~~~~~---~p~~~~~~~g~~v~l~C~~~g~P~p~v~W~k-~~~~~~~~~--~~-~------------------------   49 (88)
T cd04968           1 PSIIVV---FPKDTYALKGQNVTLECFALGNPVPQIKWRK-VDGSMPSSA--EI-S------------------------   49 (88)
T ss_pred             CCcEEE---CCCceEEeCCCcEEEEEEeeEeCCCEEEEEE-CCCcCCCcc--EE-E------------------------
Confidence            344555   6777888999999999999999999999999 554332110  00 0                        


Q ss_pred             ecCCccEEEEEEEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEEC
Q psy15390         88 KIGPLKIFWEIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDVE  142 (142)
Q Consensus        88 ~~~~~~~~w~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V~  142 (142)
                                     ...+.|.|.+++.+|+|.|+|.|.|..|. .+..+.|.|+
T Consensus        50 ---------------~~~~~L~i~~v~~~D~G~Y~C~a~N~~G~-~~~~~~l~V~   88 (88)
T cd04968          50 ---------------MSGAVLKIPNIQFEDEGTYECEAENIKGK-DTHQGRIYVQ   88 (88)
T ss_pred             ---------------EeCCEEEECCCCcccCEEEEEEEEECCCc-EEEEEEEEEC
Confidence                           01345888899999999999999999986 6777887774


No 13 
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). Ig5_NCAM-2: the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=99.69  E-value=1.6e-15  Score=86.07  Aligned_cols=97  Identities=29%  Similarity=0.482  Sum_probs=65.7

Q ss_pred             CCCeeeecCCCCceeEEecCCcEEEEEEEecCCCCeeEEEecC-CcceecCCcceEEeeccceEEEeecCCCCCeEEEEE
Q psy15390          7 VPPNILDTESTPSSVAVREEFNITLTCKAEGFPAPEIKWRRED-NQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCI   85 (142)
Q Consensus         7 ~~p~~~~~~~~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~-~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~   85 (142)
                      ++|++..    +.+..+.+|++++|.|.+.+.|.|.+.|++.+ +..+....                  ....+.|...
T Consensus         1 ~~p~i~~----~~~~~~~~G~~v~l~C~~~G~P~p~i~W~k~~~g~~~~~~~------------------~~~~~r~~v~   58 (98)
T cd05870           1 VQPHIIQ----LKNETTVENGAATLSCKAEGEPIPEITWKRASDGHTFSEGD------------------KSPDGRIEVK   58 (98)
T ss_pred             CCCEEEe----eccEEEcCCCcEEEEEecccCCCCeEEEEECCCCceeccCC------------------cCcCceEEEe
Confidence            5788764    55778899999999999999999999999832 22111000                  0000111100


Q ss_pred             EEecCCccEEEEEEEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390         86 ATKIGPLKIFWEIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus        86 ~~~~~~~~~~w~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                                     .......|.|.+++.+|+|.|+|.|.|..|. .+..+.|+|
T Consensus        59 ---------------~~~~~~~L~I~~v~~~D~G~Y~C~A~N~~G~-~~~~~~l~~   98 (98)
T cd05870          59 ---------------GQHGESSLHIKDVKLSDSGRYDCEAASRIGG-HQKSMYLDI   98 (98)
T ss_pred             ---------------ecCCeeEEEEeeCCcCCCEEEEEEEeccCCc-ceeEEEEeC
Confidence                           0011235899999999999999999999996 677777765


No 14 
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig3_NCAM-1_like: domain similar to the third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1,and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the
Probab=99.69  E-value=1.8e-15  Score=85.35  Aligned_cols=83  Identities=27%  Similarity=0.597  Sum_probs=60.0

Q ss_pred             CceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEE
Q psy15390         18 PSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWE   97 (142)
Q Consensus        18 ~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~   97 (142)
                      .....+..|+.+.|.|.+.|.|.+.+.|++ ++..+.... .+....                                 
T Consensus        10 ~~~~~~~~G~~v~L~C~~~g~P~p~v~W~k-~g~~~~~~~-~~~~~~---------------------------------   54 (95)
T cd05730          10 EVNATANLGQSVTLACDADGFPEPTMTWTK-DGEPIESGE-EKYSFN---------------------------------   54 (95)
T ss_pred             ccceEEeCCCCEEEEEeccEeCCCEEEEEE-CCEECcCCC-CEEEEe---------------------------------
Confidence            345678899999999999999999999999 777653220 010000                                 


Q ss_pred             EEEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390         98 IIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus        98 ~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                           ...+.|.|.++..+|+|.|+|.|.|..|. .+..+.|.|
T Consensus        55 -----~~~~~L~I~~v~~~D~G~Y~C~a~N~~G~-~~~~~~L~V   92 (95)
T cd05730          55 -----EDGSEMTILDVDKLDEAEYTCIAENKAGE-QEAEIHLKV   92 (95)
T ss_pred             -----CCCCEEEECCCChhhCEEEEEEEEcCCCe-EEEEEEEEE
Confidence                 01235888888999999999999999986 566666655


No 15 
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). Ig_C5_MyBP_C : the C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). MyBP_C consists of repeated domains, Ig and fibronectin type 3, and various linkers. Three isoforms of MYBP_C exist and are included in this group: cardiac(c), and fast and slow skeletal muscle (s) MyBP_C. cMYBP_C has insertions between and inside domains and an additional cardiac-specific Ig domain at the N-terminus. For cMYBP_C  an interaction has been demonstrated between this C5 domain and the Ig C8 domain.
Probab=99.69  E-value=2.1e-15  Score=83.42  Aligned_cols=84  Identities=20%  Similarity=0.347  Sum_probs=61.5

Q ss_pred             ceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEE
Q psy15390         19 SSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEI   98 (142)
Q Consensus        19 ~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~   98 (142)
                      ..+.+.+|+.+.|.|.+.|.|.|.+.|++ +++.+.... .+        +.+..                         
T Consensus         3 ~~~~v~~G~~v~l~c~~~G~P~P~v~W~k-~~~~i~~~~-~r--------~~~~~-------------------------   47 (86)
T cd05894           3 NTIVVVAGNKLRLDVPISGEPAPTVTWSR-GDKAFTETE-GR--------VRVES-------------------------   47 (86)
T ss_pred             CEEEEEcCCEEEEEeeEeecCCCeEEEEE-CCEECccCC-Ce--------EEEEE-------------------------
Confidence            35678899999999999999999999999 777664321 01        11100                         


Q ss_pred             EEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390         99 IFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus        99 ~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                         ......|.|..+..+|+|.|+|.|.|..|. .+..+.|.|
T Consensus        48 ---~~~~~~L~I~~~~~~D~G~Y~c~a~N~~G~-~~~~~~l~V   86 (86)
T cd05894          48 ---YKDLSSFVIEGAEREDEGVYTITVTNPVGE-DHASLFVKV   86 (86)
T ss_pred             ---cCCeEEEEECCCccCcCEEEEEEEEeCCCc-EEEEEEEEC
Confidence               001235888899999999999999999986 677777765


No 16 
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig5_NCAM-1: The fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM) and heterophilic (NCAM-non-NCAM) interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (tr
Probab=99.68  E-value=2.6e-15  Score=84.98  Aligned_cols=97  Identities=30%  Similarity=0.502  Sum_probs=65.8

Q ss_pred             CCCeeeecCCCCceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEE
Q psy15390          7 VPPNILDTESTPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIA   86 (142)
Q Consensus         7 ~~p~~~~~~~~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~   86 (142)
                      ++|.|..   .+....+..|+.++|.|.+.|.|.|.+.|++ +++.+.....    . ..+...+..             
T Consensus         1 ~~p~i~~---~~~~~~~~~g~~v~l~C~~~G~P~P~v~W~~-~~~~~~~~~~----~-~~~~~~v~~-------------   58 (97)
T cd05869           1 AKPKITY---VENQTAMELEEQITLTCEASGDPIPSITWRT-STRNISSEEK----T-LDGHIVVRS-------------   58 (97)
T ss_pred             CCceEEE---ccCceEEEcCCCEEEEEEeeEeCCCEEEEEE-CCccccCCcc----c-cCccEEEEc-------------
Confidence            4677766   4555556668999999999999999999999 6665432110    0 000011000             


Q ss_pred             EecCCccEEEEEEEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390         87 TKIGPLKIFWEIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus        87 ~~~~~~~~~w~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                                     ....+.|.|.+++.+|+|.|+|.|.|..|. .+..+.|.|
T Consensus        59 ---------------~~~~~~L~I~~v~~~D~G~Y~C~A~N~~G~-~~~~~~l~v   97 (97)
T cd05869          59 ---------------HARVSSLTLKYIQYTDAGEYLCTASNTIGQ-DSQSMYLEV   97 (97)
T ss_pred             ---------------CccEEEEEEecCccCcCEEEEEEEecCCCC-eeEEEEEEC
Confidence                           001235889999999999999999999997 577777765


No 17 
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). Ig_CEACAM_D4:  immunoglobulin (Ig)-like domain 4 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the
Probab=99.68  E-value=1.7e-15  Score=84.62  Aligned_cols=83  Identities=24%  Similarity=0.450  Sum_probs=63.1

Q ss_pred             CCceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEE
Q psy15390         17 TPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFW   96 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w   96 (142)
                      .+.+..+.+|++++|.|.+.+. .+.+.|++ ++..+....   ....                                
T Consensus         9 ~~~~~~v~~g~~v~l~C~a~g~-~p~i~W~k-ng~~l~~~~---~~~~--------------------------------   51 (91)
T cd05740           9 SVGNQPPEDNQPVTLTCEAEGQ-ATYIWWVN-NGSLLVPPR---LQLS--------------------------------   51 (91)
T ss_pred             ccCccccccCCcEEEEEEeCCC-CCEEEEEE-CCEECCCCC---EEEe--------------------------------
Confidence            4556789999999999999999 88999999 776543211   0000                                


Q ss_pred             EEEEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEEC
Q psy15390         97 EIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDVE  142 (142)
Q Consensus        97 ~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V~  142 (142)
                            .....|.|.+++.+|+|.|.|.|.|..|...+..+.|.|.
T Consensus        52 ------~~~~~L~I~~v~~~D~G~Y~C~a~N~~G~~~S~~~~L~V~   91 (91)
T cd05740          52 ------NDNRTLTFNNVTRSDTGHYQCEASNEVSNMTSDPYILNVN   91 (91)
T ss_pred             ------CCCCEEEECcCChhhCEEEEEEEEcCCCCEEeeeEEEEeC
Confidence                  1123588888999999999999999999877888888874


No 18 
>KOG4194|consensus
Probab=99.68  E-value=9.9e-16  Score=108.08  Aligned_cols=131  Identities=27%  Similarity=0.443  Sum_probs=97.4

Q ss_pred             cCCCeeeecCCCCceeEEecCCcEEEEEEEecC--CCCeeEEEecCCcceecCCcc---eE-Ee----------eccceE
Q psy15390          6 SVPPNILDTESTPSSVAVREEFNITLTCKAEGF--PAPEIKWRREDNQPISINKRK---KV-HM----------HYGEQL   69 (142)
Q Consensus         6 ~~~p~~~~~~~~~~~~~~~~g~~v~l~C~~~~~--~~~~~~w~~~~~~~~~~~~~~---~~-~~----------~~~~~l   69 (142)
                      ..+|++..   .|..+.+..|++++|+|.+.+.  .+..+.|.+ +.+........   ++ ..          ...+.|
T Consensus       501 spkpqI~~---qPe~~~al~g~nirftC~a~sssasplsi~WR~-dnevq~rv~ved~a~~~~q~r~~~~~e~~~~~~~L  576 (873)
T KOG4194|consen  501 SPKPQIVT---QPETVSALIGENIRFTCNAYSSSASPLSIEWRK-DNEVQPRVDVEDFATFLSQNRNGTFGEREEYTAIL  576 (873)
T ss_pred             CCCcceec---CchHhhhhhccceEEEEEeccCCCCCceeEeee-ccccCcccchhcchhhhhhhccCccchhhhhhhee
Confidence            35677776   7777788889999999999773  334788988 65533211110   00 01          112359


Q ss_pred             EEeecCCCCCeEEEEEEEec-------------------------------------------CCccEEEEE--------
Q psy15390         70 NITKISRTEMGAYLCIATKI-------------------------------------------GPLKIFWEI--------   98 (142)
Q Consensus        70 ~i~~v~~~d~G~y~C~~~~~-------------------------------------------~~~~~~w~~--------   98 (142)
                      ++.||...|.|.|+|.+.|.                                           |.|+|.|.+        
T Consensus       577 ~L~nVt~td~grYQCVvtN~FGStysqk~KltV~~~PsFtktP~dltl~tg~mArl~CaAtG~P~PeIawqkdggtdFPA  656 (873)
T KOG4194|consen  577 HLDNVTFTDEGRYQCVVTNHFGSTYSQKAKLTVNQAPSFTKTPEDLTLRTGQMARLECAATGHPRPEIAWQKDGGTDFPA  656 (873)
T ss_pred             eeeeeecccCceEEEEEecccCcchhheeEEEeeccCccccCcccceeecccceeeeeeccCCCCcceeehhcCCCCCch
Confidence            99999999999999999875                                           557999964        


Q ss_pred             -----EEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390         99 -----IFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus        99 -----~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                           ......+..+.|.+++.+|+|.|+|.|.|..|. .+..++|.|
T Consensus       657 A~eRRl~Vmpedd~f~Itnvk~eD~GiYtC~A~n~AG~-isanAtL~V  703 (873)
T KOG4194|consen  657 ARERRLHVMPEDDVFFITNVKIEDQGIYTCTAQNVAGQ-ISANATLTV  703 (873)
T ss_pred             hhhheeeecCCCCEEEEecccccccceeEEeeeccccc-eeeceEEEE
Confidence                 234556778999999999999999999999996 777777776


No 19 
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin. Ig3_Peroxidasin: the third immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells which have undergone programmed cell death, and protection of the organism against non-self.
Probab=99.68  E-value=4.7e-16  Score=83.78  Aligned_cols=74  Identities=26%  Similarity=0.559  Sum_probs=54.3

Q ss_pred             cCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEeccc
Q psy15390         25 EEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHY  104 (142)
Q Consensus        25 ~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~  104 (142)
                      +|+++.|.|.+.+.|.|.+.|++ ++..+....+.  ....                                       
T Consensus         1 eG~~v~l~C~~~g~P~p~i~W~k-~g~~~~~~~~~--~~~~---------------------------------------   38 (74)
T cd05745           1 EGQTVDFLCEAQGYPQPVIAWTK-GGSQLSVDRRH--LVLS---------------------------------------   38 (74)
T ss_pred             CCCeEEEEeECCEecCCEEEEEE-CCEECCCCCCe--EEcc---------------------------------------
Confidence            58999999999999999999999 77765332110  0111                                       


Q ss_pred             cceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        105 GEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       105 ~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      .+.|.|.+++.+|+|.|+|.|.|..|. .+..+.|.|
T Consensus        39 ~~~L~I~~v~~~D~G~Y~C~A~N~~G~-~~~~~~L~V   74 (74)
T cd05745          39 SGTLRISRVALHDQGQYECQAVNIVGS-QRTVAQLTV   74 (74)
T ss_pred             CCeEEEeeCCHHhCEEEEEEEEeCCCc-eeEEEEEeC
Confidence            234777888888888888888888886 666777665


No 20 
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig1_Neogenin: first immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=99.67  E-value=2.9e-15  Score=84.47  Aligned_cols=90  Identities=27%  Similarity=0.499  Sum_probs=61.0

Q ss_pred             CCceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEE
Q psy15390         17 TPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFW   96 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w   96 (142)
                      .|....+.+|+++.|.|.+.+.|.+.+.|++ +|..+......+.....++.+.|.++                      
T Consensus         5 ~P~~~~~~~g~~v~l~C~v~g~P~p~i~W~k-~g~~l~~~~~~~~~~~~~~~l~i~~v----------------------   61 (95)
T cd05722           5 EPSDIVAVRGGPVVLNCSAEGEPPPKIEWKK-DGVLLNLVSDERRQQLPNGSLLITSV----------------------   61 (95)
T ss_pred             CCCCeEEcCCCCEEEeeecccCCCCEEEEEE-CCeECccccCcceEEccCCeEEEeee----------------------
Confidence            5667788899999999999999999999999 88776433221111111122221111                      


Q ss_pred             EEEEeccccceEEEccCCCCCCeEEEEEEecC-CCCCeeeEEEEEE
Q psy15390         97 EIIFHMHYGEQLNITKISRTEMGAYLCIATNN-VPPSVSKRITVDV  141 (142)
Q Consensus        97 ~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~-~~~~~s~~~~l~V  141 (142)
                                  ........|.|.|+|.|.|. .|...+..+.|.|
T Consensus        62 ------------~~~~~~~~D~G~Y~C~a~N~~~G~~~s~~~~l~v   95 (95)
T cd05722          62 ------------VHSKHNKPDEGFYQCVAQNDSLGSIVSRTARLTV   95 (95)
T ss_pred             ------------eccCCCCCcCEEEEEEEECCccCcEEEeeeEEeC
Confidence                        11112678999999999999 8886688887765


No 21 
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2. Ig1_NCAM-2:  first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 (OCAM/mamFas II, RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=99.67  E-value=2.1e-15  Score=84.25  Aligned_cols=86  Identities=22%  Similarity=0.358  Sum_probs=59.0

Q ss_pred             CCceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEE
Q psy15390         17 TPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFW   96 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w   96 (142)
                      .+....+.+|+++.|.|.+.|.|. .+.|++.++..+....+  +....++                             
T Consensus         6 ~~~~~~v~~G~~v~l~C~~~G~P~-~v~W~k~~g~~~~~~~r--~~~~~~g-----------------------------   53 (92)
T cd05866           6 SLSKVELSVGESKFFTCTAIGEPE-SIDWYNPQGEKIVSSQR--VVVQKEG-----------------------------   53 (92)
T ss_pred             EecceEEcCCCeEEEEEEEEEeCC-eEEEEeCCCeEecCCCC--EEEEeCC-----------------------------
Confidence            456778999999999999999887 89999855654432211  1111110                             


Q ss_pred             EEEEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390         97 EIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus        97 ~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                             ....|.|..+..+|+|.|+|.|.|..|......+.|.|
T Consensus        54 -------~~~~L~I~~v~~~D~G~Y~C~A~N~~G~~~~~~i~l~~   91 (92)
T cd05866          54 -------VRSRLTIYNANIEDAGIYRCQATDAKGQTQEATVVLEI   91 (92)
T ss_pred             -------CeeEEEEecCChHHCEEEEEEEEcCCCcEEEEEEEEEE
Confidence                   01247788888888888888888888775566666654


No 22 
>KOG4221|consensus
Probab=99.67  E-value=4.3e-15  Score=110.99  Aligned_cols=109  Identities=24%  Similarity=0.475  Sum_probs=91.1

Q ss_pred             CCceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEec-------
Q psy15390         17 TPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKI-------   89 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~-------   89 (142)
                      .+.+..+..|+++.|.|.+.+.+.+.+.|.+ +.+++..+.  ++....++.|.|.+++..|.|.|+|.+.+.       
T Consensus       146 ~~~~~t~~~g~ta~f~c~vn~e~~p~i~w~k-n~~pl~~~~--r~i~lpsG~L~I~~~qp~d~g~yrc~vt~g~~~r~S~  222 (1381)
T KOG4221|consen  146 QPESTTLLYGQTALFSCEVNAEPVPTIMWLK-NDQPLPLDS--RVIVLPSGALEISGLQPSDTGEYRCVVTGGASQRTSN  222 (1381)
T ss_pred             CccceeEecCCcEEEEEEEcCccCceeEEec-ccccccCCC--cEEEcCCCcEEecccccCCCceEEEEEecCCcCCccc
Confidence            5667789999999999999998888999999 777776655  555677889999999999999999999865       


Q ss_pred             ------------------------------------------CCccEEEEEE----------EeccccceEEEccCCCCC
Q psy15390         90 ------------------------------------------GPLKIFWEII----------FHMHYGEQLNITKISRTE  117 (142)
Q Consensus        90 ------------------------------------------~~~~~~w~~~----------~~~~~~~~l~i~~~~~~d  117 (142)
                                                                +.+.+.|.++          +.....+.|.|.+++..|
T Consensus       223 ~a~ltv~s~~~~~~~~~fl~~p~~~~v~~g~~v~leCvvs~~p~p~v~Wlrng~~i~~ds~rivl~g~~slliS~a~~~d  302 (1381)
T KOG4221|consen  223 EAELTVLSDPGALNKLVFLDEPSNAVVVEGDDVVLECVVSGVPKPSVKWLRNGEKISVDSYRIVLVGGSSLLISNATDDD  302 (1381)
T ss_pred             eeEEEecCCcccccceeeecCCCccccccCCcEEEEEEecCCCCCceEEeeCCeeeeecceEEEEecccceEEecccccc
Confidence                                                      4478999642          233446789999999999


Q ss_pred             CeEEEEEEecC
Q psy15390        118 MGAYLCIATNN  128 (142)
Q Consensus       118 ~g~y~C~a~n~  128 (142)
                      +|.|+|+|.|.
T Consensus       303 Sg~YtC~Atn~  313 (1381)
T KOG4221|consen  303 SGKYTCRATNT  313 (1381)
T ss_pred             CceEEEEecCC
Confidence            99999999984


No 23 
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig4_Contactin-2-like: fourth Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=99.67  E-value=1.9e-15  Score=83.52  Aligned_cols=81  Identities=26%  Similarity=0.516  Sum_probs=60.9

Q ss_pred             CCceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEE
Q psy15390         17 TPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFW   96 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w   96 (142)
                      .|....+..|+.+.|.|.+.+.|.|.+.|++ ++..+....  ++.. .                               
T Consensus         5 ~p~~~~~~~G~~~~l~C~~~g~p~p~v~W~k-~g~~~~~~~--~~~~-~-------------------------------   49 (85)
T cd05728           5 VISDTEADIGSSLRWECKASGNPRPAYRWLK-NGQPLASEN--RIEV-E-------------------------------   49 (85)
T ss_pred             cCCccEEcCCCcEEEEEEeeEeCCCEEEEEE-CCEECCCCC--eEEE-e-------------------------------
Confidence            5677889999999999999999999999999 777553211  1000 0                               


Q ss_pred             EEEEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390         97 EIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus        97 ~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                              .+.|.|.++..+|+|.|+|.|.|..|. .+..+.|.|
T Consensus        50 --------~~~L~i~~~~~~D~G~Y~C~a~N~~G~-~~~~~~l~V   85 (85)
T cd05728          50 --------AGDLRITKLSLSDSGMYQCVAENKHGT-IYASAELAV   85 (85)
T ss_pred             --------CCEEEEeeCCHHHCEEEEEEEECCCCe-EEEEEEEEC
Confidence                    224777788888888999999988886 677777665


No 24 
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins. Ig5_NCAM-1 like: domain similar to the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic  (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM mole
Probab=99.66  E-value=5.1e-15  Score=83.64  Aligned_cols=96  Identities=29%  Similarity=0.461  Sum_probs=66.0

Q ss_pred             CCCeeeecCCCCceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEE
Q psy15390          7 VPPNILDTESTPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIA   86 (142)
Q Consensus         7 ~~p~~~~~~~~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~   86 (142)
                      ++|.+..    +.+..+.+|+++.|.|.+.+.|.+.+.|++ ++..+.....     ...+.+.+.              
T Consensus         1 ~~P~i~~----~~~~~~~~g~~v~l~C~~~g~p~p~v~W~~-~~~~~~~~~~-----~~~~~~~~~--------------   56 (96)
T cd05732           1 VQPKITY----LENQTAVELEQITLTCEAEGDPIPEITWRR-ATRNFSEGDK-----SLDGRIVVR--------------   56 (96)
T ss_pred             CCcccee----cCceeEecCCcEEEEEEEeEcCCCcEEEEE-CCcccCCCCc-----cccceEEEe--------------
Confidence            3577653    446778899999999999999999999999 6644322110     000001110              


Q ss_pred             EecCCccEEEEEEEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390         87 TKIGPLKIFWEIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus        87 ~~~~~~~~~w~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                                    .......|.|.+++.+|+|.|+|.|.|..|. .+..+.|.|
T Consensus        57 --------------~~~~~~~L~I~~v~~~D~G~Y~C~a~N~~G~-~~~s~~l~v   96 (96)
T cd05732          57 --------------GHARVSSLTLKDVQLTDAGRYDCEASNRIGG-DQQSMYLEV   96 (96)
T ss_pred             --------------CCccEEEEEECcCCcCcCEEeEEEEEeCCCC-cEEEEEEeC
Confidence                          0001235899999999999999999999997 577777765


No 25 
>KOG4194|consensus
Probab=99.66  E-value=1.7e-15  Score=106.96  Aligned_cols=124  Identities=22%  Similarity=0.449  Sum_probs=97.6

Q ss_pred             cccCCCeeeecCCCCceeEEecCCcEEEEEEEecCCCCeeEEEecCCcc-eecCCcceEEee-ccceEEEeecCCCCCeE
Q psy15390          4 YKSVPPNILDTESTPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQP-ISINKRKKVHMH-YGEQLNITKISRTEMGA   81 (142)
Q Consensus         4 ~~~~~p~~~~~~~~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~-~~~~~~~~~~~~-~~~~l~i~~v~~~d~G~   81 (142)
                      .|...|.|..   +|..+++..|+...|.|.+.|.|.|++.|.+ +|.. .+.....|.... .+..+.|.||+.+|.|.
T Consensus       608 tV~~~PsFtk---tP~dltl~tg~mArl~CaAtG~P~PeIawqk-dggtdFPAA~eRRl~Vmpedd~f~Itnvk~eD~Gi  683 (873)
T KOG4194|consen  608 TVNQAPSFTK---TPEDLTLRTGQMARLECAATGHPRPEIAWQK-DGGTDFPAARERRLHVMPEDDVFFITNVKIEDQGI  683 (873)
T ss_pred             EeeccCcccc---CcccceeecccceeeeeeccCCCCcceeehh-cCCCCCchhhhheeeecCCCCEEEEecccccccce
Confidence            5667899998   8999999999999999999999999999999 5555 555544554444 34579999999999999


Q ss_pred             EEEEEEec-------------------------------------------CCccEEEEEE-----E----e-ccccceE
Q psy15390         82 YLCIATKI-------------------------------------------GPLKIFWEII-----F----H-MHYGEQL  108 (142)
Q Consensus        82 y~C~~~~~-------------------------------------------~~~~~~w~~~-----~----~-~~~~~~l  108 (142)
                      |+|.++|.                                           +.+...|.+.     +    . ...+.-+
T Consensus       684 YtC~A~n~AG~isanAtL~V~e~p~f~~PL~~~~V~~get~vlqC~a~~~~a~pr~~W~k~d~pil~t~rh~f~d~dQll  763 (873)
T KOG4194|consen  684 YTCTAQNVAGQISANATLTVLETPSFSIPLEDQLVVVGETLVLQCLAEGAPADPRLEWFKEDKPILITERHTFPDGDQLL  763 (873)
T ss_pred             eEEeeeccccceeeceEEEEecCCcccccccceEEEecceEEEEEecCCCCCCccccccCCCCceEEeecccCCCCCeEE
Confidence            99999976                                           1156777531     1    1 1234556


Q ss_pred             EEccCCCCCCeEEEEEEecCCCC
Q psy15390        109 NITKISRTEMGAYLCIATNNVPP  131 (142)
Q Consensus       109 ~i~~~~~~d~g~y~C~a~n~~~~  131 (142)
                      .+.....+|+|.|+|...|..|.
T Consensus       764 vv~~~~~~daG~yTcem~~~~~~  786 (873)
T KOG4194|consen  764 VVKENLVEDAGIYTCEMSNTLGT  786 (873)
T ss_pred             EEEehhhhhcceEEEEEEeeccc
Confidence            77888899999999999998775


No 26 
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig4_L1-CAM_like:  fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=99.66  E-value=3.6e-15  Score=80.70  Aligned_cols=74  Identities=26%  Similarity=0.470  Sum_probs=55.1

Q ss_pred             CCcEEEEEEEecCCCCeeEEEecCCcceecCCcc-eEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEeccc
Q psy15390         26 EFNITLTCKAEGFPAPEIKWRREDNQPISINKRK-KVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHY  104 (142)
Q Consensus        26 g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~-~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~  104 (142)
                      |+++.|.|.+.+.|.|.+.|++ +|..+...... +..                                        ..
T Consensus         1 G~~v~l~C~~~G~P~p~i~W~k-~g~~i~~~~~~~~~~----------------------------------------~~   39 (76)
T cd05867           1 GETARLDCQVEGIPTPNITWSI-NGAPIEGTDPDPRRH----------------------------------------VS   39 (76)
T ss_pred             CCeEEEEEEeeEeCCCeEEEEE-CCEECCCCCCCceEE----------------------------------------ee
Confidence            7899999999999999999999 88765432110 100                                        01


Q ss_pred             cceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        105 GEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       105 ~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      .+.|.|.+++.+|+|.|+|.|.|..|. +...+.|.|
T Consensus        40 ~~~L~I~~~~~~D~G~Y~C~a~N~~G~-~~~~~~l~V   75 (76)
T cd05867          40 SGALILTDVQPSDTAVYQCEARNRHGN-LLANAHVHV   75 (76)
T ss_pred             CCEEEECCCChhhCEEEEEEEECCCCe-EEEEEEEEE
Confidence            335888888889999999999998886 667777766


No 27 
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5. Ig1_Contactin-5: First Ig domain of the neural cell adhesion molecule contactin-5. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains, anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. In rats, a lack of contactin-5 (NB-2) results in an impairment of the neuronal activity in the auditory system. Contactin-5 is expressed specifically in the postnatal nervous system, peaking at about 3 weeks postnatal. Contactin-5 is highly expressed in the adult human brain in the occipital lobe and in the amygdala; lower levels of expression have been detected in the corpus callosum, caudate nucleus, and spinal cord.
Probab=99.66  E-value=5.1e-15  Score=83.26  Aligned_cols=87  Identities=25%  Similarity=0.527  Sum_probs=57.4

Q ss_pred             CeeeecCCCCceeEEe---cCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEE
Q psy15390          9 PNILDTESTPSSVAVR---EEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCI   85 (142)
Q Consensus         9 p~~~~~~~~~~~~~~~---~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~   85 (142)
                      |.|..   .+..+.+.   +|+.+.|.|.+.|.|.|.+.|++ ++..+......+... .                    
T Consensus         2 P~f~~---~p~~~~~~~~~~g~~v~l~C~~~G~P~P~i~W~k-~g~~l~~~~~~~~~~-~--------------------   56 (94)
T cd05848           2 PVFVQ---EPDDAIFPTDSDEKKVILNCEARGNPVPTYRWLR-NGTEIDTESDYRYSL-I--------------------   56 (94)
T ss_pred             CeeEE---CCCcEEccCCCCCCEEEEEEEeeecCCCEEEEEE-CCeECccCCCceEEe-e--------------------
Confidence            56666   56555443   47899999999999999999999 777664321111110 1                    


Q ss_pred             EEecCCccEEEEEEEeccccceEEEccCC-CCCCeEEEEEEecCCCCCeeeEEEE
Q psy15390         86 ATKIGPLKIFWEIIFHMHYGEQLNITKIS-RTEMGAYLCIATNNVPPSVSKRITV  139 (142)
Q Consensus        86 ~~~~~~~~~~w~~~~~~~~~~~l~i~~~~-~~d~g~y~C~a~n~~~~~~s~~~~l  139 (142)
                                         ++.|.|.++. .+|+|.|+|.|.|..|...+..+.|
T Consensus        57 -------------------~g~L~i~~~~~~~D~G~Y~C~A~N~~G~~~S~~~~l   92 (94)
T cd05848          57 -------------------DGNLIISNPSEVKDSGRYQCLATNSIGSILSREALL   92 (94)
T ss_pred             -------------------CCeEEEccCCccCcCEEEEEEEEcCCCeEEeccEEE
Confidence                               2246666654 5788888888888888654555544


No 28 
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins. Ig1_NCAM-1 like: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the s
Probab=99.65  E-value=6.5e-15  Score=82.54  Aligned_cols=87  Identities=17%  Similarity=0.336  Sum_probs=59.5

Q ss_pred             CCceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEE
Q psy15390         17 TPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFW   96 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w   96 (142)
                      .|....+..|+++.|.|.+.+.|. .+.|+++++..+....+.... . .                              
T Consensus         6 ~p~~~~v~~G~~~~l~C~~~G~p~-~i~W~~~~~~~~~~~~~~~~~-~-~------------------------------   52 (92)
T cd04977           6 VPSQGEISVGESKFFLCQVIGEPK-DISWFSPNGEKLVTQQQISVV-Q-N------------------------------   52 (92)
T ss_pred             ecCcEEECCCCeEEEEEEeEeeCC-eEEEECCCCCEeccCCCEEEE-e-C------------------------------
Confidence            456678999999999999999864 899998566544321111100 0 0                              


Q ss_pred             EEEEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390         97 EIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus        97 ~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                           ......|.|.+++.+|+|.|+|.|.|..|.....++.|.|
T Consensus        53 -----~~~~~~L~I~~v~~~D~G~Y~C~A~N~~g~~~~~sv~l~~   92 (92)
T cd04977          53 -----DDVRSTLTIYNANIEDAGIYKCVATDAKGTESEATVNLKI   92 (92)
T ss_pred             -----CCCEEEEEEecCCcccCEEEEEEEEcCCCCcceeEEEEEC
Confidence                 0012358888888889999999999887665677777664


No 29 
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin. Ig_Myotilin_C: C-terminal immunoglobulin (Ig)-like domain of myotilin. Mytolin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to the latter family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Myotilin is most abundant in skeletal and cardiac muscle, and is involved in maintaining sarcomere integrity. It binds to alpha-actinin, filamin and actin. Mutations in myotilin lead to muscle disorders.
Probab=99.65  E-value=3e-15  Score=80.63  Aligned_cols=75  Identities=24%  Similarity=0.507  Sum_probs=53.0

Q ss_pred             EEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEeccccceE
Q psy15390         29 ITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYGEQL  108 (142)
Q Consensus        29 v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~~~l  108 (142)
                      |.|.|.+.|.|.|.+.|++ +++.+..... ++....+           +.|                        ...|
T Consensus         1 v~l~C~v~G~P~P~i~W~k-~~~~i~~~~~-r~~~~~~-----------~~g------------------------~~~L   43 (75)
T cd05892           1 VKLECQISAIPPPKIFWKR-NNEMVQYNTD-RISLYQD-----------NSG------------------------RVTL   43 (75)
T ss_pred             CEEEEEEEecCCCeEEEEE-CCEECcCCCC-eEEEEEc-----------CCC------------------------cEEE
Confidence            5799999999999999999 8876643211 1111100           001                        1148


Q ss_pred             EEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        109 NITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       109 ~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      .|.++..+|+|.|+|.|.|..|. .+..+.|.|
T Consensus        44 ~I~~~~~~D~G~Y~C~A~N~~G~-~~~~a~L~V   75 (75)
T cd05892          44 LIKNVNKKDAGWYTVSAVNEAGV-ATCHARLDV   75 (75)
T ss_pred             EECCCChhhCEEEEEEEEcCcCe-EEEEEEEeC
Confidence            88899999999999999999986 677777765


No 30 
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d4: the fourth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor fo
Probab=99.65  E-value=7.3e-15  Score=82.04  Aligned_cols=85  Identities=22%  Similarity=0.336  Sum_probs=60.7

Q ss_pred             CCceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEE
Q psy15390         17 TPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFW   96 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w   96 (142)
                      .++...+.+|+.+.|.|.+.|.|.|.+.|++ ++..+........                                   
T Consensus         6 ~p~~~~v~~G~~v~l~C~~~G~P~p~v~W~~-~g~~~~~~~~~~~-----------------------------------   49 (90)
T cd04972           6 GPNATVVYEGGTATIRCTAEGSPLPKVEWII-AGLIVIQTRTDTL-----------------------------------   49 (90)
T ss_pred             CCcCEEEcCCCcEEEEEEEEEcCCCeEEEEE-CCEEccCCccEEE-----------------------------------
Confidence            4455668899999999999999999999999 7765432110000                                   


Q ss_pred             EEEEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390         97 EIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus        97 ~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                         ........|.|..+..+|.|.|+|.|.|..|. .+..+.|.|
T Consensus        50 ---~~~~~~~~L~I~~v~~~D~g~Y~C~A~N~~G~-~~~~~~L~v   90 (90)
T cd04972          50 ---ETTVDIYNLQLSNITSETQTTVTCTAENPVGQ-ANVSVQVTV   90 (90)
T ss_pred             ---EecCCEEEEEEecCCcccCEEEEEEEECCCCc-eeEEEEEeC
Confidence               00011235788888888889999999998886 677777764


No 31 
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig5_Contactin-1: fifth Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=99.65  E-value=1.7e-15  Score=81.28  Aligned_cols=73  Identities=22%  Similarity=0.481  Sum_probs=53.2

Q ss_pred             CCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEecccc
Q psy15390         26 EFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYG  105 (142)
Q Consensus        26 g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~  105 (142)
                      |+.+.|.|.+.+.|.|.+.|++ ++..+....  ++....                                       .
T Consensus         1 G~~~~l~C~~~g~P~p~v~W~k-~~~~l~~~~--r~~~~~---------------------------------------~   38 (73)
T cd05852           1 GGRVIIECKPKAAPKPKFSWSK-GTELLVNNS--RISIWD---------------------------------------D   38 (73)
T ss_pred             CCeEEEEEecceeCCCEEEEEe-CCEecccCC--CEEEcC---------------------------------------C
Confidence            6889999999999999999999 776543221  111111                                       2


Q ss_pred             ceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        106 EQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       106 ~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      +.|.|.+++.+|+|.|+|.|.|..|. .+.++.|.|
T Consensus        39 g~L~I~~v~~~D~G~Y~C~A~N~~G~-~~~~~~l~~   73 (73)
T cd05852          39 GSLEILNITKLDEGSYTCFAENNRGK-ANSTGVLSV   73 (73)
T ss_pred             CEEEECcCChhHCEEEEEEEECCCCc-eeEEEEEEC
Confidence            35888888888888888999988886 566676654


No 32 
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). Ig_M-protein_C: the C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). M-protein is a structural protein localized to the M-band, a transverse structure in the center of the sarcomere, and is a candidate for M-band bridges. M-protein is modular consisting mainly of repetitive IG-like and fibronectin type III (FnIII) domains, and has a muscle-type specific expression pattern. M-protein is present in fast fibers.
Probab=99.65  E-value=8.9e-15  Score=81.97  Aligned_cols=86  Identities=26%  Similarity=0.420  Sum_probs=61.4

Q ss_pred             CCceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEE
Q psy15390         17 TPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFW   96 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w   96 (142)
                      .|..+.+.+|+++.|.|.+.+.|.+.+.|++ ++..+.....                       |....          
T Consensus         7 ~p~~v~v~eG~~v~L~C~v~g~P~p~i~W~k-~~~~~~~~~~-----------------------~~~~~----------   52 (92)
T cd05891           7 LPDVVTIMEGKTLNLTCTVFGNPDPEVIWFK-NDQDIELSEH-----------------------YSVKL----------   52 (92)
T ss_pred             CCCcEEEcCCCEEEEEEEEEEeCCCeEEEEE-CCEECCCCCC-----------------------EEEEE----------
Confidence            5667889999999999999999999999999 6654432111                       00000          


Q ss_pred             EEEEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390         97 EIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus        97 ~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                          .......|.|..+..+|+|.|+|.|.|..|. .+..+.|.|
T Consensus        53 ----~~~~~~~L~I~~~~~~D~G~Y~C~a~N~~G~-~~~~~~v~~   92 (92)
T cd05891          53 ----EQGKYASLTIKGVTSEDSGKYSINVKNKYGG-ETVDVTVSV   92 (92)
T ss_pred             ----cCCCEEEEEECCCChhhCEEEEEEEEeCCCc-eeeEEEEEC
Confidence                0000124888899999999999999999886 567676654


No 33 
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). Ig4_ NrCAM: fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six IG-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=99.65  E-value=3.9e-15  Score=80.55  Aligned_cols=75  Identities=27%  Similarity=0.450  Sum_probs=55.5

Q ss_pred             CCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEecccc
Q psy15390         26 EFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYG  105 (142)
Q Consensus        26 g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~  105 (142)
                      |+.+.|.|.+.|.|.|.+.|++ +|+.+...........                                       ..
T Consensus         1 g~~~~l~C~a~G~P~P~i~W~k-~g~~i~~~~~~~~~~~---------------------------------------~~   40 (76)
T cd05868           1 GEDGTLICRANGNPKPSISWLT-NGVPIEIAPTDPSRKV---------------------------------------DG   40 (76)
T ss_pred             CCCEEEEEEeeEeCCCeEEEEE-CCEEccccCCCceEEe---------------------------------------cC
Confidence            7889999999999999999999 8876632211100000                                       12


Q ss_pred             ceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        106 EQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       106 ~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      +.|.|..++..|+|.|+|.|.|..|. +...+.|.|
T Consensus        41 ~~l~i~~v~~~D~G~Y~C~A~N~~G~-~~~~~~l~v   75 (76)
T cd05868          41 DTIIFSKVQERSSAVYQCNASNEYGY-LLANAFVNV   75 (76)
T ss_pred             CEEEECCCCHhhCEEEEEEEEcCCCE-EEEEEEEEe
Confidence            24777788889999999999999986 777787776


No 34 
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. IG4_PDGFR-alpha: The fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFR alpha binds to all three PDGFs, whereas the PDGFR beta (not included in this group) binds only to PDGF-B. PDGF alpha is organized as an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFR alpha and PDGFR beta are essential for normal development.
Probab=99.65  E-value=6e-15  Score=83.91  Aligned_cols=88  Identities=17%  Similarity=0.312  Sum_probs=62.4

Q ss_pred             eeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEE
Q psy15390         20 SVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEII   99 (142)
Q Consensus        20 ~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~   99 (142)
                      ...+..|+.+.|.|.+.|.|.|.+.|++ +|+++.........  ..     .++   +  .+.                
T Consensus        12 ~~~~~~~~~~~l~~~v~g~P~P~v~W~k-dg~~l~~~~~~~~~--~~-----~~~---~--~~~----------------   62 (101)
T cd05859          12 LEFANLHEVKEFVVEVEAYPPPQIRWLK-DNRTLIENLTEITT--SE-----HNV---Q--ETR----------------   62 (101)
T ss_pred             eEEEecCCcEEEEEEEEEeCCCceEEEE-CCEECcCCcceEEe--cc-----ccc---c--cee----------------
Confidence            5578889999999999999999999999 88887543211100  00     000   0  000                


Q ss_pred             EeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        100 FHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       100 ~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                          ..+.|.|.++..+|+|.|+|.|.|..|. .+.++.|.|
T Consensus        63 ----~~s~L~I~~v~~~D~G~Ytc~A~N~~g~-~~~t~~l~V   99 (101)
T cd05859          63 ----YVSKLKLIRAKEEDSGLYTALAQNEDAV-KSYTFALQI   99 (101)
T ss_pred             ----eccEEEEeeCCHHHCEEEEEEEEcCCce-EEEEEEEEE
Confidence                1235889999999999999999999886 666776666


No 35 
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2. Ig1_Contactin-2: First Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=99.64  E-value=1.4e-14  Score=81.48  Aligned_cols=88  Identities=24%  Similarity=0.470  Sum_probs=59.5

Q ss_pred             CeeeecCCCCceeEEecC---CcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEE
Q psy15390          9 PNILDTESTPSSVAVREE---FNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCI   85 (142)
Q Consensus         9 p~~~~~~~~~~~~~~~~g---~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~   85 (142)
                      |.|..   .|....+.+|   +++.|.|.+.+.|.+.+.|++ +|..+......+... .                    
T Consensus         2 P~f~~---~P~~~~~~~~~~g~~v~l~C~a~g~P~p~i~W~~-~g~~l~~~~~~~~~~-~--------------------   56 (94)
T cd05850           2 PVFEE---QPSSLLFPEGSPEEKVTLGCRARASPPATYRWKM-NGTEIKFAPESRYTL-V--------------------   56 (94)
T ss_pred             CeeEE---CCCCEEecCCCCCCeEEEEeEceeCCCCEEEEEE-CCEECccCCCceEEE-E--------------------
Confidence            55655   5666665555   589999999999999999999 887664321111111 0                    


Q ss_pred             EEecCCccEEEEEEEeccccceEEEccCC-CCCCeEEEEEEecCCCCCeeeEEEEE
Q psy15390         86 ATKIGPLKIFWEIIFHMHYGEQLNITKIS-RTEMGAYLCIATNNVPPSVSKRITVD  140 (142)
Q Consensus        86 ~~~~~~~~~~w~~~~~~~~~~~l~i~~~~-~~d~g~y~C~a~n~~~~~~s~~~~l~  140 (142)
                                         .+.|.|.++. ..|+|.|+|.|.|..|...+..+.|.
T Consensus        57 -------------------~g~L~I~~~~~~~D~G~Y~C~A~N~~G~~~s~~a~l~   93 (94)
T cd05850          57 -------------------AGNLVINNPQKARDAGSYQCLAINRCGTVVSREANLR   93 (94)
T ss_pred             -------------------CCeEEEccCCccCcCEEEEEEEEcCcCcEEEEEEEEe
Confidence                               2246665544 47888999999988887666666553


No 36 
>PHA02785 IL-beta-binding protein; Provisional
Probab=99.64  E-value=7.4e-15  Score=99.71  Aligned_cols=105  Identities=17%  Similarity=0.379  Sum_probs=76.8

Q ss_pred             EEecCCcEEEEEEE-----ecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEec-------
Q psy15390         22 AVREEFNITLTCKA-----EGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKI-------   89 (142)
Q Consensus        22 ~~~~g~~v~l~C~~-----~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~-------   89 (142)
                      .+.+|+.+.|.|..     .+.|.+.+.|++ ++....    .......+..|.|.++..+|+|.|+|.+.|.       
T Consensus        37 ~~~~ge~~~l~C~~~~~~~~g~p~~~i~W~K-~g~~~~----~~~~~~~g~~l~i~~~~~~DsG~Y~C~a~N~~g~~~~s  111 (326)
T PHA02785         37 MELENEPVILPCPQINTLSSGYNILDILWEK-RGADND----RIIPIDNGSNMLILNPTQSDSGIYICITKNETYCDMMS  111 (326)
T ss_pred             hhhcCCCEEEECCCccccccCCCCceEEEEE-CCCccc----eEEEccCCceEEEcccCcccCeEEEEEEECCCcceEEE
Confidence            45679999999996     577778999999 654321    1212223445889999999999999999875       


Q ss_pred             ------------------------------------------CCccEEEEEEE-------eccccceEEEccCCCCCCeE
Q psy15390         90 ------------------------------------------GPLKIFWEIIF-------HMHYGEQLNITKISRTEMGA  120 (142)
Q Consensus        90 ------------------------------------------~~~~~~w~~~~-------~~~~~~~l~i~~~~~~d~g~  120 (142)
                                                                +++.+.|.+..       .....+.|.|.+++.+|+|.
T Consensus       112 ~~L~V~~~~~~~~~~~~~~~~~~~g~~~~i~C~~~~~~~~~~~~~~i~W~k~~~~~~~r~~~~~~~~L~i~~v~~~d~G~  191 (326)
T PHA02785        112 LNLTIVSVSESNIDLISYPQIVNERSTGEMVCPNINAFIASNVNADIIWSGHRRLRNKRLKQRTPGIITIEDVRKNDAGY  191 (326)
T ss_pred             EEEEEEecCCCccceeeccceecccCcEEEECCChhhcccCCCCceEEEccCCccCCcceEecCCCeEEEeecChhhCeE
Confidence                                                      12356774321       11224579999999999999


Q ss_pred             EEEEEecCCCC
Q psy15390        121 YLCIATNNVPP  131 (142)
Q Consensus       121 y~C~a~n~~~~  131 (142)
                      |+|.|.|..+.
T Consensus       192 Y~C~~~n~~g~  202 (326)
T PHA02785        192 YTCVLKYIYGD  202 (326)
T ss_pred             EEEEEEeccCC
Confidence            99999998765


No 37 
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of  the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. Ig2_RPTP_IIa_LAR_like: domain similar to the second immunoglobulin (Ig)-like domain found in the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. LAR belongs to the RPTP type IIa subfamily. Members of this subfamily are cell adhesion molecule-like proteins involved in central nervous system (CNS) development. They have large extracellular portions, comprised of multiple Ig-like domains and two to nine fibronectin type III (FNIII) domains, and a cytoplasmic portion having two tandem phosphatase domains.
Probab=99.64  E-value=4.2e-15  Score=80.05  Aligned_cols=74  Identities=28%  Similarity=0.522  Sum_probs=54.6

Q ss_pred             EEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEeccccceE
Q psy15390         29 ITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYGEQL  108 (142)
Q Consensus        29 v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~~~l  108 (142)
                      ++|.|.+.|.|.|.+.|++ ++..+......++...                                       ..+.|
T Consensus         1 a~l~C~~~G~P~p~v~W~k-~~~~~~~~~~~~~~~~---------------------------------------~~g~L   40 (74)
T cd05738           1 ATMLCAASGNPDPEITWFK-DFLPVDTTSNGRIKQL---------------------------------------RSGAL   40 (74)
T ss_pred             CEEEEEEeEecCCEEEEEE-CCEECccCCCCCEEEc---------------------------------------CCcEE
Confidence            4789999999999999999 7765532111111111                                       12347


Q ss_pred             EEccCCCCCCeEEEEEEecCCCCCeeeEEEEEEC
Q psy15390        109 NITKISRTEMGAYLCIATNNVPPSVSKRITVDVE  142 (142)
Q Consensus       109 ~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V~  142 (142)
                      .|..+..+|+|.|+|.|.|..|...+..+.|.||
T Consensus        41 ~i~~~~~~D~G~Y~C~a~N~~G~~~s~~a~l~v~   74 (74)
T cd05738          41 QIENSEESDQGKYECVATNSAGTRYSAPANLYVR   74 (74)
T ss_pred             EECCCChhhCEEEEEEEECCCCceEcccEEEEEC
Confidence            8888889999999999999999877888888886


No 38 
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig2_Robo: domain similar to the second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antago
Probab=99.63  E-value=9.7e-15  Score=80.82  Aligned_cols=84  Identities=30%  Similarity=0.577  Sum_probs=59.1

Q ss_pred             CCceeEEecCCcEEEEEEE-ecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEE
Q psy15390         17 TPSSVAVREEFNITLTCKA-EGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIF   95 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~-~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~   95 (142)
                      .|....+.+|+++.|.|.+ .+.|.+.+.|++ ++..+..... +.....                              
T Consensus         2 ~p~~~~~~~G~~v~l~C~~~~g~p~p~i~W~k-~g~~~~~~~~-~~~~~~------------------------------   49 (86)
T cd05724           2 EPSDTQVAVGEMAVLECSPPRGHPEPTVSWRK-DGQPLNLDNE-RVRIVD------------------------------   49 (86)
T ss_pred             CCccEEEeCCCCEEEEEECCCCCCCCEEEEEE-CCEECCCCCC-CEEEcc------------------------------
Confidence            4567788899999999998 688888999999 7766533110 100111                              


Q ss_pred             EEEEEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390         96 WEIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus        96 w~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                               .+.|.|.+++.+|+|.|+|.|.|..|...+..+.|.|
T Consensus        50 ---------~~~L~I~~~~~~D~G~Y~C~a~N~~G~~~s~~~~l~V   86 (86)
T cd05724          50 ---------DGNLLIAEARKSDEGTYKCVATNMVGERESAAARLSV   86 (86)
T ss_pred             ---------CCEEEEeECCcccCEEEEEEEEeccCceeeeeEEEEC
Confidence                     2347777888888888888888888775566666654


No 39 
>KOG4221|consensus
Probab=99.63  E-value=2.5e-15  Score=112.20  Aligned_cols=120  Identities=28%  Similarity=0.524  Sum_probs=97.4

Q ss_pred             CCceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEec-------
Q psy15390         17 TPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKI-------   89 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~-------   89 (142)
                      .+....+.+|+++.|.|.+.+.|.|.|.|.+ ++..+..+. .++.....+.|.|.+++..|+|.|+|.+.|.       
T Consensus       243 ~p~~~~v~~g~~v~leCvvs~~p~p~v~Wlr-ng~~i~~ds-~rivl~g~~slliS~a~~~dSg~YtC~Atn~~D~idas  320 (1381)
T KOG4221|consen  243 EPSNAVVVEGDDVVLECVVSGVPKPSVKWLR-NGEKISVDS-YRIVLVGGSSLLISNATDDDSGKYTCRATNTNDSIDAS  320 (1381)
T ss_pred             CCCccccccCCcEEEEEEecCCCCCceEEee-CCeeeeecc-eEEEEecccceEEeccccccCceEEEEecCCCcccccc
Confidence            6778889999999999999999999999999 998887665 5555666778999999999999999999973       


Q ss_pred             -----------------------------------CCccEEEEEE---------EeccccceEEEccCCCCCCeEEEEEE
Q psy15390         90 -----------------------------------GPLKIFWEII---------FHMHYGEQLNITKISRTEMGAYLCIA  125 (142)
Q Consensus        90 -----------------------------------~~~~~~w~~~---------~~~~~~~~l~i~~~~~~d~g~y~C~a  125 (142)
                                                         +.+.+.|.++         +.+..++.+.|..+-..|.|.|.|.+
T Consensus       321 aev~V~a~P~~~~~p~~l~A~e~~die~ec~~~g~p~p~v~w~kNgd~~ipsdy~ki~~~~~lrIlgi~~sdeg~yQcva  400 (1381)
T KOG4221|consen  321 AEVTVLAPPGFTKAPTTLVAHESMDIEFECPVSGKPIPTVRWYKNGDRIIPSDYFKIVGGGNLRILGIVKSDEGFYQCVA  400 (1381)
T ss_pred             eEEEEEcCCCCCCCCcceeeeeccceeEeCCCCCCCcceEEEEecCcccCcccceEecCCCCcEEEEEecccchhhhhhh
Confidence                                               2356777653         33444445888888899999999999


Q ss_pred             ecCCCCCeeeEEEE
Q psy15390        126 TNNVPPSVSKRITV  139 (142)
Q Consensus       126 ~n~~~~~~s~~~~l  139 (142)
                      +|..|. +...+.|
T Consensus       401 en~~G~-a~a~a~l  413 (1381)
T KOG4221|consen  401 ENDAGS-AQAAAQL  413 (1381)
T ss_pred             ccCccc-ccchhhh
Confidence            999987 4544444


No 40 
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin. Ig_Palladin_C: C-terminal immunoglobulin (Ig)-like domain of palladin. Palladin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to this family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Palladin binds to alpha-actinin ezrin, vasodilator-stimulated phosphoprotein VASP, SPIN90 (DIP, mDia interacting protein), and Src. Palladin also binds F-actin directly, via its Ig3 domain. Palladin is expressed as several alternatively spliced isoforms, having various combinations of Ig-like domains, in a cell-type-specific manner. It has been suggested that palladin's different Ig-like domains may be specialized for distinct functions.
Probab=99.62  E-value=6.1e-15  Score=79.46  Aligned_cols=75  Identities=31%  Similarity=0.548  Sum_probs=52.9

Q ss_pred             EEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEeccccceE
Q psy15390         29 ITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYGEQL  108 (142)
Q Consensus        29 v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~~~l  108 (142)
                      |+|.|.+.|.|.|.+.|++ ++..+.... .++....+           +.|                        ...|
T Consensus         1 v~l~C~v~G~P~P~v~W~k-~~~~l~~~~-~~~~~~~~-----------~~~------------------------~~~L   43 (75)
T cd05893           1 VRLECRVSGVPHPQIFWKK-ENESLTHNT-DRVSMHQD-----------NCG------------------------YICL   43 (75)
T ss_pred             CEEEEEEeEecCCEEEEEE-CCEECCCCC-CeEEEEEc-----------CCC------------------------EEEE
Confidence            5799999999999999999 777654221 11111100           000                        1148


Q ss_pred             EEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        109 NITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       109 ~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      .|..+..+|+|.|+|.|.|..|. ++.++.|.|
T Consensus        44 ~I~~v~~~D~G~Y~C~A~N~~G~-~~~~a~L~V   75 (75)
T cd05893          44 LIQGATKEDAGWYTVSAKNEAGI-VSCTARLDV   75 (75)
T ss_pred             EECCCCHHHCEEEEEEEEcCCCE-EEEEEEEeC
Confidence            88899999999999999999996 677787765


No 41 
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig4_Neogenin: fourth immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=99.62  E-value=1.2e-14  Score=77.69  Aligned_cols=71  Identities=21%  Similarity=0.496  Sum_probs=50.7

Q ss_pred             cEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEeccccce
Q psy15390         28 NITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYGEQ  107 (142)
Q Consensus        28 ~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~~~  107 (142)
                      ++.|.|.+.|.|.|.+.|++ ++..+......  ....                                       .+.
T Consensus         1 ~v~l~C~~~G~P~p~v~W~k-~g~~~~~~~~~--~~~~---------------------------------------~~~   38 (71)
T cd05723           1 DVIFECEVTGKPTPTVKWVK-NGDMVIPSDYF--KIVK---------------------------------------EHN   38 (71)
T ss_pred             CEEEEEEEEEeCCCEEEEEE-CCeECCCCCCE--EEEe---------------------------------------cCC
Confidence            47899999999999999999 77655322111  1111                                       123


Q ss_pred             EEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        108 LNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       108 l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      +.|..++.+|+|.|+|.|.|..|. .+..+.|.|
T Consensus        39 l~i~~v~~~D~G~Y~C~A~N~~G~-~~~~~~L~V   71 (71)
T cd05723          39 LQVLGLVKSDEGFYQCIAENDVGN-VQASAQLII   71 (71)
T ss_pred             EEEEcCCcccCEEEEEEEEcCCCE-EEEEEEEEC
Confidence            566688888999999999999886 677777765


No 42 
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig1_FGFR: The first immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for all FGFs.
Probab=99.62  E-value=1.5e-14  Score=78.82  Aligned_cols=78  Identities=21%  Similarity=0.430  Sum_probs=54.3

Q ss_pred             ceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEE
Q psy15390         19 SSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEI   98 (142)
Q Consensus        19 ~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~   98 (142)
                      +...+.+|+.+.|.|.+.+. .+.+.|++ +|..+....+.+  . .                                 
T Consensus         2 ~~~~~~~G~~v~l~C~~~~~-~~~v~W~k-~g~~l~~~~~~~--~-~---------------------------------   43 (79)
T cd04973           2 ESYSAHPGDLLQLRCRLRDD-VQSINWTK-DGVQLGENNRTR--I-T---------------------------------   43 (79)
T ss_pred             CcEEecCCCCEEEEEEecCC-CceEEEee-CCcCCCCCceEE--E-e---------------------------------
Confidence            45678899999999999886 56899999 887764322111  1 0                                 


Q ss_pred             EEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390         99 IFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus        99 ~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                            ...|.|..+..+|+|.|+|.|.|..|. ....+.|.|
T Consensus        44 ------~~~L~I~~~~~~DsG~Y~C~a~n~~g~-~~~~~~v~V   79 (79)
T cd04973          44 ------GEEVQIKDAVPRDSGLYACVTSSPSGS-DTTYFSVNV   79 (79)
T ss_pred             ------CCEEEECCCChhhCEEEEEEEeCCCCc-ccEEEEEeC
Confidence                  124777777788888888888877765 555565554


No 43 
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins. Ig_Titin_like: immunoglobulin (Ig)-like domain found in titin-like proteins. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic, depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone.  It appears to function similarly to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching. Within the sarcomere, titin is also attached to or is associated with myosin binding protein C (MyBP-C). MyBP-C appears to contribute to the generation of passive tension by titin, and similar to titin has repeated Ig-like and FN-
Probab=99.61  E-value=1.7e-14  Score=77.65  Aligned_cols=74  Identities=24%  Similarity=0.476  Sum_probs=53.6

Q ss_pred             cEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEeccccce
Q psy15390         28 NITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYGEQ  107 (142)
Q Consensus        28 ~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~~~  107 (142)
                      .+.|.|.+.|.|.|.+.|++ ++..+....+..+..                                      ......
T Consensus         1 ~~~l~c~~~G~P~p~v~W~k-~g~~l~~~~~~~~~~--------------------------------------~~~~~~   41 (74)
T cd05748           1 SVRLEVPISGRPTPTVTWSK-DGKPLKLSGRVQIET--------------------------------------TASSTS   41 (74)
T ss_pred             CEEEEeeEeeeCCCeEEEEE-CCEEcCCCCeEEEEE--------------------------------------CCCeEE
Confidence            47899999999999999999 777663222111100                                      011235


Q ss_pred             EEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        108 LNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       108 l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      |.|..+..+|+|.|+|.|.|..|. .+..+.|.|
T Consensus        42 L~I~~~~~~D~G~Y~C~a~N~~G~-~~~~~~l~V   74 (74)
T cd05748          42 LVIKNAERSDSGKYTLTLKNPAGE-KSATINVKV   74 (74)
T ss_pred             EEECCCCcCcCEEEEEEEECCCcc-EEEEEEEEC
Confidence            888899999999999999999986 677777765


No 44 
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. Ig2_FGFR: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three IG-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin sulfate proteoglycans.
Probab=99.61  E-value=2.1e-14  Score=79.36  Aligned_cols=82  Identities=20%  Similarity=0.446  Sum_probs=59.3

Q ss_pred             eEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEE
Q psy15390         21 VAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIF  100 (142)
Q Consensus        21 ~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~  100 (142)
                      ..+.+|+.+.|.|.+.+.|.+.+.|++ +|..+.......       ...+                             
T Consensus         4 ~~v~~G~~~~L~C~~~g~P~p~i~W~k-~g~~l~~~~~~~-------~~~~-----------------------------   46 (85)
T cd05857           4 HAVPAANTVKFRCPAAGNPTPTMRWLK-NGKEFKQEHRIG-------GYKV-----------------------------   46 (85)
T ss_pred             EEcCCCCEEEEEEEcCCCCCCEEEEEE-CCEECCCCCcee-------eeEE-----------------------------
Confidence            357789999999999999999999999 777654321100       0000                             


Q ss_pred             eccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        101 HMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       101 ~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                       ......|.|..+..+|+|.|+|.|.|..|. ....+.|.|
T Consensus        47 -~~~~~~l~i~~~~~~D~G~Y~C~a~N~~G~-~~~~~~l~v   85 (85)
T cd05857          47 -RNQHWSLIMESVVPSDKGNYTCVVENEYGS-INHTYHLDV   85 (85)
T ss_pred             -eCCceEEEEccCCcccCEEEEEEEEeCCCE-EEEEEEEEC
Confidence             001224778888999999999999999996 677777765


No 45 
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). Ig4_L1-NrCAM_like: fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). These proteins belong to the L1 subfamily of cell adhesion molecules (CAMs) and are comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. These molecules are primarily expressed in the nervous system. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=99.61  E-value=1.5e-14  Score=78.25  Aligned_cols=75  Identities=27%  Similarity=0.401  Sum_probs=55.8

Q ss_pred             CCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEecccc
Q psy15390         26 EFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYG  105 (142)
Q Consensus        26 g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~  105 (142)
                      |+++.|.|.+.+.|.|.+.|++ ++..+........                                       .....
T Consensus         1 G~~~~l~C~~~g~P~p~i~W~~-~g~~~~~~~~~~~---------------------------------------~~~~~   40 (76)
T cd04978           1 GETGRLDCEAEGIPQPTITWRL-NGVPIEELPPDPR---------------------------------------RRVDG   40 (76)
T ss_pred             CCeEEEEEEceeeCCCEEEEEE-CCEECCCCCCcce---------------------------------------EEccC
Confidence            7899999999999999999999 7776543211100                                       00113


Q ss_pred             ceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        106 EQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       106 ~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      +.|.|..++.+|+|.|+|.|.|..|. .+..+.|.|
T Consensus        41 ~~L~i~~v~~~D~G~Y~C~A~N~~G~-~~~~~~l~V   75 (76)
T cd04978          41 GTLILSNVQPNDTAVYQCNASNVHGY-LLANAFVHV   75 (76)
T ss_pred             CEEEECCCChhhCEEEEEEEEccCCe-EEEeEEEEE
Confidence            45888888889999999999999886 677777776


No 46 
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). Ig8_DSCAM:  the eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion.
Probab=99.61  E-value=3.5e-14  Score=78.88  Aligned_cols=82  Identities=18%  Similarity=0.314  Sum_probs=56.4

Q ss_pred             CCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEecccc
Q psy15390         26 EFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYG  105 (142)
Q Consensus        26 g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~  105 (142)
                      |+.+.|.|.+.+.|.+.+.|++ ++..+.... .++.        +..-..   |.                     ...
T Consensus         1 g~~~~l~C~~~g~p~~~i~W~k-~~~~i~~~~-~r~~--------~~~~~~---~~---------------------~~~   46 (88)
T cd05735           1 GQKKEMSCTAHGEKPIIVRWEK-EDRIINPEM-SRYL--------VSTKEV---GD---------------------EVI   46 (88)
T ss_pred             CCeEEEEEEEECCCCCEEEEee-CCEECCCCC-CcEE--------EEEecC---CC---------------------cEE
Confidence            7899999999999999999999 776553221 1111        110000   00                     002


Q ss_pred             ceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEEC
Q psy15390        106 EQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDVE  142 (142)
Q Consensus       106 ~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V~  142 (142)
                      +.|.|..+..+|+|.|+|.|.|..|. .+..+.|.|+
T Consensus        47 s~L~I~~~~~~D~G~YtC~A~N~~G~-~~~~~~L~V~   82 (88)
T cd05735          47 STLQILPTVREDSGFFSCHAINSYGE-DRGIIQLTVQ   82 (88)
T ss_pred             EEEEECCCCcccCEEEEEEEEcCCCc-ceEEEEEEEe
Confidence            34888899999999999999999986 6777777764


No 47 
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3). Ig2_VEGFR-3: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-3 (Flt-4) binds two members of the VEGF family (VEGF-C and -D) and is involved in tumor angiogenesis and growth.
Probab=99.61  E-value=9.7e-15  Score=76.75  Aligned_cols=64  Identities=28%  Similarity=0.583  Sum_probs=47.4

Q ss_pred             EEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEeccccceE
Q psy15390         29 ITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYGEQL  108 (142)
Q Consensus        29 v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~~~l  108 (142)
                      +.|.|.+.+.|.|.+.|++ +|+.+...       ..                                       .+.|
T Consensus         1 ~~l~c~v~g~P~P~v~W~k-dg~~l~~~-------~~---------------------------------------~~~L   33 (67)
T cd05863           1 VKLPVKVAAYPPPEFQWYK-DGKLISGK-------HS---------------------------------------QHSL   33 (67)
T ss_pred             CEEEEEEEEeCCCEEEEEE-CCEECccc-------CC---------------------------------------cCEE
Confidence            4789999999999999999 88766310       00                                       2347


Q ss_pred             EEccCCCCCCeEEEEEEecCCCCCeeeEEEEE
Q psy15390        109 NITKISRTEMGAYLCIATNNVPPSVSKRITVD  140 (142)
Q Consensus       109 ~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~  140 (142)
                      .|.++..+|+|.|+|.|.|..|. .+..+.+.
T Consensus        34 ~i~~v~~~D~G~YtC~a~N~~g~-~~~~~~~~   64 (67)
T cd05863          34 QIKDVTEASAGTYTLVLWNSAAG-LEKRISLE   64 (67)
T ss_pred             EECCCCHHHCEEEEEEEEECCcc-EEEEEEEE
Confidence            88888888888888888888875 44444443


No 48 
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin. Ig_Myotilin_like_C: immunoglobulin (Ig)-like domain in myotilin, palladin, and myopalladin.  Myotilin, palladin, and myopalladin function as scaffolds that regulate actin organization. Myotilin and myopalladin are most abundant in skeletal and cardiac muscle; palladin is ubiquitously expressed in the organs of developing vertebrates and  plays a key role in cellular morphogenesis. The three family members each interact with specific molecular partners: all three bind to alpha-actinin; in addition, palladin also binds to vasodilator-stimulated phosphoprotein (VASP) and ezrin, myotilin binds to filamin and actin, and myopalladin also binds to nebulin and cardiac ankyrin repeat protein (CARP).
Probab=99.59  E-value=3.4e-14  Score=76.62  Aligned_cols=75  Identities=25%  Similarity=0.498  Sum_probs=52.5

Q ss_pred             EEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEeccccceE
Q psy15390         29 ITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYGEQL  108 (142)
Q Consensus        29 v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~~~l  108 (142)
                      ++|.|.+.|.|.|.+.|++ ++..+..... ++....           .+.|                        ...|
T Consensus         1 v~L~C~v~G~P~P~v~W~k-~~~~i~~~~~-r~~~~~-----------~~~~------------------------~~~L   43 (75)
T cd05744           1 VRLECRVSAIPPPQIFWKK-NNEMLTYNTD-RISLYQ-----------DNCG------------------------RICL   43 (75)
T ss_pred             CEEEEEEeecCCCeEEEEE-CCEECCCCCC-cEEEEE-----------cCCC------------------------eEEE
Confidence            4799999999999999999 7776642211 110000           0000                        1148


Q ss_pred             EEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        109 NITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       109 ~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      .|..++.+|+|.|+|.|.|..|. .+..+.|.|
T Consensus        44 ~I~~~~~~D~G~Y~C~a~N~~G~-~~~~~~l~v   75 (75)
T cd05744          44 LIQNANKEDAGWYTVSAVNEAGV-VSCNARLDV   75 (75)
T ss_pred             EECCCCcccCEEEEEEEEcCCCc-EEEEEEEeC
Confidence            88899999999999999999986 677777765


No 49 
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin. Ig5_Contactin_like: Fifth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=99.59  E-value=2.1e-14  Score=77.14  Aligned_cols=73  Identities=21%  Similarity=0.461  Sum_probs=52.8

Q ss_pred             CCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEecccc
Q psy15390         26 EFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYG  105 (142)
Q Consensus        26 g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~  105 (142)
                      |+++.|.|.+.+.|.+.+.|++ ++..+....+.  ...                                       ..
T Consensus         1 G~~v~L~C~~~g~P~p~v~W~k-~~~~~~~~~~~--~~~---------------------------------------~~   38 (73)
T cd04969           1 GGDVIIECKPKAAPKPTISWSK-GTELLTNSSRI--CIW---------------------------------------PD   38 (73)
T ss_pred             CCeEEEEEeeeEcCCCEEEEEE-CCEEcccCCCE--EEC---------------------------------------CC
Confidence            7889999999999999999999 77654322111  111                                       12


Q ss_pred             ceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        106 EQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       106 ~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      +.|.|.+++.+|+|.|+|.|.|..|. .+..+.|.|
T Consensus        39 ~~L~i~~v~~~D~G~Y~C~a~N~~G~-~~~~~~l~V   73 (73)
T cd04969          39 GSLEILNVTKSDEGKYTCFAENFFGK-ANSTGSLSV   73 (73)
T ss_pred             CeEEEccCChhHCEEEEEEEECCCCc-eEEEEEEEC
Confidence            34788888888888888888888886 566676665


No 50 
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM:  third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=99.59  E-value=1.6e-14  Score=77.17  Aligned_cols=71  Identities=34%  Similarity=0.692  Sum_probs=53.2

Q ss_pred             EEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEeccccceE
Q psy15390         29 ITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYGEQL  108 (142)
Q Consensus        29 v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~~~l  108 (142)
                      +.|.|.+.|.|.|.+.|++ ++..+..... .  .                                      ......|
T Consensus         1 ~~L~C~~~G~P~P~v~W~k-~~~~~~~~~~-~--~--------------------------------------~~~~~~L   38 (71)
T cd05876           1 LVLECIAEGLPTPEVHWDR-IDGPLSPNRT-K--K--------------------------------------LNNNKTL   38 (71)
T ss_pred             CEEEEEeeEecCCeEEEEE-CCcCCCCCce-e--E--------------------------------------EcCCCEE
Confidence            4689999999999999999 6654422100 0  0                                      0113458


Q ss_pred             EEccCCCCCCeEEEEEEecCCCCCeeeEEEEEEC
Q psy15390        109 NITKISRTEMGAYLCIATNNVPPSVSKRITVDVE  142 (142)
Q Consensus       109 ~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V~  142 (142)
                      .|..++.+|+|.|+|.|.|..|. .+..+.|.||
T Consensus        39 ~I~~v~~~D~G~Y~C~a~N~~G~-~~~~~~l~Ve   71 (71)
T cd05876          39 QLDNVLESDDGEYVCTAENSEGS-ARHHYTVTVE   71 (71)
T ss_pred             EEcccCHHhCEEEEEEEEcCCCe-EEEEEEEEEC
Confidence            88899999999999999999996 7888888886


No 51 
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs). Ig2_Tyro3_like: the second immunoglobulin (Ig)-like domain in the Axl/Tyro3 family of receptor tyrosine kinases (RTKs). This family includes Axl (also known as Ark, Ufo, and Tyro7), Tyro3 (also known as Sky, Rse, Brt, Dtk, and Tif), and Mer (also known as Nyk, c-Eyk, and Tyro12). Axl/Tyro3 family receptors have an extracellular portion with two Ig-like domains followed by two fibronectin-types III (FNIII) domains, a membrane-spanning single helix, and a cytoplasmic tyrosine kinase domain. Axl, Tyro3 and Mer are widely expressed in adult tissues, though they show higher expression in the brain, in the lymphatic and vascular systems, and in the testis. Axl, Tyro3, and Mer bind the vitamin K dependent protein Gas6 with high affinity, and in doing so activate their tyrosine kinase activity. Axl/Gas6 signaling may play a part in cell adhesion processes, prevention of apoptosis, and c
Probab=99.58  E-value=3.8e-14  Score=77.38  Aligned_cols=76  Identities=29%  Similarity=0.470  Sum_probs=54.7

Q ss_pred             CCceeEEecCCcEEEEEEEecCCCC-eeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEE
Q psy15390         17 TPSSVAVREEFNITLTCKAEGFPAP-EIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIF   95 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~~~~~-~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~   95 (142)
                      .|+.+.+.+|+++.|.|.+.|.|.| .+.|++ +|+.+....     ...                              
T Consensus         4 ~P~~~~v~~G~~v~l~C~a~G~P~P~~I~W~k-~g~~l~~~~-----~~~------------------------------   47 (81)
T cd05749           4 EPEDLSVTANTPFNLTCQAVGPPEPVEILWWQ-GGSPLGDPP-----APS------------------------------   47 (81)
T ss_pred             CCCceEEcCCCCEEEEEEeeeecCCeEEEEEE-CCEECCCCC-----CCC------------------------------
Confidence            5677889999999999999999999 799999 887653200     001                              


Q ss_pred             EEEEEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEE
Q psy15390         96 WEIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITV  139 (142)
Q Consensus        96 w~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l  139 (142)
                               .+.|.|..+  .|+|.|.|.|.|..|...+..+.|
T Consensus        48 ---------~s~L~i~~~--~d~g~Y~C~A~N~~G~~~s~~a~~   80 (81)
T cd05749          48 ---------PSVLNVPGL--NETSKFSCEAHNAKGVTTSRTGTV   80 (81)
T ss_pred             ---------CCEEEEccc--cCCeEEEEEEEeccCcEEeeeEEe
Confidence                     123555444  367889999999888755555544


No 52 
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin. Ig8_hNephrin_like: domain similar to the eighth immunoglobulin-like domain in human nephrin. Nephrin is an integral component of the slit diaphragm, and is a central component of the glomerular ultrafilter. Nephrin plays a structural role, and has a role in signaling. Nephrin is a transmembrane protein having a short intracellular portion, and an extracellular portion comprised of eight Ig-like domains, and one fibronectin type III-like domain. The extracellular portions of nephrin, from neighboring foot processes of separate podocyte cells, may interact with each other, and in association with other components of the slit diaphragm, form a porous molecular sieve within the slit pore.  The intracellular portion of nephrin is associated with linker proteins, which connect nephrin to the actin cytoskeleton. The intracellular portion is tyrosine phosphorylated, and mediates signaling from the slit diaphragm into the p
Probab=99.58  E-value=1.2e-13  Score=79.71  Aligned_cols=99  Identities=21%  Similarity=0.416  Sum_probs=63.6

Q ss_pred             ccCCCeeeecCCCCc--eeEE--ecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCe
Q psy15390          5 KSVPPNILDTESTPS--SVAV--REEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMG   80 (142)
Q Consensus         5 ~~~~p~~~~~~~~~~--~~~~--~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G   80 (142)
                      |..+|.|..   .+.  .+..  ..|..+.|.|.+.+.|.+.+.|++ ++..+.... .+...        ....   .|
T Consensus         1 v~~~P~~~~---~~~~~~~~~~~~~g~~v~L~C~a~G~P~p~i~W~k-~g~~l~~~~-~r~~~--------~~~~---~~   64 (109)
T cd05773           1 VRFAPDLQK---GPQLRKVASRGDGSSDANLVCQAQGVPRVQFRWAK-NGVPLDLGN-PRYEE--------TTEH---TG   64 (109)
T ss_pred             Ccccccccc---CCceEEEEEecCCCCEEEEEEECcccCCCEEEEEE-CCEECCCCC-CeEEE--------Eeec---cC
Confidence            355777766   333  2222  356899999999999999999999 887664221 11100        0000   00


Q ss_pred             EEEEEEEecCCccEEEEEEEeccccceEEEccCC-CCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390         81 AYLCIATKIGPLKIFWEIIFHMHYGEQLNITKIS-RTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus        81 ~y~C~~~~~~~~~~~w~~~~~~~~~~~l~i~~~~-~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      .                     ...+.|.|.++. .+|.|.|+|.|.|..|. .+..+.|.|
T Consensus        65 ~---------------------~~~s~L~I~~v~~~~D~G~Y~C~A~N~~G~-~~~~i~L~~  104 (109)
T cd05773          65 T---------------------VHTSILTIINVSAALDYALFTCTAHNSLGE-DSLDIQLVS  104 (109)
T ss_pred             c---------------------cceeEEEECcCCccCCCEEEEEEEEeCCcc-CcEEEEEEe
Confidence            0                     002358888886 58999999999999986 577777766


No 53 
>PHA02785 IL-beta-binding protein; Provisional
Probab=99.58  E-value=7.5e-14  Score=94.84  Aligned_cols=107  Identities=19%  Similarity=0.367  Sum_probs=77.1

Q ss_pred             eEEecCCcEEEEEE-----EecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEec------
Q psy15390         21 VAVREEFNITLTCK-----AEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKI------   89 (142)
Q Consensus        21 ~~~~~g~~v~l~C~-----~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~------   89 (142)
                      ..+.+|+.+.|.|.     ..+.+.+.+.|++ +.. +.   ..++....++.|.|.+++.+|.|.|+|.+.|.      
T Consensus       131 ~~~~~g~~~~i~C~~~~~~~~~~~~~~i~W~k-~~~-~~---~~r~~~~~~~~L~i~~v~~~d~G~Y~C~~~n~~g~~~~  205 (326)
T PHA02785        131 QIVNERSTGEMVCPNINAFIASNVNADIIWSG-HRR-LR---NKRLKQRTPGIITIEDVRKNDAGYYTCVLKYIYGDKTY  205 (326)
T ss_pred             ceecccCcEEEECCChhhcccCCCCceEEEcc-CCc-cC---CcceEecCCCeEEEeecChhhCeEEEEEEEeccCCEEE
Confidence            44668999999997     2356778999987 543 21   12333344568999999999999999998753      


Q ss_pred             ------------------------------------------CC---ccEEEEEEEecc---------------------
Q psy15390         90 ------------------------------------------GP---LKIFWEIIFHMH---------------------  103 (142)
Q Consensus        90 ------------------------------------------~~---~~~~w~~~~~~~---------------------  103 (142)
                                                                ++   +.+.|.++....                     
T Consensus       206 ~~t~~v~l~V~~~~~pp~~~~p~~~~~~~G~~v~L~C~a~g~P~~~~~~v~W~kng~~i~~~~~~~~~~~~~~~~~~~~~  285 (326)
T PHA02785        206 NVTRIVKLEVRDRIIPPTMQLPEGVVTSIGSNLTIACRVSLRPPTTDADVFWISNGMYYEEDDEDGDGRISVANKIYTTD  285 (326)
T ss_pred             eEEEEEEEEEeccCCCceecCCCcEEecCCCcEEEEEEEECCCCCCCceEEEEECCEECCCcCCCCceeEEEecCccccc
Confidence                                                      11   258897632110                     


Q ss_pred             ----ccceEEEccCCCCCCeEEEEEEecCCCCC
Q psy15390        104 ----YGEQLNITKISRTEMGAYLCIATNNVPPS  132 (142)
Q Consensus       104 ----~~~~l~i~~~~~~d~g~y~C~a~n~~~~~  132 (142)
                          ....|.|.+++.+|+|.|+|.|.|..+..
T Consensus       286 ~~~~~~~~L~I~~V~~~D~G~Y~C~A~n~~~~~  318 (326)
T PHA02785        286 KRRVITSRLNINPVKEEDATTFTCMAFTIPSIS  318 (326)
T ss_pred             cceeeeEEEEECCcchhcCeeeEEEEEeccCce
Confidence                02468899999999999999999987653


No 54 
>KOG4222|consensus
Probab=99.58  E-value=1.6e-14  Score=107.40  Aligned_cols=124  Identities=24%  Similarity=0.526  Sum_probs=100.6

Q ss_pred             CCceeEEecCCcEEEEEEE-ecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEec------
Q psy15390         17 TPSSVAVREEFNITLTCKA-EGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKI------   89 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~-~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~------   89 (142)
                      .+....+..|+.+.|.|.- .+.|.+.+.|.+ +|..+......++...+++.|.|.++...|.|.|.|.++|+      
T Consensus       137 ~prd~~~a~ge~avlEcgpP~ghpeptvSw~K-dg~pl~~~~~~~~~lisgG~LlIsnvrksD~GtY~CVatNmvG~ReS  215 (1281)
T KOG4222|consen  137 SPRDVQAAVGEEAVLECGPPRGHPEPTVSWVK-DGKPLDHYDVPIIALISGGNLLISNVRKSDEGTYACVATNMVGERES  215 (1281)
T ss_pred             CcccccccccceeEEeccCCCCCCCCcceeec-CCCccccccceeEEEecCCcEEEeccccCCCceeeeeeccccccccc
Confidence            6667788889999999974 456788999999 99999866666666778889999999999999999999987      


Q ss_pred             -------------------------------------CCccEEEEEE--------E-eccccceEEEccCCCCCCeEEEE
Q psy15390         90 -------------------------------------GPLKIFWEII--------F-HMHYGEQLNITKISRTEMGAYLC  123 (142)
Q Consensus        90 -------------------------------------~~~~~~w~~~--------~-~~~~~~~l~i~~~~~~d~g~y~C  123 (142)
                                                           +.+.+.|.+.        . ......++.|.+++..|.|+|.|
T Consensus       216 ~~A~lsv~e~P~f~~rp~~~~v~~g~~~~f~c~v~GdP~P~Vrwkk~~~~~P~~ry~i~~d~qtl~i~r~tp~deg~y~C  295 (1281)
T KOG4222|consen  216 IPARLSVQEKPWFWKRPKDLAVLVGAAAEFDCRVGGDPQPTVRWKKDDPSLPRSRYSILDDTQTLRIDRVTPTDEGTYVC  295 (1281)
T ss_pred             ccceeeeccCCccccccccceeecccccccccccCCCCCCceeeeccCCCCCccceeeeeccccccccccCCCcccceee
Confidence                                                 3356777641        1 22233678899999999999999


Q ss_pred             EEecCCCCCeeeEEEEEEC
Q psy15390        124 IATNNVPPSVSKRITVDVE  142 (142)
Q Consensus       124 ~a~n~~~~~~s~~~~l~V~  142 (142)
                      .|.|..|. .+|...|+|+
T Consensus       296 ~a~n~vG~-l~asa~ltV~  313 (1281)
T KOG4222|consen  296 PAENLVGG-LEASATLTVQ  313 (1281)
T ss_pred             eccccccc-cccccceEEe
Confidence            99999986 7888777774


No 55 
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig3_FGFR: third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for FGFs.
Probab=99.57  E-value=6.3e-14  Score=78.22  Aligned_cols=86  Identities=19%  Similarity=0.330  Sum_probs=55.8

Q ss_pred             CCcEEEEEEEecCCCCeeEEEecCCc----ceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEe
Q psy15390         26 EFNITLTCKAEGFPAPEIKWRREDNQ----PISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFH  101 (142)
Q Consensus        26 g~~v~l~C~~~~~~~~~~~w~~~~~~----~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~  101 (142)
                      |+.++|.|.+.+.|.|.+.|++ ++.    .+.......        ..+......                     ...
T Consensus         1 G~~v~l~C~v~g~P~P~i~W~k-~~~~~g~~~~~~~~~~--------~~~~~~~~~---------------------~~~   50 (90)
T cd04974           1 GSDVEFHCKVYSDAQPHIQWLK-HVEVNGSKYGPDGLPY--------VTVLKVAGI---------------------NTT   50 (90)
T ss_pred             CCcEEEEEEEeCCCCCeEEEEE-ecccCCceeCCCCCce--------EEEEEecCC---------------------ccc
Confidence            6889999999999999999999 432    111000000        000000000                     000


Q ss_pred             ccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEEC
Q psy15390        102 MHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDVE  142 (142)
Q Consensus       102 ~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V~  142 (142)
                      ......|.|.+++.+|+|.|+|.|.|..|. .+.++.|.|+
T Consensus        51 ~~~~~~L~I~~v~~~D~G~Y~C~A~N~~G~-~~~sa~L~V~   90 (90)
T cd04974          51 DNESEVLYLRNVSFDDAGEYTCLAGNSIGP-SHHSAWLTVL   90 (90)
T ss_pred             ccccceEEEeccccccCcEEEEEeecccCc-ccCCEEEEeC
Confidence            011235889999999999999999999997 6778888885


No 56 
>KOG4222|consensus
Probab=99.57  E-value=2.6e-14  Score=106.35  Aligned_cols=131  Identities=26%  Similarity=0.505  Sum_probs=95.1

Q ss_pred             CCCeeeecCCCCceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceec-CC-cceEEeeccceEEEeec----C-CCCC
Q psy15390          7 VPPNILDTESTPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISI-NK-RKKVHMHYGEQLNITKI----S-RTEM   79 (142)
Q Consensus         7 ~~p~~~~~~~~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~-~~-~~~~~~~~~~~l~i~~v----~-~~d~   79 (142)
                      .+|.++.   =+....+..|+.++|.|.+.|.|.|.+.||+ +|+.... .. ..++.. .+++|.+-.+    + ..|.
T Consensus        30 ~~p~iie---hp~d~vvs~~~patlnc~asG~ppPti~w~k-~G~~~~~~e~~shR~~l-p~gsLf~l~~ahg~~a~~d~  104 (1281)
T KOG4222|consen   30 QPPRIIE---HPHDLVVSKGEPATLNCKASGDPPPTIEWYK-DGENVFKGEPGSHRFLL-PDGSLFLLRLAHGKKAGHDH  104 (1281)
T ss_pred             CCCceEe---cchhhhccCCCCceeecCCCCCCCCceeccc-CCcccCCCCCCCcceec-CCccEEEEecccCCcccCCC
Confidence            4566654   4556678889999999999999999999999 8865432 22 344333 3444444333    1 2389


Q ss_pred             eEEEEEEEec---------------------------------------------CCccEEEEEE-----------Eecc
Q psy15390         80 GAYLCIATKI---------------------------------------------GPLKIFWEII-----------FHMH  103 (142)
Q Consensus        80 G~y~C~~~~~---------------------------------------------~~~~~~w~~~-----------~~~~  103 (142)
                      |.|.|.+.|.                                             +.+.+.|.+.           ....
T Consensus       105 G~y~cvasn~~g~avSr~a~L~vavlrddfrv~prd~~~a~ge~avlEcgpP~ghpeptvSw~Kdg~pl~~~~~~~~~li  184 (1281)
T KOG4222|consen  105 GVYSCVASNRLGEAVSRGASLIVAVLRDDFRVSPRDVQAAVGEEAVLECGPPRGHPEPTVSWVKDGKPLDHYDVPIIALI  184 (1281)
T ss_pred             ceeEeeecCccceeeecCceEEEEEechhcccCcccccccccceeEEeccCCCCCCCCcceeecCCCccccccceeEEEe
Confidence            9999999875                                             3356777532           2334


Q ss_pred             ccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEEC
Q psy15390        104 YGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDVE  142 (142)
Q Consensus       104 ~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V~  142 (142)
                      ..+.|.|.++..+|+|+|.|.|.|..|.+.+...+|.|.
T Consensus       185 sgG~LlIsnvrksD~GtY~CVatNmvG~ReS~~A~lsv~  223 (1281)
T KOG4222|consen  185 SGGNLLISNVRKSDEGTYACVATNMVGERESIPARLSVQ  223 (1281)
T ss_pred             cCCcEEEeccccCCCceeeeeecccccccccccceeeec
Confidence            577899999999999999999999999887887777763


No 57 
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1. Ig1_Contactin-1: First Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may, through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=99.57  E-value=9.2e-14  Score=77.94  Aligned_cols=86  Identities=27%  Similarity=0.497  Sum_probs=55.4

Q ss_pred             CeeeecCCCCceeEEec---CCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEE
Q psy15390          9 PNILDTESTPSSVAVRE---EFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCI   85 (142)
Q Consensus         9 p~~~~~~~~~~~~~~~~---g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~   85 (142)
                      |.|..   .|....+.+   |..+.|.|.+.|.|.|.+.|++ ++..+.... .+.. ..                    
T Consensus         2 P~f~~---~P~~~~~~~~~~~~~v~l~C~a~G~P~P~i~W~k-~~~~i~~~~-~~~~-~~--------------------   55 (93)
T cd05849           2 PVFEE---QPIDTIYPEESTEGKVSVNCRARANPFPIYKWRK-NNLDIDLTN-DRYS-MV--------------------   55 (93)
T ss_pred             CEEEE---CCCCEEecCCccCCeEEEeCcCccCCCCEEEEEE-CCEEccCCC-CeEE-EE--------------------
Confidence            56665   455544444   3479999999999999999999 776543211 0110 01                    


Q ss_pred             EEecCCccEEEEEEEeccccceEEEccCC-CCCCeEEEEEEecCCCCCeeeEEEE
Q psy15390         86 ATKIGPLKIFWEIIFHMHYGEQLNITKIS-RTEMGAYLCIATNNVPPSVSKRITV  139 (142)
Q Consensus        86 ~~~~~~~~~~w~~~~~~~~~~~l~i~~~~-~~d~g~y~C~a~n~~~~~~s~~~~l  139 (142)
                                         ++.|.|.++. .+|+|.|+|.|.|..|...+..+.|
T Consensus        56 -------------------~g~L~I~~~~~~~D~G~Y~C~A~N~~G~~~s~~a~l   91 (93)
T cd05849          56 -------------------GGNLVINNPDKYKDAGRYVCIVSNIYGKVRSREATL   91 (93)
T ss_pred             -------------------CCEEEECcCCcCCCCEEEEEEEEeCcceEEEccEEE
Confidence                               2346666664 5788888888888888654555554


No 58 
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). Ig2_FGFRL1-like: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). FGFRL1 is comprised of a signal peptide, three extracellular Ig-like modules, a transmembrane segment, and a short intracellular domain. FGFRL1 is expressed preferentially in skeletal tissues. Similar to FGF receptors, the expressed protein interacts specifically with heparin and with FGF2.  FGFRL1 does not have a protein tyrosine kinase domain at its C terminus; neither does its cytoplasmic domain appear to interact with a signaling partner. It has been suggested that FGFRL1 may not have any direct signaling function, but instead acts as a decoy receptor trapping FGFs and preventing them from binding other receptors.
Probab=99.57  E-value=4.3e-14  Score=77.45  Aligned_cols=79  Identities=25%  Similarity=0.497  Sum_probs=57.0

Q ss_pred             eEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEE
Q psy15390         21 VAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIF  100 (142)
Q Consensus        21 ~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~  100 (142)
                      +.+..|+++.|.|.+.+.|.+.+.|++ ++..+.......  .                                     
T Consensus         4 ~~~~~G~~v~L~C~~~g~p~p~i~W~k-~~~~~~~~~~~~--~-------------------------------------   43 (82)
T cd05856           4 IARPVGSSVRLKCVASGNPRPDITWLK-DNKPLTPTEIGE--S-------------------------------------   43 (82)
T ss_pred             eeccCCCeEEEEEEeeEeCCCcEEEEE-CCcCCcCCccce--e-------------------------------------
Confidence            456679999999999999999999999 766543221000  0                                     


Q ss_pred             eccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        101 HMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       101 ~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                       ......|.|.++..+|+|.|+|.|.|..|. .+..+.|.|
T Consensus        44 -~~~~~~L~i~~v~~~D~G~Y~C~a~N~~G~-~~~~~~v~v   82 (82)
T cd05856          44 -RKKKWTLSLKNLKPEDSGKYTCHVSNRAGE-INATYKVDV   82 (82)
T ss_pred             -cCceEEEEEccCChhhCEEEEEEEEcCCcc-EEEEEEEeC
Confidence             001234788888889999999999998886 677777664


No 59 
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Ig_Perlecan_D2_like: the immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Perlecan consists of five domains. Domain I has three putative heparan sulfate attachment sites; domain II has four LDL receptor-like repeats, and one Ig-like repeat; domain III resembles the short arm of laminin chains; domain IV has multiple Ig-like repeats (21 repeats in human perlecan); and domain V resembles the globular G domain of the laminin A chain and internal repeats of EGF. Perlecan may participate in a variety of biological functions including cell binding, LDL-metabolism, basement membrane assembly and selective permeability, calcium binding, and growth- and neurite-promoting activities.
Probab=99.57  E-value=4.7e-14  Score=76.69  Aligned_cols=67  Identities=27%  Similarity=0.424  Sum_probs=44.7

Q ss_pred             CCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEecccc
Q psy15390         26 EFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYG  105 (142)
Q Consensus        26 g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~  105 (142)
                      |+++.|.|.+.+.|.|.+.|++ ++..+....+..+.. .                                     ...
T Consensus         1 G~~v~l~C~~~g~P~p~v~W~~-~~~~~~~~~~~~~~~-~-------------------------------------~~~   41 (78)
T cd05743           1 GETVEFTCVATGVPTPIINWRL-NWGHVPDSARVSITS-E-------------------------------------GGY   41 (78)
T ss_pred             CCEEEEEEEEEEecCCEEEEEE-CCeECCCCCCEEEEE-C-------------------------------------CCE
Confidence            7889999999999999999999 665443221111000 0                                     012


Q ss_pred             ceEEEccCCCCCCeEEEEEEecCCCC
Q psy15390        106 EQLNITKISRTEMGAYLCIATNNVPP  131 (142)
Q Consensus       106 ~~l~i~~~~~~d~g~y~C~a~n~~~~  131 (142)
                      ..|.|.++..+|+|.|+|.|.|..|.
T Consensus        42 ~~L~I~~v~~~D~G~Y~C~a~N~~G~   67 (78)
T cd05743          42 GTLTIRDVKESDQGAYTCEAINTRGM   67 (78)
T ss_pred             EEEEECCCChHHCEEEEEEEEecCCE
Confidence            24677777777777777777777775


No 60 
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily. Ig_1: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=99.56  E-value=8.5e-14  Score=75.10  Aligned_cols=73  Identities=27%  Similarity=0.588  Sum_probs=50.3

Q ss_pred             EEEEEEEecCCCCeeEEEecCCcce-ecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEeccccce
Q psy15390         29 ITLTCKAEGFPAPEIKWRREDNQPI-SINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYGEQ  107 (142)
Q Consensus        29 v~l~C~~~~~~~~~~~w~~~~~~~~-~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~~~  107 (142)
                      +.|.|.+.|.|.|.+.|++ ++... ......++..                                      ....+.
T Consensus         1 a~l~C~~~G~P~P~v~W~k-~~~~~~~~~~~~~~~~--------------------------------------~~~~~~   41 (75)
T cd05763           1 ARLECAATGHPTPQIAWQK-DGGTDFPAARERRMHV--------------------------------------MPEDDV   41 (75)
T ss_pred             CEeEeecccccCCEEEEEe-CCCccCCcccccceEE--------------------------------------ecCCCE
Confidence            3689999999999999999 65432 1111001000                                      011235


Q ss_pred             EEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        108 LNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       108 l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      |.|.+++.+|+|.|+|.|.|..|. .+..+.|.|
T Consensus        42 L~I~~~~~~D~G~Y~C~A~N~~G~-~~~~~~l~V   74 (75)
T cd05763          42 FFIVDVKIEDTGVYSCTAQNTAGS-ISANATLTV   74 (75)
T ss_pred             EEEeeCCcccCEEEEEEEEcCCCE-EEeeEEEEE
Confidence            788888889999999999998886 677787776


No 61 
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily. Ig_2: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=99.56  E-value=7.2e-14  Score=75.18  Aligned_cols=74  Identities=27%  Similarity=0.488  Sum_probs=52.0

Q ss_pred             CCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEecccc
Q psy15390         26 EFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYG  105 (142)
Q Consensus        26 g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~  105 (142)
                      |+.+.|.|.+.+.|.|.+.|++.++..+....  +.....                                       .
T Consensus         1 G~~~~l~C~~~g~P~p~v~W~~~~~~~~~~~~--~~~~~~---------------------------------------~   39 (74)
T cd05764           1 GQRATLRCKARGDPEPAIHWISPDGKLISNSS--RTLVYD---------------------------------------N   39 (74)
T ss_pred             CCeEEEEEEccCcCCCEEEEEeCCCEEecCCC--eEEEec---------------------------------------C
Confidence            78899999999999999999974555443211  111111                                       2


Q ss_pred             ceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        106 EQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       106 ~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      +.|.|..+..+|+|.|+|.|.|..|. .+..+.|.|
T Consensus        40 ~~L~i~~~~~~D~G~Y~C~a~N~~G~-~~~~~~l~v   74 (74)
T cd05764          40 GTLDILITTVKDTGSFTCIASNAAGE-ATATVELHI   74 (74)
T ss_pred             CEEEEEECChhhCEEEEEEEECCCCe-EEEEEEEEC
Confidence            34677777888888888888888886 567776665


No 62 
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig1_IL1R_like: domain similar to the first immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta.
Probab=99.55  E-value=8.6e-14  Score=78.17  Aligned_cols=83  Identities=16%  Similarity=0.273  Sum_probs=57.3

Q ss_pred             ceeEEecCCcEEEEEEEec-----CCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCcc
Q psy15390         19 SSVAVREEFNITLTCKAEG-----FPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLK   93 (142)
Q Consensus        19 ~~~~~~~g~~v~l~C~~~~-----~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~   93 (142)
                      ....+.+|+.+.|.|.+.+     .|.+.+.||+ ++..+......      +...                        
T Consensus         7 ~~~~v~~G~~~~L~C~~~g~~~~~~p~~~v~Wyk-~~~~~~~~~~~------~~r~------------------------   55 (94)
T cd05756           7 KKSYVLEGEPVVIKCPLFYSYIAQSPGLNLTWYK-SDGKTPIPTEE------RSRM------------------------   55 (94)
T ss_pred             eEEEEecCCCeEEECCCCCcccccCCCceEEEEE-cCCCCcccccc------ccee------------------------
Confidence            4556789999999999988     5788999999 66543211000      0000                        


Q ss_pred             EEEEEEEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390         94 IFWEIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus        94 ~~w~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                              ....+.|.|..+..+|+|.|+|.+.|..|. .+..+.|.|
T Consensus        56 --------~~~~~~L~I~~~~~~DsG~Y~C~~~N~~g~-~~~~~~L~v   94 (94)
T cd05756          56 --------HQQKDLLWFLPAALEDSGLYTCVVRNSTYC-MKVSISLTV   94 (94)
T ss_pred             --------eecCCeEEEccCCcccCeEEEEEEcCCCcc-EEEEEEEEC
Confidence                    001235788888889999999999988876 677777765


No 63 
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig6_Contactin-2: Sixth Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=99.54  E-value=2e-13  Score=75.36  Aligned_cols=80  Identities=26%  Similarity=0.397  Sum_probs=54.6

Q ss_pred             CcEEEEEEEecCCCC--eeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEeccc
Q psy15390         27 FNITLTCKAEGFPAP--EIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHY  104 (142)
Q Consensus        27 ~~v~l~C~~~~~~~~--~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~  104 (142)
                      ++++|.|.+.+.|.+  .+.|++ +++.+.....       +....+..+                           ...
T Consensus         1 ~~~~L~C~a~g~P~p~~~v~W~~-~g~~i~~~~~-------~~~~~~~~~---------------------------~~~   45 (85)
T cd05854           1 ENLTLQCHASHDPTMDLTFTWSL-DDFPIDLDKP-------NGHYRRMEV---------------------------KET   45 (85)
T ss_pred             CcEEEEEEEecCCCCCeEEEEEE-CCeEccccCC-------CCcEEEEEe---------------------------cce
Confidence            478999999999887  579999 8876643210       000000000                           011


Q ss_pred             cceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEEC
Q psy15390        105 GEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDVE  142 (142)
Q Consensus       105 ~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V~  142 (142)
                      .+.|.|.+++..|+|.|+|.|.|..|. .+..+.|.|+
T Consensus        46 ~~~L~I~~v~~~D~G~YtC~A~n~~g~-~~~~~~L~V~   82 (85)
T cd05854          46 IGDLVIVNAQLSHAGTYTCTAQTVVDS-ASASATLVVR   82 (85)
T ss_pred             EeEEEEccCChhhCeEEEEEEecCCCC-EEEEEEEEEE
Confidence            235888999999999999999999886 6777777763


No 64 
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4. Ig2_PTK7: domain similar to the second immunoglobulin (Ig)-like domain in protein tyrosine kinase (PTK) 7, also known as CCK4. PTK7 is a subfamily of the receptor protein tyrosine kinase family, and is referred to as an RPTK-like molecule. RPTKs transduce extracellular signals across the cell membrane, and play important roles in regulating cell proliferation, migration, and differentiation. PTK7 is organized as an extracellular portion having seven Ig-like domains, a single transmembrane region, and a cytoplasmic tyrosine kinase-like domain. PTK7 is considered a pseudokinase as it has several unusual residues in some of the highly conserved tyrosine kinase (TK) motifs; it is predicted to lack TK activity. PTK7 may function as a cell-adhesion molecule. PTK7 mRNA is expressed at high levels in placenta, melanocytes, liver, lung, pancreas, and kidney. PTK7 is overexpressed in s
Probab=99.54  E-value=7e-14  Score=75.82  Aligned_cols=73  Identities=26%  Similarity=0.519  Sum_probs=47.1

Q ss_pred             EEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEeccccceE
Q psy15390         29 ITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYGEQL  108 (142)
Q Consensus        29 v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~~~l  108 (142)
                      ++|.|.+.+.|.|.+.|++ +|..+............                                       .+.|
T Consensus         1 v~L~C~~~g~P~p~v~W~k-~g~~l~~~~~~~~~~~~---------------------------------------~~~L   40 (77)
T cd05760           1 VTLRCHIDGHPRPTYQWFR-DGTPLSDGQGNYSVSSK---------------------------------------ERTL   40 (77)
T ss_pred             CEEEEEeeecCCCcEEEEE-CCEECCCCCccEEEeCC---------------------------------------CCEE
Confidence            5799999999999999999 77765432111100011                                       2246


Q ss_pred             EEccCCCCCCeEEEEEEecCCCCC-eeeEEEEEE
Q psy15390        109 NITKISRTEMGAYLCIATNNVPPS-VSKRITVDV  141 (142)
Q Consensus       109 ~i~~~~~~d~g~y~C~a~n~~~~~-~s~~~~l~V  141 (142)
                      .|.++..+|+|.|+|.|.|..|.. .+..+.|.|
T Consensus        41 ~I~~~~~~D~G~Y~C~a~N~~G~~~s~~~~~l~v   74 (77)
T cd05760          41 TLRSAGPDDSGLYYCCAHNAFGSVCSSQNFTLSI   74 (77)
T ss_pred             EEeeCCcccCEEEEEEEEeCCCeEeeCceEEEEE
Confidence            777777778888888888877752 234555544


No 65 
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig4_Robo: domain similar to the fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagoni
Probab=99.54  E-value=1.5e-13  Score=76.72  Aligned_cols=82  Identities=22%  Similarity=0.496  Sum_probs=53.6

Q ss_pred             CCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEecccc
Q psy15390         26 EFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYG  105 (142)
Q Consensus        26 g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~  105 (142)
                      |+.+.|.|.+.+.|.|.+.|++ ++..+...       ...        .....+.|                  .....
T Consensus         1 G~~v~L~C~~~g~P~p~v~W~k-~g~~~~~~-------~~~--------~~~~~~r~------------------~v~~~   46 (90)
T cd05726           1 GRTVTFQCEATGNPQPAIFWQK-EGSQNLLF-------SYQ--------PPQSSSRF------------------SVSQT   46 (90)
T ss_pred             CCEEEEEEECCccCCCEEEEEe-CCCcceee-------ccc--------CCCCCCeE------------------EECCC
Confidence            7889999999999999999999 55422100       000        00000000                  11113


Q ss_pred             ceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEEC
Q psy15390        106 EQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDVE  142 (142)
Q Consensus       106 ~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V~  142 (142)
                      +.|.|.+++.+|+|.|+|.|.|..|. .+..+.|.|+
T Consensus        47 ~~L~I~~v~~~D~G~Y~C~a~N~~G~-~~~~~~l~V~   82 (90)
T cd05726          47 GDLTITNVQRSDVGYYICQTLNVAGS-ILTKAYLEVT   82 (90)
T ss_pred             CeEEEeeCChhhCEEEEEEEEcCCCc-eEEEEEEEEe
Confidence            35888888889999999999998886 6677777764


No 66 
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig1_FcgammaR_like: domain similar to the first immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=99.53  E-value=9.3e-14  Score=75.36  Aligned_cols=61  Identities=18%  Similarity=0.395  Sum_probs=46.0

Q ss_pred             CCceeEEecCCcEEEEEEEecCCCC-eeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEe
Q psy15390         17 TPSSVAVREEFNITLTCKAEGFPAP-EIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATK   88 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~~~~~-~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~   88 (142)
                      .|+...+.+|++++|.|.+.+.|.+ .+.|++ ++..+.         ..++.|.|.++ .+|+|.|+|.+.+
T Consensus         6 ~P~~~~v~~G~~V~L~C~~~~~p~~~~~~W~k-ng~~l~---------~~~~~l~i~~~-~~dsG~Y~C~a~~   67 (78)
T cd05752           6 DPPWTTIFQGEKVTLTCNGFNSPEQNSTQWYH-NGKLLE---------TTTNSYRIRAA-NNDSGEYRCQTQG   67 (78)
T ss_pred             CCCCeEeeCCCCEEEEEeCCCCCCCccEEEEE-CCEEee---------ccCCeEEEeec-ccCCEEeEEECCC
Confidence            6777889999999999999887754 699999 887652         12445777777 7777777777654


No 67 
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM_like: domain similar to the third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM and human neurofascin.
Probab=99.52  E-value=8.4e-14  Score=74.29  Aligned_cols=71  Identities=32%  Similarity=0.676  Sum_probs=51.5

Q ss_pred             EEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEeccccceE
Q psy15390         29 ITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYGEQL  108 (142)
Q Consensus        29 v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~~~l  108 (142)
                      +.|.|.+.+.|.|.+.|++ ++..+.... ..  .                                      ......|
T Consensus         1 v~l~C~~~g~P~p~v~W~k-~~~~~~~~~-~~--~--------------------------------------~~~~~~L   38 (71)
T cd05731           1 LLLECIAEGLPTPEISWIK-IGGELPADR-TK--F--------------------------------------ENFNKTL   38 (71)
T ss_pred             CEEEEEeeEecCCeEEEEE-CCeECCCCc-ee--E--------------------------------------ecCCCEE
Confidence            4789999999999999999 554432110 00  0                                      0012358


Q ss_pred             EEccCCCCCCeEEEEEEecCCCCCeeeEEEEEEC
Q psy15390        109 NITKISRTEMGAYLCIATNNVPPSVSKRITVDVE  142 (142)
Q Consensus       109 ~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V~  142 (142)
                      .|.+++.+|+|.|+|.|.|..|. .+..+.|.|+
T Consensus        39 ~i~~v~~~D~G~Y~C~a~N~~G~-~~~~~~l~V~   71 (71)
T cd05731          39 KIDNVSEEDDGEYRCTASNSLGS-ARHTISVTVE   71 (71)
T ss_pred             EECCCCHHHCEEEEEEEEeCCce-EEEEEEEEEC
Confidence            88889999999999999999886 6778888875


No 68 
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins. Ig2_Follistatin_like: domain similar to the second immunoglobulin (Ig)-like domain found in a follistatin-like molecule encoded by the CNS-related Mahya gene. Mahya genes have been retained in certain Bilaterian branches during evolution.  They are conserved in Hymenoptera and Deuterostomes, but are absent from other metazoan species such as fruit fly and nematode. Mahya proteins are secretory, with a follistatin-like domain (Kazal-type serine/threonine protease inhibitor domain and EF-hand calcium-binding domain), two Ig-like domains, and a novel C-terminal domain. Mahya may be involved in learning and memory and in processing of sensory information in Hymenoptera and vertebrates. Follistatin is a secreted, multidomain protein that binds activins with high affinity and antagonizes their signaling.
Probab=99.52  E-value=2.8e-13  Score=73.24  Aligned_cols=74  Identities=30%  Similarity=0.570  Sum_probs=52.2

Q ss_pred             EEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEeccccceE
Q psy15390         29 ITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYGEQL  108 (142)
Q Consensus        29 v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~~~l  108 (142)
                      +.|.|.+.+.|.+.+.|++ +++.+......++...                                      .....|
T Consensus         1 ~~L~C~v~g~P~p~v~W~k-~~~~l~~~~~~~~~~~--------------------------------------~~~~~l   41 (76)
T cd05736           1 ASLRCHAEGIPLPRLTWLK-NGMDITPKLSKQLTLI--------------------------------------ANGSEL   41 (76)
T ss_pred             CEeEeEeeecCCCEEEEEE-CCEECCCCCCccEEEe--------------------------------------CCCCEE
Confidence            3689999999999999999 7766543221111111                                      112347


Q ss_pred             EEccCCCCCCeEEEEEEecCCCCCeeeEEEEEEC
Q psy15390        109 NITKISRTEMGAYLCIATNNVPPSVSKRITVDVE  142 (142)
Q Consensus       109 ~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V~  142 (142)
                      .|.++..+|.|.|+|.|.|..|. ....+.|.|+
T Consensus        42 ~I~~~~~~D~G~Y~C~a~N~~G~-~~~~~~l~V~   74 (76)
T cd05736          42 HISNVRYEDTGAYTCIAKNEAGV-DEDISSLFVE   74 (76)
T ss_pred             EECcCCcccCEEEEEEEEcCCCC-cceEEEEEEE
Confidence            88888888999999999998886 5777777774


No 69 
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2). Ig3_FGFR-2-like; domain similar to the third immunoglobulin (Ig)-like domain of human fibroblast growth factor receptor 2 (FGFR2). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for FGFs. FGFR2 is required for male sex determination.
Probab=99.52  E-value=3e-13  Score=75.52  Aligned_cols=86  Identities=17%  Similarity=0.269  Sum_probs=55.1

Q ss_pred             CCcEEEEEEEecCCCCeeEEEecC---CcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEec
Q psy15390         26 EFNITLTCKAEGFPAPEIKWRRED---NQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHM  102 (142)
Q Consensus        26 g~~v~l~C~~~~~~~~~~~w~~~~---~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~  102 (142)
                      |+++.|.|.+.+.|.|.+.|++..   +..+..............     .+...                        .
T Consensus         1 G~~v~L~C~~~g~P~P~i~W~k~~~~~g~~~~~~~~~~~~~~~~~-----~~~~~------------------------~   51 (90)
T cd05858           1 GSTVEFVCKVYSDAQPHIQWLKHVEKNGSKYGPDGLPYVTVLKTA-----GVNTT------------------------D   51 (90)
T ss_pred             CCeEEEEEEEecCCCCEEEEEEecccCCcEeCCCCCeeEEEeccC-----Cceec------------------------C
Confidence            788999999999999999999821   222211110000000000     00000                        0


Q ss_pred             cccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        103 HYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       103 ~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      .....|.|.+++.+|+|.|+|.|.|..|. .+..+.|.|
T Consensus        52 ~~~~~L~I~~v~~~D~G~Y~C~A~N~~G~-~~~~a~L~V   89 (90)
T cd05858          52 KEMEVLYLRNVTFEDAGEYTCLAGNSIGI-SHHSAWLTV   89 (90)
T ss_pred             CceeEEEEccCCHHHCEEEEEEEEeCCCc-ccceEEEEE
Confidence            11236999999999999999999999996 677777776


No 70 
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB. TrkB_d5: the fifth domain of Trk receptor TrkB, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors, which mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. The Trks are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkB shares significant sequence homology and domain organization with TrkA, and TrkC. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. In some cell systems NT-3 can activate TrkA and TrkB receptors. TrKB transcripts are found throughout multiple structures of the central and peripheral nervous systems.
Probab=99.52  E-value=2.4e-13  Score=73.64  Aligned_cols=75  Identities=17%  Similarity=0.317  Sum_probs=50.8

Q ss_pred             EEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEeccccceEEE
Q psy15390         31 LTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYGEQLNI  110 (142)
Q Consensus        31 l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~~~l~i  110 (142)
                      |.|.+.|.|.|.++|++ +|+.+.........        +....   ..                      ...+.|.|
T Consensus         3 i~~~v~G~P~Pti~W~k-ng~~l~~~~~~~~~--------~~~~~---~~----------------------~~~~~L~i   48 (79)
T cd05855           3 IPFTVKGNPKPTLQWFH-EGAILNESEYICTK--------IHVIN---NT----------------------EYHGCLQL   48 (79)
T ss_pred             EEEEEeEeCCCceEEEE-CCEECCCCcceeee--------eEeec---cc----------------------ceEEEEEE
Confidence            68999999999999999 89887543211100        00000   00                      01235889


Q ss_pred             ccCCCCCCeEEEEEEecCCCCCeeeEEEEE
Q psy15390        111 TKISRTEMGAYLCIATNNVPPSVSKRITVD  140 (142)
Q Consensus       111 ~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~  140 (142)
                      .++...|+|.|+|.|.|..|. .+..+.+.
T Consensus        49 ~~~~~~D~G~YtC~A~N~~G~-~~~~~~~~   77 (79)
T cd05855          49 DNPTHLNNGIYTLVAKNEYGE-DEKNVSAH   77 (79)
T ss_pred             CCCCcccCEEEEEEEEcCCcc-cceEEEee
Confidence            999999999999999999996 56665543


No 71 
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. Ig6_L1-CAM_like: domain similar to the sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM).  L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains NrCAM [Ng(neuronglia)CAM-related cell adhesion molecule], which is primarily expressed in the nervous system, and human neurofascin.
Probab=99.52  E-value=1.5e-13  Score=74.46  Aligned_cols=72  Identities=28%  Similarity=0.562  Sum_probs=46.8

Q ss_pred             EEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEeccccceE
Q psy15390         29 ITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYGEQL  108 (142)
Q Consensus        29 v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~~~l  108 (142)
                      +.|.|.+.|.|.|.+.|++ ++..+......++....                                      ..+.|
T Consensus         1 i~l~C~~~G~P~P~v~W~k-~g~~l~~~~~~~~~~~~--------------------------------------~~g~L   41 (77)
T cd05733           1 IVIKCEAKGNPPPTFSWTR-NGTHFDPEKDPRVTMKP--------------------------------------DSGTL   41 (77)
T ss_pred             CEEEeeCcccCCCeEEEEE-CCeECCCCCCCCEEEeC--------------------------------------CCCEE
Confidence            4789999999999999999 88766432211111110                                      12235


Q ss_pred             EEccCC----CCCCeEEEEEEecCCCCCeeeEEEE
Q psy15390        109 NITKIS----RTEMGAYLCIATNNVPPSVSKRITV  139 (142)
Q Consensus       109 ~i~~~~----~~d~g~y~C~a~n~~~~~~s~~~~l  139 (142)
                      .|..+.    .+|+|.|+|.|.|..|...+..+.|
T Consensus        42 ~i~~~~~~~~~~d~G~Y~C~A~N~~G~~~s~~~~l   76 (77)
T cd05733          42 VIDNMNGGRAEDYEGEYQCYASNELGTAISNEIHL   76 (77)
T ss_pred             EEeccCCCCCcCCCEEEEEEEEcCCCcEEccccEE
Confidence            555543    3678899999999888755655544


No 72 
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig3_Robo: domain similar to the third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagoni
Probab=99.52  E-value=1.8e-13  Score=72.61  Aligned_cols=69  Identities=22%  Similarity=0.551  Sum_probs=49.1

Q ss_pred             EEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEeccccceE
Q psy15390         29 ITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYGEQL  108 (142)
Q Consensus        29 v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~~~l  108 (142)
                      ++|.|.+.+.|.|.+.|++ ++..+...   +....                                       ....|
T Consensus         1 v~l~C~~~g~P~p~v~W~k-~~~~~~~~---~~~~~---------------------------------------~~~~L   37 (69)
T cd05725           1 VEFQCEVGGDPVPTVLWRK-EDGELPKG---RAEIL---------------------------------------DDKSL   37 (69)
T ss_pred             CEEEEECccCCCCEEEEEE-CCccCCCC---cEEEe---------------------------------------eCCEE
Confidence            4789999999999999999 55433211   10000                                       12358


Q ss_pred             EEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        109 NITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       109 ~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      .|.+++.+|+|.|+|.|.|..|. .+..+.|.|
T Consensus        38 ~I~~v~~~D~G~Y~C~a~N~~G~-~~~~~~l~V   69 (69)
T cd05725          38 KIRNVTAGDEGSYTCEAENMVGK-IEASASLTV   69 (69)
T ss_pred             EECcCChhHCEEEEEEEEcCCCc-EEEEEEEEC
Confidence            88888888999999999998886 666777665


No 73 
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM). Ig7_DSCAM: the seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion.
Probab=99.51  E-value=2.9e-13  Score=73.72  Aligned_cols=79  Identities=28%  Similarity=0.555  Sum_probs=52.4

Q ss_pred             EEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEeccccceE
Q psy15390         29 ITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYGEQL  108 (142)
Q Consensus        29 v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~~~l  108 (142)
                      ++|.|.+.|.|.|.+.|++.++....... ..  .             ...|.+                  .....+.|
T Consensus         1 v~l~C~~~G~P~P~v~W~~~~~~~~~~~~-~~--~-------------~~~~r~------------------~~~~~~~L   46 (79)
T cd05734           1 VTLNCSAEGYPPPTIVWKHSKGRGHPQHT-HT--C-------------CLAGRI------------------QLLSNGSL   46 (79)
T ss_pred             CEeEeeCeEeCCCEEEEEECCCccccccc-cc--c-------------ccCCCE------------------EEecCCeE
Confidence            57999999999999999994332211000 00  0             000000                  01113468


Q ss_pred             EEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        109 NITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       109 ~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      .|..+..+|+|.|+|.|.|..|...+..+.|+|
T Consensus        47 ~I~~v~~~D~G~Y~C~a~N~~G~~~s~~~~l~~   79 (79)
T cd05734          47 LIKHVLEEDSGYYLCKVSNDVGADASKSMVLTV   79 (79)
T ss_pred             EECcCCcccCEEEEEEEEeCCCCCCceEEEEeC
Confidence            899999999999999999999987788888775


No 74 
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins. Ig5_KIRREL3-like: domain similar to the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=99.51  E-value=4.2e-13  Score=76.08  Aligned_cols=94  Identities=17%  Similarity=0.256  Sum_probs=61.2

Q ss_pred             CCeeeecCCCCceeEEecCCcEEEEEEEecCCCC-eeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEE
Q psy15390          8 PPNILDTESTPSSVAVREEFNITLTCKAEGFPAP-EIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIA   86 (142)
Q Consensus         8 ~p~~~~~~~~~~~~~~~~g~~v~l~C~~~~~~~~-~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~   86 (142)
                      ||.+.    .+....+.+|+.+.|.|.+.+.|.| .+.|++ ++..+......++        .+..... +.|.     
T Consensus         2 pp~i~----~~~~~~~~~G~~v~L~C~~~g~P~P~~v~W~~-~~~~i~~~~~~r~--------~i~~~~~-~~~~-----   62 (98)
T cd05758           2 PPIIT----SEATQYAILGDKGRVECFIFSTPPPDRIVWTW-KENELESGSSGRY--------TVETDPS-PGGV-----   62 (98)
T ss_pred             CCeEc----CCCcEEEeCCCcEEEEEEEcccCCCCEeEEEE-CCEEccCCCCCCE--------EEEEecC-CCce-----
Confidence            56664    3456678899999999999999998 599999 7776643221111        1111000 0000     


Q ss_pred             EecCCccEEEEEEEeccccceEEEccCCCCC-CeEEEEEEecCCCCCeeeEEEE
Q psy15390         87 TKIGPLKIFWEIIFHMHYGEQLNITKISRTE-MGAYLCIATNNVPPSVSKRITV  139 (142)
Q Consensus        87 ~~~~~~~~~w~~~~~~~~~~~l~i~~~~~~d-~g~y~C~a~n~~~~~~s~~~~l  139 (142)
                                        .+.|.|..+..+| .|.|+|.|.|..|. ....+.|
T Consensus        63 ------------------~s~L~I~~v~~~d~~G~Y~C~A~N~~G~-~~~~~~L   97 (98)
T cd05758          63 ------------------LSTLTISNTQESDFQTSYNCTAWNSFGS-GTAIISL   97 (98)
T ss_pred             ------------------EEEEEECCccccccceeEEEEEEcCCCc-ccEEEEe
Confidence                              1258888888855 89999999999986 4555544


No 75 
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). Ig6_NrCAM: sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=99.50  E-value=2.9e-13  Score=73.31  Aligned_cols=25  Identities=32%  Similarity=0.865  Sum_probs=21.6

Q ss_pred             EEEEEEEecCCCCeeEEEecCCccee
Q psy15390         29 ITLTCKAEGFPAPEIKWRREDNQPIS   54 (142)
Q Consensus        29 v~l~C~~~~~~~~~~~w~~~~~~~~~   54 (142)
                      |.|.|.+.|.|.|.+.|++ ++..+.
T Consensus         1 ~~l~C~a~G~P~P~i~W~k-~g~~l~   25 (77)
T cd05874           1 IVIQCEAKGKPPPSFSWTR-NGTHFD   25 (77)
T ss_pred             CEEEeeCcccCCCeEEEEE-CCeECC
Confidence            5789999999999999999 777653


No 76 
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin. Ig6_Contactin_like: Sixth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=99.50  E-value=4.7e-13  Score=73.91  Aligned_cols=80  Identities=24%  Similarity=0.334  Sum_probs=53.8

Q ss_pred             CcEEEEEEEecCCCC--eeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEeccc
Q psy15390         27 FNITLTCKAEGFPAP--EIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHY  104 (142)
Q Consensus        27 ~~v~l~C~~~~~~~~--~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~  104 (142)
                      +++.|.|.+.+.|.+  .+.|++ +|+.+......       ....                           .......
T Consensus         1 e~~~L~C~~~g~P~p~i~~~W~~-~g~~i~~~~~~-------~~~~---------------------------~~~~~~~   45 (85)
T cd04970           1 ESITLQCHASHDPTLDLTFTWSF-NGVPIDFDKDG-------GHYR---------------------------RVGGKDS   45 (85)
T ss_pred             CcEEEEEEEecCCCCCeEEEEEE-CCeEeeccCCC-------ccEE---------------------------EEecccc
Confidence            478999999998877  568999 88766432110       0000                           0001112


Q ss_pred             cceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEEC
Q psy15390        105 GEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDVE  142 (142)
Q Consensus       105 ~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V~  142 (142)
                      .+.|.|.+++..|+|.|+|.|.|..|. .+..+.|.|+
T Consensus        46 ~~~L~I~~v~~~D~G~Y~C~a~n~~g~-~~~~~~l~V~   82 (85)
T cd04970          46 NGDLMIRNAQLKHAGKYTCTAQTVVDS-LSASADLIVR   82 (85)
T ss_pred             cceEEEccCCHHhCeeeEEEEecCCCc-EEEEEEEEEE
Confidence            346888899999999999999998886 6777777763


No 77 
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin. Ig_Semaphorin_C; Immunoglobulin (Ig)-like domain in semaphorins. Semaphorins are transmembrane protein that have important roles in a variety of tissues. Functionally, semaphorins were initially characterized for their importance in the development of the nervous system and in axonal guidance. Later they have been found to be important for the formation and functioning of the cardiovascular, endocrine, gastrointestinal, hepatic, immune, musculoskeletal, renal, reproductive, and respiratory systems. Semaphorins function through binding to their receptors and transmembrane semaphorins also serves as receptors themselves. Although molecular mechanism of semaphorins is poorly understood, the Ig-like domains may involve in ligand binding or dimerization.
Probab=99.50  E-value=7.3e-13  Score=73.76  Aligned_cols=83  Identities=17%  Similarity=0.333  Sum_probs=54.9

Q ss_pred             CCceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCc--ceEEeeccceEEEeecCCCCCeEEEEEEEecCCccE
Q psy15390         17 TPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKR--KKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKI   94 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~--~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~   94 (142)
                      ++..+.+.+|+++.|.|.+.+ |.+.+.|++ ++..+.....  .+...                               
T Consensus         2 ~~~~~~v~~g~~v~L~C~~~~-p~~~i~W~k-~~~~~~~~~~~~~~~~~-------------------------------   48 (89)
T cd04979           2 EEKVVTVVEGNSVFLECSPKS-NLASVVWLF-QGGPLQRKEEPEERLLV-------------------------------   48 (89)
T ss_pred             cceEEEEECCCcEEEEEeCCC-CCceEEEEE-CCcccccccCcCceEEE-------------------------------
Confidence            456678899999999999876 777899999 6654432210  01000                               


Q ss_pred             EEEEEEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390         95 FWEIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus        95 ~w~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                               ....|.|..+..+|+|.|+|.|.+..+...+.++.|.|
T Consensus        49 ---------~~~~L~I~~~~~~D~G~Y~C~a~~~~~~~~~~~~~l~V   86 (89)
T cd04979          49 ---------TEDGLLIRSVSPADAGVYTCQSVEHGFKQTLATYSLNV   86 (89)
T ss_pred             ---------cCCCEEEccCCHHHCEEEEEEEecCccceeEeEEEEEE
Confidence                     01236777777788888888887665555566666665


No 78 
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). Ig2_VEGF-2: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-2 (KDR/Flk-1) is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGF-A also interacts with VEGFR-1, which it binds more strongly than VEGFR-2.  VEGFR-2 and -1 may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells.
Probab=99.49  E-value=1.2e-13  Score=73.29  Aligned_cols=68  Identities=25%  Similarity=0.553  Sum_probs=47.4

Q ss_pred             EEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEeccccceE
Q psy15390         29 ITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYGEQL  108 (142)
Q Consensus        29 v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~~~l  108 (142)
                      +.|.|.+.|.|.|.+.|++ +|+.+....  +  ...                                       ...|
T Consensus         1 ~~~~c~v~G~P~P~v~W~k-~g~~l~~~~--~--~~~---------------------------------------~~~L   36 (70)
T cd05864           1 VKIPVKYYGYPPPEVKWYK-NGQLIVLNH--T--FKR---------------------------------------GVHL   36 (70)
T ss_pred             CEEEeEEEEeCCCEEEEEE-CCEECCCCC--E--Ecc---------------------------------------CCEE
Confidence            4689999999999999999 888764321  1  001                                       2247


Q ss_pred             EEccCCCCCCeEEEEEEecCCCC-CeeeEEEEE
Q psy15390        109 NITKISRTEMGAYLCIATNNVPP-SVSKRITVD  140 (142)
Q Consensus       109 ~i~~~~~~d~g~y~C~a~n~~~~-~~s~~~~l~  140 (142)
                      .|.++..+|+|.|+|.|.|..|. ....++.|.
T Consensus        37 ~I~~v~~~D~G~YtC~a~N~~G~~~~~~t~~l~   69 (70)
T cd05864          37 TIYEVTEKDAGNYTVVLTNPITKEEQRHTFQLV   69 (70)
T ss_pred             EECcCCHHHCEEEEEEEEECCCceeeEEEEEEE
Confidence            77788888888888888888875 234444444


No 79 
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D. Ig_Sema4D_like; Immunoglobulin (Ig)-like domain of Sema4D. Sema4D is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4D has extracellular Sema and Ig domains, a transmembrane domain, and a short cytoplasmic domain. Sema4D plays a part in the development of GABAergic synapses. Sema4D in addition is an immune semaphorin. It is abundant on resting T cells; its expression is weak on resting B cells and antigen presenting cells (APCs), but is upregulated by various stimuli. The receptor used by Sema4D in the immune system is CD72. Sem4D enhances the activation of B cells and DCs through binding CD72, perhaps by reducing CD72s inhibitory signals. The receptor used by Sema4D in the non-lymphatic tissues is plexin-B1. Sem4D is anchored to the cell surface but its extracellular domain can be released from the cell surface by a metalloproteas
Probab=99.48  E-value=3.9e-13  Score=74.11  Aligned_cols=69  Identities=20%  Similarity=0.435  Sum_probs=51.6

Q ss_pred             CCceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEec
Q psy15390         17 TPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      .|+...+..|+++.|.|.+.+ +.+.+.|++ +|..+..+. .+... .++.|.|.+++..|+|.|+|.+.+.
T Consensus         2 ~P~~~~v~~G~~v~L~C~~~~-~~~~i~W~~-ng~~i~~~~-~r~~~-~~~~L~I~nv~~~DsG~Y~C~a~e~   70 (87)
T cd05873           2 DPRQRTFKLGNNAELKCSPKS-NLARVVWKF-DGKVLTPES-AKYLL-YRDGLLIFNASEADAGRYQCLSVEK   70 (87)
T ss_pred             CcceEEEECCCCEEEEEECCC-CCCeEEEEE-CCEECCCCC-ceEEE-ECCcEEEeCCCHHHCEEEEEEEEec
Confidence            567788999999999999754 567899999 888876542 23222 3456788888888888888877654


No 80 
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). Ig6_hNeurofascin_like:  the sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). NF belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and a cytoplasmic domain. NF has many alternatively spliced isoforms having different temporal expression patterns during development. NF participates in axon subcellular targeting and synapse formation, however little is known of the functions of the different isoforms.
Probab=99.48  E-value=5.9e-13  Score=72.12  Aligned_cols=72  Identities=29%  Similarity=0.575  Sum_probs=45.4

Q ss_pred             EEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEeccccceE
Q psy15390         29 ITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYGEQL  108 (142)
Q Consensus        29 v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~~~l  108 (142)
                      +.|.|.+.|.|.|.+.|++ ++..+......++...                                      ...+.|
T Consensus         1 ~~l~C~~~G~P~P~v~W~k-~g~~~~~~~~~~~~~~--------------------------------------~~~~~L   41 (77)
T cd05875           1 IIIECEAKGNPVPTFQWTR-NGKFFNVAKDPRVSMR--------------------------------------RRSGTL   41 (77)
T ss_pred             CEEEEeccccCCCEEEEEE-CCEEccCcCCCcEEEe--------------------------------------CCCceE
Confidence            4789999999999999999 7775532211111110                                      012235


Q ss_pred             EEccCC----CCCCeEEEEEEecCCCCCeeeEEEE
Q psy15390        109 NITKIS----RTEMGAYLCIATNNVPPSVSKRITV  139 (142)
Q Consensus       109 ~i~~~~----~~d~g~y~C~a~n~~~~~~s~~~~l  139 (142)
                      .|..+.    ..|+|.|+|.|.|..|...+..+.|
T Consensus        42 ~i~~~~~~~~~~d~G~Y~C~A~N~~G~~~s~~~~~   76 (77)
T cd05875          42 VIDFSGGGRPEDYEGEYQCFARNNLGTALSNKILL   76 (77)
T ss_pred             EEeccCCCCCCCCCEEEEEEEEeccceEEEEEEEE
Confidence            554432    2368888899988888765665544


No 81 
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). Ig1_Necl-1: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-1, Necl-1 (also known as celll adhesion molecule 3 (CADM3), SynCAM2, IGSF4). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the format
Probab=99.47  E-value=3.6e-12  Score=71.65  Aligned_cols=92  Identities=15%  Similarity=0.296  Sum_probs=55.3

Q ss_pred             CceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEE
Q psy15390         18 PSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWE   97 (142)
Q Consensus        18 ~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~   97 (142)
                      ..+..+.+|+++.|.|.+.+.|.+.+.|++.++..+..+.. +  ...+..+.+...                       
T Consensus         4 ~~~~tv~~G~tv~L~C~v~g~~~~~v~W~k~~~~~~~~~~~-~--~~~~~r~~~~~~-----------------------   57 (95)
T cd05882           4 TQDETVAVGGTVTLKCGVKEHDNSSLQWSNTAQQTLYFGEK-R--ALRDNRIQLVKS-----------------------   57 (95)
T ss_pred             cccEEEecCCcEEEEEEEeCCCCCeEEEeccCccEEEeCCe-E--EEeCCeEEEEeC-----------------------
Confidence            45678899999999999999999999999943332221110 0  000111111000                       


Q ss_pred             EEEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390         98 IIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus        98 ~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                          ......|.|.++..+|+|.|+|.+....  ..+..+.|.|
T Consensus        58 ----~~~~~~L~I~nV~~~D~G~YtC~~~t~~--~~~~~~~~~v   95 (95)
T cd05882          58 ----TPTELIISISNVQLSDEGEYTCSIFTMP--VRTAKATVTV   95 (95)
T ss_pred             ----CCceEEEEECCCCcccCEEEEEEEEeec--cccEEEEEEC
Confidence                0112358888888888888888888743  2345555544


No 82 
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin. Ig4_Peroxidasin: the fourth immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted, and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells, which have undergone programmed cell death, and protection of the organism against non-self.
Probab=99.47  E-value=1.8e-13  Score=72.68  Aligned_cols=68  Identities=26%  Similarity=0.577  Sum_probs=46.0

Q ss_pred             EEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEeccccceE
Q psy15390         29 ITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYGEQL  108 (142)
Q Consensus        29 v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~~~l  108 (142)
                      |.|.|.+.+.|.|.+.|++ ++..+....  +.....                                       .+.|
T Consensus         1 v~L~C~~~g~P~p~i~W~k-~g~~~~~~~--~~~~~~---------------------------------------~~~L   38 (69)
T cd05746           1 VQIPCSAQGDPEPTITWNK-DGVQVTESG--KFHISP---------------------------------------EGYL   38 (69)
T ss_pred             CEeEecceEeCCCEEEEEE-CCEECCCCC--CEEECC---------------------------------------CCEE
Confidence            5789999999999999999 776553221  111111                                       1247


Q ss_pred             EEccCCCCCCeEEEEEEecCCCCCeeeEEEE
Q psy15390        109 NITKISRTEMGAYLCIATNNVPPSVSKRITV  139 (142)
Q Consensus       109 ~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l  139 (142)
                      .|.++..+|+|.|+|.|.|..|. .+..+.|
T Consensus        39 ~I~~~~~~D~G~Y~C~a~N~~G~-~~~~~~L   68 (69)
T cd05746          39 AIRDVGVADQGRYECVARNTIGY-ASVSMVL   68 (69)
T ss_pred             EECcCChhhCEEEEEEEECCCCc-EEEEEEe
Confidence            77777777888888888888776 4555544


No 83 
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). Ig2_VEGFR: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-2 is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A. VEGFR-1 may play an inhibitory part in these processes by binding VEGF and interfering with its interaction with VEGFR-2. VEGFR-1 has a signa
Probab=99.47  E-value=2.2e-13  Score=72.71  Aligned_cols=60  Identities=27%  Similarity=0.594  Sum_probs=43.1

Q ss_pred             EEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEeccccceE
Q psy15390         29 ITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYGEQL  108 (142)
Q Consensus        29 v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~~~l  108 (142)
                      +.|.|.+.|.|.|.+.|++ +|+.+....  +. ...                                       ...|
T Consensus         1 ~~l~c~v~g~P~p~v~W~k-~g~~l~~~~--~~-~~~---------------------------------------~~~L   37 (71)
T cd04976           1 VRLPVKVKAYPPPEIQWYK-NGKLISEKN--RT-KKS---------------------------------------GHSL   37 (71)
T ss_pred             CEEEeEEEEeCCCEEEEEE-CCEECCCCC--EE-EcC---------------------------------------CCEE
Confidence            4689999999999999999 887764331  10 111                                       2347


Q ss_pred             EEccCCCCCCeEEEEEEecCCCC
Q psy15390        109 NITKISRTEMGAYLCIATNNVPP  131 (142)
Q Consensus       109 ~i~~~~~~d~g~y~C~a~n~~~~  131 (142)
                      .|.++..+|+|.|+|.|.|..|.
T Consensus        38 ~I~~v~~~D~G~YtC~a~N~~g~   60 (71)
T cd04976          38 TIKDVTEEDAGNYTVVLTNKQAK   60 (71)
T ss_pred             EECcCCHHHCEEEEEEEEcCCcc
Confidence            77777778888888888887765


No 84 
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig6_Contactin-4: sixth Ig domain of the neural cell adhesion molecule contactin-4. Contactins are neural cell adhesion molecules, and are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. Highest expresson of contactin-4 is in testes, thyroid, small intestine, uterus and brain. Contactin-4 plays a role in the response of neuroblastoma cells to differentiating agents, such as retinoids. The contactin 4 gene is associated with cerebellar degeneration in spinocerebellar ataxia type 16.
Probab=99.47  E-value=7.6e-13  Score=72.68  Aligned_cols=79  Identities=19%  Similarity=0.273  Sum_probs=52.9

Q ss_pred             CcEEEEEEEec--CCCCeeEEEecCCcceecCC-cceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEecc
Q psy15390         27 FNITLTCKAEG--FPAPEIKWRREDNQPISINK-RKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMH  103 (142)
Q Consensus        27 ~~v~l~C~~~~--~~~~~~~w~~~~~~~~~~~~-~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~  103 (142)
                      +++.|.|.+.+  .+.+.+.|++ +|+.+.... ..++....                                   ...
T Consensus         1 ~~~~l~C~v~~d~~l~~~~~W~~-dg~~i~~~~~~~~~~~~~-----------------------------------~~~   44 (85)
T cd05853           1 ESIVLPCQVSHDHSLDIVFTWSF-NGHLIDFQKDGDHFERVG-----------------------------------GQD   44 (85)
T ss_pred             CcEEEEEEeccCCCCCcEEEEEE-CCEECcccCCCccEEEec-----------------------------------cCC
Confidence            47899999977  4466899999 888774211 11111100                                   001


Q ss_pred             ccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEEC
Q psy15390        104 YGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDVE  142 (142)
Q Consensus       104 ~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V~  142 (142)
                      ..+.|.|.+++..|+|+|+|.|.|..+. ++.++.|.|+
T Consensus        45 ~~~~L~I~nv~~~dsG~YtC~a~n~~~~-~~a~a~L~V~   82 (85)
T cd05853          45 SAGDLMIRSIQLKHAGKYVCMVQTSVDK-LSAAADLIVR   82 (85)
T ss_pred             CCCcEEEecCCHHHCEEEEEEEEcccCc-eEEEEEEEEe
Confidence            1345888888888999999999988875 6777777763


No 85 
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1). Ig2_VEGFR-1: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1). VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-1 binds VEGF-A strongly; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-1 may play an inhibitory rolet in the function of VEGFR-2 by binding VEGF-A and interfering with its interaction with VEGFR-2. VEGFR-1 has a signaling role in mediating monocyte chemotaxis and may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells.
Probab=99.46  E-value=2.3e-13  Score=72.53  Aligned_cols=57  Identities=28%  Similarity=0.473  Sum_probs=38.5

Q ss_pred             EEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEe
Q psy15390         29 ITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATK   88 (142)
Q Consensus        29 v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~   88 (142)
                      +.|.|.+.|.|.|.+.|++ ++.++.... .+. ...+.+|.|.+++.+|+|.|+|.+.+
T Consensus         1 ~~l~c~v~g~P~P~v~W~k-dg~~l~~~~-~~~-~~~~~~L~I~~v~~~D~G~YtC~a~~   57 (72)
T cd07702           1 YRLTPKVKAFPAPEVIWLK-DGLPAAEKC-SRY-HVDGYSLVIKDVTEEDAGIYTILLGI   57 (72)
T ss_pred             CeEEeeEEEcCCCeEEEEE-CCEECCCCC-cEE-EeCCCEEEECcCCHHHCEEEEEEEEc
Confidence            3689999999999999999 887765432 121 12334566666666666666666654


No 86 
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily. Ig_3: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=99.46  E-value=1.1e-12  Score=71.70  Aligned_cols=81  Identities=22%  Similarity=0.366  Sum_probs=53.9

Q ss_pred             CCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEecccc
Q psy15390         26 EFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYG  105 (142)
Q Consensus        26 g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~  105 (142)
                      |+.+.|.|.+.+.|.|.+.|++ ++...   .  ........          ..+.                  +.....
T Consensus         1 G~~v~l~C~~~g~P~p~v~W~k-~~~~~---~--~~~~~~~~----------~~~~------------------~~~~~~   46 (81)
T cd05765           1 GETASFHCDVTGRPPPEITWEK-QVHGK---E--NLIMRPNH----------VRGN------------------VVVTNI   46 (81)
T ss_pred             CCcEEEEeeccccCCCcEEEEe-cCCCC---c--ceeecCCc----------ccCC------------------EEEccc
Confidence            7899999999999999999999 42110   0  00000000          0000                  011113


Q ss_pred             ceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        106 EQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       106 ~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      ..|.|.++..+|+|.|+|.|.|..|. .+..+.|.|
T Consensus        47 ~~L~I~~~~~~D~G~Y~C~a~N~~G~-~~~~~~l~v   81 (81)
T cd05765          47 GQLVIYNAQPQDAGLYTCTARNSGGL-LRANFPLSV   81 (81)
T ss_pred             cEEEEccCCcccCEEEEEEEecCCce-EEEEEEEeC
Confidence            46899999999999999999999996 677777765


No 87 
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig2_FcgammaR_like: domain similar to the second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=99.46  E-value=7.4e-13  Score=72.73  Aligned_cols=77  Identities=21%  Similarity=0.306  Sum_probs=54.1

Q ss_pred             CceeEEecCCcEEEEEEEec-CCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEE
Q psy15390         18 PSSVAVREEFNITLTCKAEG-FPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFW   96 (142)
Q Consensus        18 ~~~~~~~~g~~v~l~C~~~~-~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w   96 (142)
                      +....+.+|++++|.|.+.+ .+...+.|++ ++..+..       ...                               
T Consensus         6 ~p~~~V~~G~~vtL~C~~~~~~~~~~~~w~k-~g~~~~~-------~~~-------------------------------   46 (83)
T cd05753           6 VPSRVVFEGEPLVLRCHGWKNKPVYKVTYYR-DGKAKKY-------SHS-------------------------------   46 (83)
T ss_pred             CCcceecCCCCEEEEeeCCCCCcceEEEEEE-CCeEccc-------cCC-------------------------------
Confidence            33446889999999999854 4556799999 6654311       000                               


Q ss_pred             EEEEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390         97 EIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus        97 ~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                              ...|.|.+++.+|+|.|+|.|.+..++..|..+.|+|
T Consensus        47 --------~~~l~I~~~~~~dsG~Y~C~~~~~~~~~~s~~~~i~~   83 (83)
T cd05753          47 --------NSNLSIPQATLSDSGSYHCSGIIGSYDYSSEPVSITV   83 (83)
T ss_pred             --------CceEEECccCHHHCEEEEEEEEeCCceecCCCEEEEC
Confidence                    1247777888888888888888887776677777765


No 88 
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. Ig3_RPTP_IIa_LAR_like: domain similar to the third immunoglobulin (Ig)-like domain found in the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. LAR belongs to the RPTP type IIa subfamily. Members of this subfamily are cell adhesion molecule-like proteins involved in central nervous system (CNS) development. They have large extracellular portions, comprised of multiple IG-like domains and two to nine fibronectin type III (FNIII) domains, and a cytoplasmic portion having two tandem phosphatase domains. Included in this group is Drosophila LAR (DLAR).
Probab=99.45  E-value=8.3e-13  Score=70.02  Aligned_cols=27  Identities=33%  Similarity=0.709  Sum_probs=24.3

Q ss_pred             CCcEEEEEEEecCCCCeeEEEecCCcce
Q psy15390         26 EFNITLTCKAEGFPAPEIKWRREDNQPI   53 (142)
Q Consensus        26 g~~v~l~C~~~~~~~~~~~w~~~~~~~~   53 (142)
                      |++++|.|.+.|.|.|.+.|++ ++..+
T Consensus         1 G~~v~L~C~a~G~P~P~v~W~k-~g~~l   27 (69)
T cd05739           1 GGSVNLTCVAVGAPMPYVKWMK-GGEEL   27 (69)
T ss_pred             CCeEEEEEEeeecCCCEEEEEE-CCEEC
Confidence            6889999999999999999999 77655


No 89 
>cd04967 Ig1_Contactin First Ig domain of contactin. Ig1_Contactin: First Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 weeks postnata
Probab=99.45  E-value=2.4e-12  Score=71.94  Aligned_cols=42  Identities=26%  Similarity=0.631  Sum_probs=30.6

Q ss_pred             CeeeecCCCCceeEEe---cCCcEEEEEEEecCCCCeeEEEecCCccee
Q psy15390          9 PNILDTESTPSSVAVR---EEFNITLTCKAEGFPAPEIKWRREDNQPIS   54 (142)
Q Consensus         9 p~~~~~~~~~~~~~~~---~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~   54 (142)
                      |.|..   .+....+.   .|+.+.|.|.+.+.|.+.+.|++ +++.+.
T Consensus         2 P~f~~---~p~~~~~~~~~~~~~~~l~C~~~g~p~p~i~W~k-~~~~l~   46 (91)
T cd04967           2 PVFEE---QPDDTIFPEESDEGKVSLNCRARGSPPPTYRWLM-NGTEID   46 (91)
T ss_pred             CeeEe---CCCCEEccCCCCCCEEEEEEeeeEcCCCEEEEEE-CCEECC
Confidence            45554   45444433   34679999999999999999999 777663


No 90 
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Ig1_Necl-3: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-3, Necl-3 (also known as cell adhesion molecule 2 (CADM2), SynCAM2, IGSF4D).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses.  Necl-3 accumulates in central and peripheral nervous system tissue, and has been shown to selectively interact with oligodendrocytes.
Probab=99.44  E-value=3e-12  Score=72.08  Aligned_cols=34  Identities=21%  Similarity=0.396  Sum_probs=29.2

Q ss_pred             CCceeEEecCCcEEEEEEEecCCCCeeEEEecCC
Q psy15390         17 TPSSVAVREEFNITLTCKAEGFPAPEIKWRREDN   50 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~   50 (142)
                      ..+++.+.+|+++.|.|.+.+.|.+.+.|+++++
T Consensus         3 ~~~~v~v~eG~~v~L~C~~~~~p~~~v~W~~~~~   36 (95)
T cd07701           3 LTQNVTVVEGGTANLTCRVDQNDNTSLQWSNPAQ   36 (95)
T ss_pred             ccceEEEecCCcEEEEEEEecCCceEEEEeCCCC
Confidence            4567889999999999999999999999997433


No 91 
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d5: the fifth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrkB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor foun
Probab=99.41  E-value=1.8e-12  Score=70.77  Aligned_cols=77  Identities=17%  Similarity=0.296  Sum_probs=51.7

Q ss_pred             EEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEeccccceEEE
Q psy15390         31 LTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYGEQLNI  110 (142)
Q Consensus        31 l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~~~l~i  110 (142)
                      |.|.+.|.|.|.++|++ +|+.+..........        .....                       ......+.|.|
T Consensus         3 i~~~v~G~P~P~v~W~k-~g~~i~~~~~~~~~~--------~~~~~-----------------------~~~~~~~~L~I   50 (81)
T cd04971           3 IPFTVRGNPKPTLTWYH-NGAVLNESDYIRTEI--------HYEVT-----------------------TPTEYHGCLQF   50 (81)
T ss_pred             EEEEeEeeCCCcEEEEE-CCEECcCCCceeEEE--------Eeecc-----------------------cccccEEEEEE
Confidence            68999999999999999 888775432111100        00000                       00111345888


Q ss_pred             ccCCCCCCeEEEEEEecCCCCCeeeEEEEE
Q psy15390        111 TKISRTEMGAYLCIATNNVPPSVSKRITVD  140 (142)
Q Consensus       111 ~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~  140 (142)
                      .+++..|+|.|+|.|.|..|. .+..+.|.
T Consensus        51 ~~~~~~D~G~YtC~A~N~~G~-~~~~~~~~   79 (81)
T cd04971          51 DNPTHVNNGNYTLVASNEYGQ-DSKSISAH   79 (81)
T ss_pred             CCCCcccCeEEEEEEEeCCCC-eeeEEEee
Confidence            999999999999999999986 66666554


No 92 
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins. Ig1_VEGFR_like: first immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) related proteins. The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGF-A interacts with both VEGFR-1 and VEGFR-2. VEGFR-1 binds strongest to VEGF, VEGF-2 binds more weakly. VEGFR-3 appears not to bind VEGF, but binds other members of the VEGF family (VEGF-C and -D). VEGFRs bind VEGFs with high affinity with the IG-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGF
Probab=99.40  E-value=8.8e-12  Score=68.64  Aligned_cols=81  Identities=16%  Similarity=0.287  Sum_probs=53.7

Q ss_pred             CCcEEEEEEEecC--CCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEecc
Q psy15390         26 EFNITLTCKAEGF--PAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMH  103 (142)
Q Consensus        26 g~~v~l~C~~~~~--~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~  103 (142)
                      |+++.|.|.+.+.  |.+.+.|++ +++.+.....    .. ..     ... ....                      .
T Consensus         1 Ge~~~L~C~~~g~~~~~~~i~W~~-~~~~~~~~~~----~~-~~-----~~~-~~~~----------------------~   46 (84)
T cd05742           1 GETLVLNCTVLTELNEGVDFQWTY-PGKKRGRGKS----MV-TR-----QSL-SEAT----------------------E   46 (84)
T ss_pred             CCeEEEEEEEEeCCCccEEEEEec-CCcccCCceE----ee-cc-----ccc-ccce----------------------E
Confidence            7899999999998  778999988 5543321100    00 00     000 0000                      0


Q ss_pred             ccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        104 YGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       104 ~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      ....|.|.+++.+|+|.|+|.|.|..+. .+.+..|.|
T Consensus        47 ~~s~L~I~~v~~~DsG~Y~C~a~n~~~~-~~~s~~v~v   83 (84)
T cd05742          47 LSSTLTIPNATLKDSGTYTCAASSGTMD-QKESTKVNI   83 (84)
T ss_pred             EEEEEEECCCChhhCEEEEEEEccCCCc-eEEEEEEEE
Confidence            1235899999999999999999999886 677777665


No 93 
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). Ig1_PDGFR-alphabeta: The first immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFRalpha binds to all three PDGFs, whereas the PDGFRbeta binds only to PDGF-B. PDGFRs alpha and beta have similar organization: an extracellular component with five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFRalpha and PDGFRbeta are essential for normal development.
Probab=99.40  E-value=2.2e-11  Score=67.06  Aligned_cols=81  Identities=16%  Similarity=0.326  Sum_probs=50.4

Q ss_pred             CCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEecccc
Q psy15390         26 EFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYG  105 (142)
Q Consensus        26 g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~  105 (142)
                      |++++|.|.+.+.|.+.+.|++ .++...... ..   .       .......                       ....
T Consensus         1 Ge~~~l~C~~~~~~~~~~~W~~-~~~~~~~~~-~~---~-------~~~~~~~-----------------------~~~~   45 (84)
T cd05861           1 GETITVNCIVQGNEVVDFSWTY-PGKDIGKGI-PE---V-------EEVKVPA-----------------------TTLR   45 (84)
T ss_pred             CCcEEEEEEEECCCccEEEEEE-CCccCCCCc-eE---E-------EEEecCC-----------------------cEEE
Confidence            7899999999999889999998 443211000 00   0       0000000                       0012


Q ss_pred             ceEEEccCCCCCCeEEEEEEecCCCC-CeeeEEEEEE
Q psy15390        106 EQLNITKISRTEMGAYLCIATNNVPP-SVSKRITVDV  141 (142)
Q Consensus       106 ~~l~i~~~~~~d~g~y~C~a~n~~~~-~~s~~~~l~V  141 (142)
                      ..|.|.+++.+|+|.|+|.|.|..+. ..+.++.|+|
T Consensus        46 s~L~I~~~~~~DsG~Y~C~a~n~~~~~~~~~sv~i~V   82 (84)
T cd05861          46 STLTFPHATVEDSGTYECAAHESTQDQKAFKKVNITV   82 (84)
T ss_pred             EEEEECCCCcCCCEEEEEEEEECccCcceeEEEEEEE
Confidence            35888888888999999998876542 2466777766


No 94 
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins. Ig2_FGFR_like: domain similar to the second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three Ig-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin 
Probab=99.39  E-value=1.8e-11  Score=67.37  Aligned_cols=82  Identities=28%  Similarity=0.486  Sum_probs=54.6

Q ss_pred             eEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEE
Q psy15390         21 VAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIF  100 (142)
Q Consensus        21 ~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~  100 (142)
                      +.+..|+.+.|.|.+.+.|.+.+.|++ ++..+.......  .        ...                          
T Consensus         4 ~~~~~G~~~~l~C~~~~~p~~~v~W~k-~~~~~~~~~~~~--~--------~~~--------------------------   46 (85)
T cd05729           4 HAVPAGSTVRLKCPASGNPRPTITWLK-DGKPFKKEHRIG--G--------YKV--------------------------   46 (85)
T ss_pred             eEecCCCcEEEEEEcCCCCCCeEEEEE-CCEECcccCcee--E--------EEc--------------------------
Confidence            456689999999999998888999999 766543221000  0        000                          


Q ss_pred             eccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        101 HMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       101 ~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                       ......|.|..+..+|+|.|.|.|.|..|. .+.++.|.|
T Consensus        47 -~~~~~~l~i~~~~~~d~g~Y~C~~~n~~g~-~~~~~~l~v   85 (85)
T cd05729          47 -RKKKWTLILESVVPSDSGKYTCIVENKYGS-INHTYKVDV   85 (85)
T ss_pred             -cCcEEEEEEeECCcccCEEEEEEEEECCce-EEEEEEEeC
Confidence             000124777778888888888888888775 566666654


No 95 
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig2_Contactin-2-like: second Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=99.38  E-value=4.2e-12  Score=71.06  Aligned_cols=71  Identities=21%  Similarity=0.475  Sum_probs=48.5

Q ss_pred             CceeEEecCCcEEEEEEE-ecCCCCeeEEEecCCcceec-CCcceEEeeccceEEEeecCCCCCeEEEEEEEec
Q psy15390         18 PSSVAVREEFNITLTCKA-EGFPAPEIKWRREDNQPISI-NKRKKVHMHYGEQLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        18 ~~~~~~~~g~~v~l~C~~-~~~~~~~~~w~~~~~~~~~~-~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      .....+.+|+.+.|.|.. .+.|.+.+.|++ ++..+.. ....++....++.|.|.+|...|+|.|.|.+.|.
T Consensus        10 ~~~~~v~eG~~~~L~C~pP~g~P~p~~~W~k-~~~~~~~~~d~r~~~~~~~G~L~fs~v~~~D~g~Y~C~A~n~   82 (96)
T cd05727          10 RDEVKVKEGWGVVLFCDPPPHYPDLSYRWLL-NEFPNFIPEDGRRFVSQTNGNLYIAKVEASDRGNYSCFVSSP   82 (96)
T ss_pred             cCceeeeeCCcEEEeeCCCCCCCCCEEEEEE-CCcccccccCCCeEEeCCCCcEEEeecCHhhCceeEEEEEec
Confidence            345678899999999965 557888999999 6654321 1122322333567777777777777777777663


No 96 
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins. Ig3_Perlecan_like: domain similar to the third immunoglobulin (Ig)-like domain found in Perlecan. Perlecan is a large multi-domain heparin sulfate proteoglycan, important in tissue development and organogenesis.  Perlecan can be represented as 5 major portions; its fourth major portion (domain IV) is a tandem repeat of immunoglobulin-like domains (Ig2-Ig15), which can vary in size due to alternative splicing. Perlecan binds many cellular and extracellular ligands. Its domain IV region has many binding sites.  Some of these have been mapped at the level of individual Ig-like domains, including a site restricted to the Ig5 domain for heparin/sulfatide, a site restricted to the Ig3 domain for nidogen-1 and nidogen-2, a site restricted to Ig4-5 for fibronectin, and sites restricted to Ig2 and to Ig13-15 for fibulin-2.
Probab=99.37  E-value=4.4e-12  Score=70.01  Aligned_cols=34  Identities=29%  Similarity=0.581  Sum_probs=28.0

Q ss_pred             CCceeEEecCCcEEEEEEEec-CCCCeeEEEecCCc
Q psy15390         17 TPSSVAVREEFNITLTCKAEG-FPAPEIKWRREDNQ   51 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~-~~~~~~~w~~~~~~   51 (142)
                      .+....+.+|++++|.|.+.+ .|.+.+.|++ ++.
T Consensus         7 ~p~~~~v~~G~~v~L~C~~~~~~~~~~i~W~~-~~~   41 (85)
T cd05754           7 EPRSQEVRPGADVSFICRAKSKSPAYTLVWTR-VGG   41 (85)
T ss_pred             CCCceEEcCCCCEEEEEEcCCCCCCcEEEEEE-CCC
Confidence            566778899999999999865 6777899999 554


No 97 
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). Ig5_KIRREL3: the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1). These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development. Neph1 and 2 may mediate axonal guidance and synapse formation in certain areas of the CNS. In the kidney, they participate in the formation of the slit diaphragm.
Probab=99.36  E-value=5.1e-11  Score=67.10  Aligned_cols=93  Identities=18%  Similarity=0.267  Sum_probs=59.9

Q ss_pred             CCeeeecCCCCceeEEecCCcEEEEEEEecCCCC-eeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEE
Q psy15390          8 PPNILDTESTPSSVAVREEFNITLTCKAEGFPAP-EIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIA   86 (142)
Q Consensus         8 ~p~~~~~~~~~~~~~~~~g~~v~l~C~~~~~~~~-~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~   86 (142)
                      ||.+.    ......+.+|+++.|.|.+.+.|.| .+.|.. .+..+......+        +.|..... +.       
T Consensus         2 pP~i~----~~~s~~~~~G~~~~L~C~~~s~P~P~~i~W~w-~~~~i~~~~~~r--------~~I~~~~~-~~-------   60 (98)
T cd05898           2 PPIIS----SEQVQYAVRGERGKVKCFIGSTPPPDRIAWAW-KENVLESGTSER--------YTVERTST-GS-------   60 (98)
T ss_pred             CCEEe----cCceEEEeCCCcEEEEEEEccCCCCcEEEEEE-ccccccCCCCCC--------EEEEEEcc-CC-------
Confidence            67763    4667788899999999999777766 578987 555443221111        22221110 11       


Q ss_pred             EecCCccEEEEEEEeccccceEEEccCCCCC-CeEEEEEEecCCCCCeeeEEE
Q psy15390         87 TKIGPLKIFWEIIFHMHYGEQLNITKISRTE-MGAYLCIATNNVPPSVSKRIT  138 (142)
Q Consensus        87 ~~~~~~~~~w~~~~~~~~~~~l~i~~~~~~d-~g~y~C~a~n~~~~~~s~~~~  138 (142)
                                      ...+.|.|.++...| .|.|.|.|.|.+|. ....++
T Consensus        61 ----------------g~~S~L~I~~~~~~d~~g~Y~C~a~N~~G~-d~~~i~   96 (98)
T cd05898          61 ----------------GVLSTLTINNIMEADFQTHYNCTAWNSFGS-GTAIIQ   96 (98)
T ss_pred             ----------------CcEEEEEECCCccccCCcEEEEEEEeCCcc-ceEEEE
Confidence                            113468888887767 78999999999987 344443


No 98 
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. Ig2_L1-CAM_like: domain similar to the second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=99.34  E-value=8.7e-12  Score=69.65  Aligned_cols=71  Identities=21%  Similarity=0.346  Sum_probs=53.3

Q ss_pred             CCceeEEecCCcEEEEEE-EecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCe-EEEEEEEec
Q psy15390         17 TPSSVAVREEFNITLTCK-AEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMG-AYLCIATKI   89 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~-~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G-~y~C~~~~~   89 (142)
                      ..+.+.+.+|+.+.|.|. ..+.|.+.+.|+..+...+.  ...|+....++.|.|.+|...|.| .|.|.+.+.
T Consensus         9 ~~~~v~V~eG~~~~L~C~pP~g~P~P~i~W~~~~~~~i~--~~~Ri~~~~~GnL~fs~v~~~D~g~~Y~C~a~~~   81 (95)
T cd05845           9 KIRPVEVEEGDSVVLPCNPPKSAVPLRIYWMNSDLLHIT--QDERVSMGQNGNLYFANVEEQDSHPDYICHAHFP   81 (95)
T ss_pred             ccceeEEecCCCEEEEecCCCCCCCCEEEEECCCCcccc--ccccEEECCCceEEEEEEehhhCCCCeEEEEEcc
Confidence            456788999999999997 68899999999983323232  234445555678888888888888 788888764


No 99 
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively). Ig1_Necl-1-3_like:  N-terminal immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), and Necl-3 (CADM2). At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1, Necl-2, and Necl-3 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the form
Probab=99.33  E-value=3.2e-11  Score=67.93  Aligned_cols=93  Identities=18%  Similarity=0.290  Sum_probs=54.7

Q ss_pred             CCceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEE
Q psy15390         17 TPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFW   96 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w   96 (142)
                      ..+.+.+.+|++++|.|.+.+.+.+.+.|+++++..+.....                .....+.|.-.           
T Consensus         3 ~~~~~~v~~G~~v~L~C~~~~~~~~~v~W~~p~~~~~~~~~~----------------~~~~~~r~~~~-----------   55 (95)
T cd05717           3 VTQDVTVVEGGTATLKCRVKNNDNSSLQWSNPNQQTLYFNDK----------------RALRDNRIQLV-----------   55 (95)
T ss_pred             cCCcEEEcCCCCEEEEEEECCCCCceEEEeCCCCcEEEeccc----------------cccccCcEEEE-----------
Confidence            355678899999999999988888899999744332211000                00000111000           


Q ss_pred             EEEEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390         97 EIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus        97 ~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                         ........|.|.+++.+|+|.|+|.+.+....  +..+.|.|
T Consensus        56 ---~~~~~~~~L~I~~v~~~DsG~Y~C~~~~~~~~--~~~~~~~v   95 (95)
T cd05717          56 ---NFSANELSISISNVSLSDEGRYTCSLYTMPVQ--TAKATVTV   95 (95)
T ss_pred             ---cCCCCeeEEEEccCCcccCEEEEEEEecCCCc--eEEEEEEC
Confidence               00112335888888888888888888876644  33344443


No 100
>PF00047 ig:  Immunoglobulin domain The Prosite family only concerns antibodies and MHCs.;  InterPro: IPR013151 Members of the immunoglobulin superfamily are found in hundreds of proteins of different functions. Examples include antibodies, the giant muscle kinase titin and receptor tyrosine kinases. Immunoglobulin-like domains may be involved in protein-protein and protein-ligand interactions. The Pfam alignments do not include the first and last strand of the immunoglobulin-like domain.; PDB: 1B6U_A 3O4O_C 3VH8_H 1BIH_A 2C9A_A 2V5Y_A 1BQH_K 2ATP_A 3B9K_A 1NEZ_H ....
Probab=99.32  E-value=1.1e-11  Score=64.71  Aligned_cols=60  Identities=22%  Similarity=0.547  Sum_probs=40.6

Q ss_pred             CCcEEEEEEE-ecCCCCeeEEEecCCcceecCCcceEEeeccc---eEEEeecCCCCCeEEEEEE
Q psy15390         26 EFNITLTCKA-EGFPAPEIKWRREDNQPISINKRKKVHMHYGE---QLNITKISRTEMGAYLCIA   86 (142)
Q Consensus        26 g~~v~l~C~~-~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~---~l~i~~v~~~d~G~y~C~~   86 (142)
                      |++++|.|.+ .+.+...+.|++ +++................   .|.|.+++.+|+|.|.|.+
T Consensus         1 G~~v~L~C~~~~~~~~~~~~W~~-~~~~~~~~~~~~~~~~~~~~~~~L~i~~v~~~d~G~Y~C~v   64 (64)
T PF00047_consen    1 GSSVTLTCSVSSGPPPTTVTWSK-NGQSLPEGSTTNRSTNSVSSTSRLTISNVTPEDSGTYTCVV   64 (64)
T ss_dssp             TSEEEEEEEEEESSSTSEEEEEE-TTTTTSEEEEEEEEETTTEEEEEEEESSCTGGGTEEEEEEE
T ss_pred             CCeEEEEeecCCCCCCcEEEEEE-CCccccCcceeEeecccceeeeEEEEccCCHHHCEEEEEEC
Confidence            7899999999 667777999999 6555433222121111111   2888888888888888875


No 101
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs). Ig_Pro_neuregulin: immunoglobulin (Ig)-like domain in neuregulins (NRGs). NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. There are four members of the neuregulin gene family (NRG1, -2, -3, and -4). The NRG-1 protein, binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. The other NRGs proteins bind one or the other or both of these ErbBs. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates processes such as target cell differentiation, and Schwann cell surv
Probab=99.32  E-value=9.8e-12  Score=66.91  Aligned_cols=72  Identities=21%  Similarity=0.496  Sum_probs=46.4

Q ss_pred             EEEEEEEec-CCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEeccccce
Q psy15390         29 ITLTCKAEG-FPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYGEQ  107 (142)
Q Consensus        29 v~l~C~~~~-~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~~~  107 (142)
                      +.|.|.+.+ .|.+.+.|++ ++..+........       +.+.                            .......
T Consensus         1 ~~l~C~~~g~~P~p~~~W~k-~g~~l~~~~~~~~-------~~~~----------------------------~~~~~~~   44 (75)
T cd05750           1 LVLKCEATSEYPSLRFKWFK-DGKELNRKNKPRN-------IKIR----------------------------NKKKNSE   44 (75)
T ss_pred             CEEEEEccCCCCCceEEEEc-CCeeccccCCcce-------EEEE----------------------------ecCceEE
Confidence            468999999 8999999999 7776643221110       0010                            0001234


Q ss_pred             EEEccCCCCCCeEEEEEEecCCCCCeeeEE
Q psy15390        108 LNITKISRTEMGAYLCIATNNVPPSVSKRI  137 (142)
Q Consensus       108 l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~  137 (142)
                      |.|..+..+|+|.|+|.|.|..|. .+..+
T Consensus        45 L~I~~~~~~D~G~Y~C~a~N~~G~-~~~~~   73 (75)
T cd05750          45 LQINKAKLADSGEYTCVVENILGN-DTVTA   73 (75)
T ss_pred             EEEccCCcccCeEEEEEEEEcCCc-eeEEE
Confidence            778888888888888888888876 34433


No 102
>smart00408 IGc2 Immunoglobulin C-2 Type.
Probab=99.31  E-value=2.5e-11  Score=62.56  Aligned_cols=60  Identities=37%  Similarity=0.741  Sum_probs=41.7

Q ss_pred             cCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEe
Q psy15390         25 EEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATK   88 (142)
Q Consensus        25 ~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~   88 (142)
                      +|++++|.|.+.+.+.+.+.|++ ++..+. . ... .......|.|.++...|+|.|.|.+.+
T Consensus         1 ~g~~~~l~C~~~~~~~~~v~W~~-~~~~~~-~-~~~-~~~~~~~L~i~~~~~~d~G~Y~C~~~n   60 (63)
T smart00408        1 EGQSVTLTCPAEGDPVPNITWLK-DGKPLP-E-SNR-LSASGSTLTIKSVSLEDSGEYTCVAEN   60 (63)
T ss_pred             CCceEEEEeeCccCCCCeEEEEE-CCEECC-C-CCE-EecCCcEEEEeeCCcccCEEEEEEEec
Confidence            48899999998888888999999 666554 1 111 123344677777777777777777654


No 103
>PF13895 Ig_2:  Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A ....
Probab=99.30  E-value=3.8e-11  Score=65.15  Aligned_cols=32  Identities=38%  Similarity=0.848  Sum_probs=27.4

Q ss_pred             eEEecCCcEEEEEEEecCCCCeeEEEecCCcce
Q psy15390         21 VAVREEFNITLTCKAEGFPAPEIKWRREDNQPI   53 (142)
Q Consensus        21 ~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~   53 (142)
                      ..+.+|+++.|.|.+.+.|...+.|++ ++..+
T Consensus         9 ~~v~~g~~~~l~C~~~~~p~~~~~w~~-~~~~~   40 (80)
T PF13895_consen    9 QSVEEGDSVTLTCSVSGNPPPQVQWYK-NGSPI   40 (80)
T ss_dssp             SEEETTSEEEEEEEEESSSSSEEEEEE-TTEEE
T ss_pred             eEEeCCCcEEEEEEEEcccceeeeeee-eeeee
Confidence            568899999999999988888999999 66554


No 104
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig2_IL1R_like: domain similar to the second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R).  IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three IG-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta. This group also contains ILIR-like 1 (IL1
Probab=99.29  E-value=1.6e-11  Score=68.60  Aligned_cols=63  Identities=17%  Similarity=0.400  Sum_probs=37.8

Q ss_pred             eEEecCCcEEEEEEEec-----CCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEE
Q psy15390         21 VAVREEFNITLTCKAEG-----FPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIAT   87 (142)
Q Consensus        21 ~~~~~g~~v~l~C~~~~-----~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~   87 (142)
                      ..+.+|+++.|.|...+     .|.+.+.|++ +++++..... +  ...++.|.|.++..+|+|.|+|.+.
T Consensus         5 ~~~~~g~~~~l~Cp~~~~~~~~~~~p~i~Wyk-~~~~i~~~~~-~--~~~~~~L~I~~v~~~DsG~YtC~~~   72 (92)
T cd05757           5 QILFSTKGGKIVCPDLDDFKNENTLPPVQWYK-DCKLLEGDRK-R--FVKGSKLLIQNVTEEDAGNYTCKLT   72 (92)
T ss_pred             EEEeeccCCEEECCChHHccCCCCCCcEEEeE-CCEECCCCcc-E--EecCCEEEEeeCChhhCEEEEEEEE
Confidence            35778999999998644     2467899999 8887654321 1  1133344444444444444444443


No 105
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. Ig1_CD4; first immunoglobulin (Ig) domain of CD4.  CD4 and CD8 are the two primary co-receptor proteins found on the surface of T cells, and the presence of either CD4 or CD8 determines the function of the T cell.  CD4 is found on helper T cells, where it is required for the binding of MHC (major histocompatibility complex) class II molecules, while CD8 is found on cytotoxic T cells, where it is required for the binding of MHC class I molecules.  CD4 contains four immunoglobulin domains, with the first three included in this hierarchy.  The fourth domain has a general Ig architecture, but has slight topological changes in the arrangement of beta strands relative to the other structures in this family and is not specifically included in the hierarchy.
Probab=99.29  E-value=3e-11  Score=67.62  Aligned_cols=89  Identities=13%  Similarity=0.149  Sum_probs=50.3

Q ss_pred             eEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEE
Q psy15390         21 VAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIF  100 (142)
Q Consensus        21 ~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~  100 (142)
                      +.+.+|++|+|+|.+.+.+.+.+.|++ +++....+...++        .+.....           ..+....  ....
T Consensus         2 v~~~~G~~VtL~C~~s~~~~~~i~W~~-~~~k~~~g~~~~l--------~~~~~~~-----------~~~r~~~--~~~~   59 (94)
T cd07690           2 VLGKKGDTAELPCTASQKKSIQFHWKN-SNQIKILGNQGSF--------LTKGPSK-----------LNDRADS--RRNL   59 (94)
T ss_pred             eEeeCCCCEEEEEEeCCCCCcEEEEEE-CCcEEccCcCCEE--------EEecccc-----------cCCCCce--eccc
Confidence            357789999999999988888999997 4432222211221        1100000           0000000  0000


Q ss_pred             eccccceEEEccCCCCCCeEEEEEEecCCCC
Q psy15390        101 HMHYGEQLNITKISRTEMGAYLCIATNNVPP  131 (142)
Q Consensus       101 ~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~  131 (142)
                      .......|.|.++..+|+|+|.|.+.|..+.
T Consensus        60 ~~~g~~~L~I~~l~~sDsgtY~C~v~~~~~~   90 (94)
T cd07690          60 WDQGSFPLIIKNLKIEDSDTYICEVEDKKEE   90 (94)
T ss_pred             CCCCeEEEEECCCCHHHCEEEEEEECCccce
Confidence            0112335888888888888888888887653


No 106
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Ig1_Necl-2: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-2, Necl-2 (also known as cell adhesion molecule 1 (CADM1), SynCAM1, IGSF4A, Tslc1, sgIGSF, and RA175).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-2 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-2 is expressed in a wide variety of tissues, and is a 
Probab=99.28  E-value=1.1e-10  Score=65.43  Aligned_cols=73  Identities=16%  Similarity=0.288  Sum_probs=44.9

Q ss_pred             CceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecC-----CcceEEeec--c--ceEEEeecCCCCCeEEEEEEEe
Q psy15390         18 PSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISIN-----KRKKVHMHY--G--EQLNITKISRTEMGAYLCIATK   88 (142)
Q Consensus        18 ~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~-----~~~~~~~~~--~--~~l~i~~v~~~d~G~y~C~~~~   88 (142)
                      .+++.+.+|+++.|.|.+.+.....+.|++.+...+...     ...|+....  +  .+|.|.+++.+|+|.|.|++..
T Consensus         4 ~~nvtv~~G~ta~L~C~v~~~~~~~v~w~~~~~~~i~~~~~~~~~d~Rf~~~~~~~~~~tL~I~~vq~~D~G~Y~Cqv~t   83 (95)
T cd05881           4 TEDVTVVEGEVAIISCRVKNNDDSVIQLLNPNRQTIYFRDVRPLKDSRFQLVNFSSNELRVSLSNVSLSDEGRYFCQLYT   83 (95)
T ss_pred             cCceEEcCCCcEEEEEEEccCCccEEEEEecCCcEEEecCccccCCcCEEEEeCCCCEEEEEECcCCcccCEEEEEEEEc
Confidence            456789999999999999988777789998543332110     111111111  1  1466666666666666666654


Q ss_pred             cC
Q psy15390         89 IG   90 (142)
Q Consensus        89 ~~   90 (142)
                      .+
T Consensus        84 ~p   85 (95)
T cd05881          84 DP   85 (95)
T ss_pred             cc
Confidence            43


No 107
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. Ig_Pro_neuregulin-1: immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. There are many NRG-1 isoforms which arise from the alternative splicing of mRNA. NRG-1 belongs to the neuregulin gene family, which is comprised of four genes. This group represents NRG-1. NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, and heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. The NRG-1 protein binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates process
Probab=99.28  E-value=2.6e-11  Score=65.45  Aligned_cols=73  Identities=21%  Similarity=0.497  Sum_probs=44.2

Q ss_pred             EEEEEEEec-CCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEeccccce
Q psy15390         29 ITLTCKAEG-FPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYGEQ  107 (142)
Q Consensus        29 v~l~C~~~~-~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~~~  107 (142)
                      +.|.|.+.+ .|.+.+.|++ +++.+......+      ....+.                            .......
T Consensus         1 ~~L~C~a~~~~p~~~~~W~~-~g~~i~~~~~~~------~~~~~~----------------------------~~~~~~~   45 (76)
T cd05895           1 LVLRCETVSEYPSLRFKWFK-NGKEIGAKNKPD------NKIKIR----------------------------KKKKSSE   45 (76)
T ss_pred             CEEEEecccCCCCCceEEEE-CCcccccCCCCC------ceEEEE----------------------------eCCcEEE
Confidence            468999864 6778999999 777664321110      000000                            0111235


Q ss_pred             EEEccCCCCCCeEEEEEEecCCCCCeeeEE
Q psy15390        108 LNITKISRTEMGAYLCIATNNVPPSVSKRI  137 (142)
Q Consensus       108 l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~  137 (142)
                      |.|.++..+|+|.|+|.|.|..|. .+.++
T Consensus        46 L~I~~~~~~DsG~Y~C~a~N~~g~-~~~~~   74 (76)
T cd05895          46 LQISKASLADNGEYKCMVSSKLGN-DSVTA   74 (76)
T ss_pred             EEECcCCcccCEEEEEEEEeCCCc-eeEEE
Confidence            777788888888888888888775 44443


No 108
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). Ig2_VEGF-2: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-2 (KDR/Flk-1) is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGF-A also interacts with VEGFR-1, which it binds more strongly than VEGFR-2.  VEGFR-2 and -1 may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells.
Probab=99.23  E-value=8e-11  Score=62.47  Aligned_cols=24  Identities=21%  Similarity=0.350  Sum_probs=19.0

Q ss_pred             ceEEEeecCCCCCeEEEEEEEecC
Q psy15390         67 EQLNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        67 ~~l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      ..|.|.++..+|+|.|+|.+.|..
T Consensus        34 ~~L~I~~v~~~D~G~YtC~a~N~~   57 (70)
T cd05864          34 VHLTIYEVTEKDAGNYTVVLTNPI   57 (70)
T ss_pred             CEEEECcCCHHHCEEEEEEEEECC
Confidence            037788899999999999888853


No 109
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin. Ig_Semaphorin_class III; Immunoglobulin (Ig)-like domain of class III semaphorins. Semaphorins are classified into various classes on the basis of structural features additional to the Sema domain. Class III semaphorins are a vertebrate class having a Sema domain, an Ig domain, a short basic domain, and are secreted. They have been shown to be axonal guidance cues and have a part in the regulation of the cardiovascular, immune and respiratory systems. Sema3A, the prototype member of this class III subfamily, induces growth cone collapse and is an inhibitor of axonal sprouting. In perinatal rat cortex as a chemoattractant, it functions to direct, for pyramidal neurons, the orientated extension of apical dendrites. It may play a role, prior to the development of apical dendrites, in signaling the radial migration of newborn cortical neurons towards the upper layers. Sema3A selectively inhibits vascula
Probab=99.22  E-value=1.7e-10  Score=64.41  Aligned_cols=28  Identities=25%  Similarity=0.325  Sum_probs=23.7

Q ss_pred             ceeEEecCCcEEEEEEEecCCCCeeEEEe
Q psy15390         19 SSVAVREEFNITLTCKAEGFPAPEIKWRR   47 (142)
Q Consensus        19 ~~~~~~~g~~v~l~C~~~~~~~~~~~w~~   47 (142)
                      ..+...+|+++.|.|.. +.|.+.+.||+
T Consensus         4 ~~~~~~eG~~v~L~C~~-~~p~p~v~Wyk   31 (91)
T cd05871           4 KVVYGVENNSTFLECLP-KSPQASVKWLF   31 (91)
T ss_pred             eEEEEecCCcEEEEEEC-CCCCceEEEEE
Confidence            35678899999999996 47888999998


No 110
>smart00410 IG_like Immunoglobulin like. IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
Probab=99.19  E-value=1.4e-09  Score=59.21  Aligned_cols=83  Identities=28%  Similarity=0.538  Sum_probs=52.2

Q ss_pred             eeEEecCCcEEEEEEEecCCCCeeEEEecC-CcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEE
Q psy15390         20 SVAVREEFNITLTCKAEGFPAPEIKWRRED-NQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEI   98 (142)
Q Consensus        20 ~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~-~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~   98 (142)
                      .+.+..|+++.|.|.+.+.+.+.+.|++ + +..+....  +......                                
T Consensus         3 ~~~~~~g~~~~l~C~~~~~~~~~~~W~~-~~~~~v~~~~--~~~~~~~--------------------------------   47 (86)
T smart00410        3 SVTVKEGESVTLSCEVSGSPPPEVTWYK-QGGKLLAESG--RFSVSRS--------------------------------   47 (86)
T ss_pred             cEEEeCCCeEEEEEEEccCCCCeEEEEE-CCCEEcCCCC--cEEEEEc--------------------------------
Confidence            4567889999999999888778999999 5 44432111  1000000                                


Q ss_pred             EEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEEC
Q psy15390         99 IFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDVE  142 (142)
Q Consensus        99 ~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V~  142 (142)
                          .....|.|.++...|+|.|+|.+.+..+.. ...+.|.|+
T Consensus        48 ----~~~~~l~i~~~~~~d~G~Y~C~v~~~~~~~-~~~~~l~V~   86 (86)
T smart00410       48 ----GSNSTLTISNVTPEDSGTYTCAATNSSGSA-SSTTTLTVL   86 (86)
T ss_pred             ----CCeeEEEEEeeccccCeEEEEEEEcCCCeE-EEEEEEEEC
Confidence                002247777777777788888887666653 333666653


No 111
>smart00409 IG Immunoglobulin.
Probab=99.19  E-value=1.4e-09  Score=59.21  Aligned_cols=83  Identities=28%  Similarity=0.538  Sum_probs=52.2

Q ss_pred             eeEEecCCcEEEEEEEecCCCCeeEEEecC-CcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEE
Q psy15390         20 SVAVREEFNITLTCKAEGFPAPEIKWRRED-NQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEI   98 (142)
Q Consensus        20 ~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~-~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~   98 (142)
                      .+.+..|+++.|.|.+.+.+.+.+.|++ + +..+....  +......                                
T Consensus         3 ~~~~~~g~~~~l~C~~~~~~~~~~~W~~-~~~~~v~~~~--~~~~~~~--------------------------------   47 (86)
T smart00409        3 SVTVKEGESVTLSCEVSGSPPPEVTWYK-QGGKLLAESG--RFSVSRS--------------------------------   47 (86)
T ss_pred             cEEEeCCCeEEEEEEEccCCCCeEEEEE-CCCEEcCCCC--cEEEEEc--------------------------------
Confidence            4567889999999999888778999999 5 44432111  1000000                                


Q ss_pred             EEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEEC
Q psy15390         99 IFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDVE  142 (142)
Q Consensus        99 ~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V~  142 (142)
                          .....|.|.++...|+|.|+|.+.+..+.. ...+.|.|+
T Consensus        48 ----~~~~~l~i~~~~~~d~G~Y~C~v~~~~~~~-~~~~~l~V~   86 (86)
T smart00409       48 ----GSNSTLTISNVTPEDSGTYTCAATNSSGSA-SSTTTLTVL   86 (86)
T ss_pred             ----CCeeEEEEEeeccccCeEEEEEEEcCCCeE-EEEEEEEEC
Confidence                002247777777777788888887666653 333666653


No 112
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2). Ig2_IL1R2_like: domain similar to the second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds the type II (IL1R2) represented in this group. Mature IL1R2 consists of three IG-like domains, a transmembrane domain, and a short cytoplasmic domain. It lacks the large cytoplasmic domain of Mature IL1R1, and does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta.
Probab=99.19  E-value=1.4e-10  Score=64.93  Aligned_cols=66  Identities=18%  Similarity=0.294  Sum_probs=41.3

Q ss_pred             EEecCCcEEEEEEE-e----cCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEe
Q psy15390         22 AVREEFNITLTCKA-E----GFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATK   88 (142)
Q Consensus        22 ~~~~g~~v~l~C~~-~----~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~   88 (142)
                      .+..|.+..|.|+- .    ..+.+.+.||+ ++.++...............|.|.+|..+|+|.|+|.+.+
T Consensus         6 ~~~~~~~~~l~Cp~~~~f~~~~~~~~v~WYK-d~~~l~~~~~~~~~~~~~~~L~I~~v~~~D~G~YtC~~~~   76 (95)
T cd05897           6 ILFTSTSGKLVCPDLSDFTINRTDVELQWYK-DSVLLDKDNEKFYSLKGSTYLHIIDVSLNDSGYYTCKLQF   76 (95)
T ss_pred             EeccccCcEEECCCHHHcccCCCCCcEEEcc-CCEECcCCCcceEecCCCCEEEEEEcChhhCEEEEEEEEE
Confidence            46678999999972 2    23556899999 8887754332221112234566666666666666666554


No 113
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). Ig4_SCFR: The fourth Immunoglobulin (Ig)-like domain in stem cell factor receptor (SCFR). SCFR is organized as an extracellular component having five IG-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR. This fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth domain abolishes the ligand-induced dimerization of SCFR and completely inhibits signal transduction.
Probab=99.17  E-value=3.7e-09  Score=59.47  Aligned_cols=90  Identities=22%  Similarity=0.370  Sum_probs=62.3

Q ss_pred             CceeEEecCCcEEEEEEEecCCCCe-eEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEE
Q psy15390         18 PSSVAVREEFNITLTCKAEGFPAPE-IKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFW   96 (142)
Q Consensus        18 ~~~~~~~~g~~v~l~C~~~~~~~~~-~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w   96 (142)
                      ...+.+.+|+++.|.|.+.+.|.|. +.|.+ ++..+......        ...     ..+.++|.             
T Consensus        10 ~~~~~v~~gE~~~L~V~ieAYP~p~~~~W~~-~~~~l~~~~~~--------~~~-----~~~~~~~r-------------   62 (101)
T cd05860          10 NTTIFVNAGENLDLIVEYEAYPKPEHQQWIY-MNRTLTNTSDH--------YVK-----SRNESNNR-------------   62 (101)
T ss_pred             CceEEEECCCCEEEEEEEEeCCCCeeeEEEc-CCcccCccccc--------eeE-----EeccCceE-------------
Confidence            3467899999999999999999997 99998 66654322110        000     00111111             


Q ss_pred             EEEEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEEC
Q psy15390         97 EIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDVE  142 (142)
Q Consensus        97 ~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V~  142 (142)
                             ..+.|.+.+++.+|.|.|+|.|.|.... .+.++.|.|+
T Consensus        63 -------Y~S~L~L~Rlk~~E~G~YTf~a~N~~~~-~s~tF~l~v~  100 (101)
T cd05860          63 -------YVSELHLTRLKGTEGGTYTFLVSNSDAS-ASVTFNVYVN  100 (101)
T ss_pred             -------EEEEEEEeecChhhCcEEEEEEECCCCe-EEEEEEEEEe
Confidence                   1235888899999999999999998875 6777777764


No 114
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). Ig2_VEGFR: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-2 is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A. VEGFR-1 may play an inhibitory part in these processes by binding VEGF and interfering with its interaction with VEGFR-2. VEGFR-1 has a signa
Probab=99.17  E-value=3.9e-10  Score=60.07  Aligned_cols=23  Identities=22%  Similarity=0.472  Sum_probs=18.3

Q ss_pred             ceEEEeecCCCCCeEEEEEEEec
Q psy15390         67 EQLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        67 ~~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      ..|.|.++..+|+|.|+|.+.|.
T Consensus        35 ~~L~I~~v~~~D~G~YtC~a~N~   57 (71)
T cd04976          35 HSLTIKDVTEEDAGNYTVVLTNK   57 (71)
T ss_pred             CEEEECcCCHHHCEEEEEEEEcC
Confidence            03778888899999999988874


No 115
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin. Ig4_Peroxidasin: the fourth immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted, and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells, which have undergone programmed cell death, and protection of the organism against non-self.
Probab=99.16  E-value=3.6e-10  Score=59.84  Aligned_cols=21  Identities=29%  Similarity=0.632  Sum_probs=16.1

Q ss_pred             EEEeecCCCCCeEEEEEEEec
Q psy15390         69 LNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        69 l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      |.|.++..+|+|.|.|.+.|.
T Consensus        38 L~I~~~~~~D~G~Y~C~a~N~   58 (69)
T cd05746          38 LAIRDVGVADQGRYECVARNT   58 (69)
T ss_pred             EEECcCChhhCEEEEEEEECC
Confidence            677778888888888877765


No 116
>PHA02826 IL-1 receptor-like protein; Provisional
Probab=99.16  E-value=2.2e-10  Score=74.08  Aligned_cols=68  Identities=15%  Similarity=0.300  Sum_probs=51.4

Q ss_pred             ceeEEecCCcEEEEEEEec-----CCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEe
Q psy15390         19 SSVAVREEFNITLTCKAEG-----FPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATK   88 (142)
Q Consensus        19 ~~~~~~~g~~v~l~C~~~~-----~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~   88 (142)
                      ....+.+|+++.|.|.+.+     .|.+.+.|++ +++.+....+..+ ...++.|.|.+++.+|+|.|+|.+..
T Consensus       137 ~~~~~~~G~~v~L~C~~~~~~~~~~p~p~I~WyK-ng~~l~~~~r~~~-~~~~~~L~I~~V~~~DsG~YtC~a~~  209 (227)
T PHA02826        137 INYQFNSGKDSKLHCYGTDGISSTFKDYTLTWYK-NGNIVLYTDRIQL-RNNNSTLVIKSATHDDSGIYTCNLRF  209 (227)
T ss_pred             ccceEecCCCEEEEeeCCCCccccCCCceEEEEE-CCEECCCCCCEEE-eCCCCEEEECcCCHHhCEEEEEEEEE
Confidence            3456778999999999753     3567999999 8888764432221 12345899999999999999998864


No 117
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4. Ig2_PTK7: domain similar to the second immunoglobulin (Ig)-like domain in protein tyrosine kinase (PTK) 7, also known as CCK4. PTK7 is a subfamily of the receptor protein tyrosine kinase family, and is referred to as an RPTK-like molecule. RPTKs transduce extracellular signals across the cell membrane, and play important roles in regulating cell proliferation, migration, and differentiation. PTK7 is organized as an extracellular portion having seven Ig-like domains, a single transmembrane region, and a cytoplasmic tyrosine kinase-like domain. PTK7 is considered a pseudokinase as it has several unusual residues in some of the highly conserved tyrosine kinase (TK) motifs; it is predicted to lack TK activity. PTK7 may function as a cell-adhesion molecule. PTK7 mRNA is expressed at high levels in placenta, melanocytes, liver, lung, pancreas, and kidney. PTK7 is overexpressed in s
Probab=99.14  E-value=1.3e-09  Score=58.91  Aligned_cols=21  Identities=24%  Similarity=0.523  Sum_probs=15.9

Q ss_pred             EEEeecCCCCCeEEEEEEEec
Q psy15390         69 LNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        69 l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      |.|.++..+|+|.|.|.+.|.
T Consensus        40 L~I~~~~~~D~G~Y~C~a~N~   60 (77)
T cd05760          40 LTLRSAGPDDSGLYYCCAHNA   60 (77)
T ss_pred             EEEeeCCcccCEEEEEEEEeC
Confidence            677777777788888877764


No 118
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R). IG1_VEGFR: first immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGF_A interacts with both VEGFR-1 and VEGFR-2. VEGFR-1 binds strongest to VEGF, VEGF-2 binds more weakly. VEGFR-3 appears not to bind VEGF, but binds other members of the VEGF family (VEGF-C and -D). VEGFRs bind VEGFs with high affinity with the IG-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-2 is a major mediator of the mitogenic, angioge
Probab=99.12  E-value=1.6e-09  Score=59.79  Aligned_cols=35  Identities=23%  Similarity=0.415  Sum_probs=27.1

Q ss_pred             ceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        106 EQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       106 ~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      +.|.|.+++.+|+|.|+|.|.|..+. ......|.|
T Consensus        50 s~L~I~~~~~~DsG~Y~C~a~n~~~~-~~~~t~~~V   84 (86)
T cd05862          50 STLTIENVTLSDLGRYTCTASSGQMI-AKNSTIVIV   84 (86)
T ss_pred             eEEEEecCCcccCEEEEEEEeecceE-ecccEEEEE
Confidence            35888888999999999999988774 556666655


No 119
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan. Ig_Aggrecan: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan. These aggregates contribute to the tissue's load bearing properties. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Aggrecan has a wide distribution in connective tissue and extracellular matrices. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Probab=99.11  E-value=6.6e-09  Score=60.07  Aligned_cols=38  Identities=21%  Similarity=0.420  Sum_probs=31.0

Q ss_pred             ccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEEC
Q psy15390        104 YGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDVE  142 (142)
Q Consensus       104 ~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V~  142 (142)
                      ...+|.|.+++.+|+|+|+|.+.+.... -+..+.|.|+
T Consensus        72 ~~asL~I~nl~~sDsG~Y~C~V~~g~~~-~~~~v~l~v~  109 (112)
T cd05900          72 SDATLEITELRSNDSGTYRCEVMHGIED-NYDTVEVQVK  109 (112)
T ss_pred             CCcEEEEeecccccCEEEEEEEecCCCC-ceeEEEEEEE
Confidence            4567999999999999999999977665 4667777764


No 120
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0). Ig_P0ex: immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an Ig domain.  The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin.
Probab=99.09  E-value=1.2e-08  Score=59.41  Aligned_cols=108  Identities=18%  Similarity=0.208  Sum_probs=60.2

Q ss_pred             CCceeEEecCCcEEEEEEEecCC----CCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCc
Q psy15390         17 TPSSVAVREEFNITLTCKAEGFP----APEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPL   92 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~~~----~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~   92 (142)
                      .+..+.+..|+++.|.|......    ...+.|.......   .....+....++....     .+.|.|.=        
T Consensus         4 ~~~ev~a~~G~~v~L~C~f~~~~~~~~~~~v~W~~~~~~~---~~~~~v~~y~~g~~~~-----~~~~~f~~--------   67 (116)
T cd05879           4 TDREVYGTVGSDVTLSCSFWSSEWISDDISFTWHYQPDGS---RDAISIFHYGKGQPYI-----DDVGPFKE--------   67 (116)
T ss_pred             ccceEEEEcCCcEEEEEEEecCCCCCCcEEEEEEEcCCCC---CccEEEEEeCCCceec-----ccccCccC--------
Confidence            45567888999999999987643    3479994412110   0111111222211110     01111111        


Q ss_pred             cEEEEEEEeccccceEEEccCCCCCCeEEEEEEecCCCC-CeeeEEEEEE
Q psy15390         93 KIFWEIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPP-SVSKRITVDV  141 (142)
Q Consensus        93 ~~~w~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~-~~s~~~~l~V  141 (142)
                      .+.|.... ...+.++.|.+++.+|+|+|+|.+.|.+.. .....+.|.|
T Consensus        68 Rv~f~g~~-~~~daSI~I~nv~~sD~G~Y~C~v~n~p~~~~~~~~~~l~v  116 (116)
T cd05879          68 RIEWVGNP-SRKDGSIVIHNLDYTDNGTFTCDVKNPPDIVGKSSQVTLYV  116 (116)
T ss_pred             ceEEeCCC-CcCeeEEEEccCCcccCEEEEEEEEcCCCcCCceeEEEEEC
Confidence            23333222 234568999999999999999999998763 2234555544


No 121
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d5: the fifth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrkB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor foun
Probab=99.08  E-value=1.4e-09  Score=59.32  Aligned_cols=23  Identities=17%  Similarity=0.215  Sum_probs=18.5

Q ss_pred             eEEEeecCCCCCeEEEEEEEecC
Q psy15390         68 QLNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        68 ~l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      .|.|.++...|+|.|+|.+.|..
T Consensus        47 ~L~I~~~~~~D~G~YtC~A~N~~   69 (81)
T cd04971          47 CLQFDNPTHVNNGNYTLVASNEY   69 (81)
T ss_pred             EEEECCCCcccCeEEEEEEEeCC
Confidence            47888888888888888888753


No 122
>PF13927 Ig_3:  Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C ....
Probab=99.07  E-value=4.7e-10  Score=59.96  Aligned_cols=74  Identities=32%  Similarity=0.614  Sum_probs=43.8

Q ss_pred             CCeeeecCCCCceeEEecCCcEEEEEEEecCC-CCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEE
Q psy15390          8 PPNILDTESTPSSVAVREEFNITLTCKAEGFP-APEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIA   86 (142)
Q Consensus         8 ~p~~~~~~~~~~~~~~~~g~~v~l~C~~~~~~-~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~   86 (142)
                      +|.+..   .+.......+. +.|.|.+.+.+ .+.+.|+. ......  ..........+.|.|.++..+|.|.|+|.+
T Consensus         1 kP~I~~---~~~~~~~~~~~-~~l~C~~~~~~~~~~~~W~~-~~~~~~--~~~~~~~~~~~~L~i~~v~~~~~g~y~C~a   73 (75)
T PF13927_consen    1 KPQISV---PPPPVVTSGGS-VTLTCSAEGGPPPPSISWYD-SNPSFN--SNSRGSSSSNSTLTISNVTRSDNGTYTCIA   73 (75)
T ss_dssp             ESEEEE---ESTSEEETTEE-EEEEEEESSEESSEEEEEET-EEEEEE--EEEEEEEEEEEEEEESSCCGGGTEEEEEEE
T ss_pred             CCEEEE---cCCCcEeecee-EEEEEEEccccCCeEEEEEe-cCCcee--eeeeeccceeeEEEEccCCHHhCcEEEEEE
Confidence            356555   34444443333 99999998877 67899991 111000  011112233456788888888888888877


Q ss_pred             Ee
Q psy15390         87 TK   88 (142)
Q Consensus        87 ~~   88 (142)
                      .|
T Consensus        74 ~N   75 (75)
T PF13927_consen   74 SN   75 (75)
T ss_dssp             EE
T ss_pred             EC
Confidence            65


No 123
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). Ig2_KIRREL3-like: domain similar to the second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=99.06  E-value=6.8e-09  Score=56.78  Aligned_cols=80  Identities=29%  Similarity=0.406  Sum_probs=47.7

Q ss_pred             cEEEEEEEec-CCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEeccccc
Q psy15390         28 NITLTCKAEG-FPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYGE  106 (142)
Q Consensus        28 ~v~l~C~~~~-~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~~  106 (142)
                      .+.|.|.+.+ .|.+.+.|++ +|+.+....... .           + ..+.+.|.-                    .+
T Consensus         1 ~~~L~C~v~g~~P~~~v~W~~-~g~~l~~~~~~~-~-----------~-~~~~~~~~~--------------------~s   46 (82)
T cd05759           1 PYNLTCRARGAKPAAEIIWFR-DGEVLDGATYSK-E-----------L-LKDGKRETT--------------------VS   46 (82)
T ss_pred             CEEEEEEEeCccCCCEEEEEE-CCEEccCceeee-e-----------E-ecCCCeEEE--------------------EE
Confidence            3689999987 5778999999 887664221000 0           0 001111110                    12


Q ss_pred             eEEEccCCCCCCeEEEEEEecCCCC-CeeeEEEEEE
Q psy15390        107 QLNITKISRTEMGAYLCIATNNVPP-SVSKRITVDV  141 (142)
Q Consensus       107 ~l~i~~~~~~d~g~y~C~a~n~~~~-~~s~~~~l~V  141 (142)
                      .|.+......|.|.|+|.|.|...+ .+..+++|+|
T Consensus        47 ~L~i~~~~~~~~~~y~C~a~n~~l~~~~~~s~~l~v   82 (82)
T cd05759          47 TLPITPSDHDTGRTFTCRARNEALPTGKETSVTLDV   82 (82)
T ss_pred             EEEEeCceecCCCEEEEEEcCccCCCCcEEEEEEcC
Confidence            3666666666778999999886533 4667777765


No 124
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins. IgV_TCR_alpha: immunoglobulin (Ig) variable domain of the alpha chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group represents the variable domain of the alpha chain of TCRs and also includes the variable domain of delta chains of TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=99.05  E-value=2.6e-09  Score=61.56  Aligned_cols=103  Identities=18%  Similarity=0.290  Sum_probs=57.2

Q ss_pred             CCceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEE
Q psy15390         17 TPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFW   96 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w   96 (142)
                      .+..+.+.+|++++|.|...+.+...+.|++.. ..  .............       .....+.+.....         
T Consensus         4 ~~~~v~~~~G~~v~L~C~~~~~~~~~v~W~k~~-~~--~~~~~l~~~~~~~-------~~~~~~r~~~~~~---------   64 (109)
T cd04983           4 SPQSLSVQEGENVTLNCNYSTSTFYYLFWYRQY-PG--QGPQFLIYISSNG-------EEKEKGRFSATLD---------   64 (109)
T ss_pred             cCCceEEcCCCCEEEEEEECCCCccEEEEEEEC-CC--CCeEEEEEEecCC-------CcccCCcEEEEEc---------
Confidence            566788999999999999987777789999832 10  0000000000000       0011121111100         


Q ss_pred             EEEEeccccceEEEccCCCCCCeEEEEEEecCCCC---CeeeEEEEEEC
Q psy15390         97 EIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPP---SVSKRITVDVE  142 (142)
Q Consensus        97 ~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~---~~s~~~~l~V~  142 (142)
                          .......|.|.+++.+|+|.|.|.+.+..+.   .......|.|+
T Consensus        65 ----~~~~~~~L~I~~~~~~DsG~Y~C~~~~~~~~~~~~~g~gt~l~V~  109 (109)
T cd04983          65 ----KSRKSSSLHISAAQLSDSAVYFCALSESGGTGKLTFGKGTRLTVE  109 (109)
T ss_pred             ----ccCCEEEEEECCCCHHHCEEEEEEEecCCCCcceEECCCEEEEEC
Confidence                0112346899999999999999999876431   12334455554


No 125
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins. Ig1_LILRB1_like: domain similar to the first immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1). This group includes, LILRA5 (LIR9), an activating natural cytotoxicity receptor NKp46, and the immune-type receptor glycoprotein VI (GPVI). LILRs are a family of immunoreceptors expressed on expressed on T and B cells, on monocytes, dendritic cells, and subgroups of natural killer (NK) cells. The human LILR family contains nine proteins (LILRA1-3,and 5, and LILRB1-5). From functional assays, and as the cytoplasmic domains of various LILRs, for example LILRB1 (LIR-1), LILRB2 (LIR-2), and LILRB3 (LIR-3) contain immunoreceptor tyrosine-based inhibitory motifs (ITIMs) it is thought that LIR proteins are inhibitory receptors. Of the eight LIR family proteins, only LIR-1(LILRB1), and LIR-2 (LILRB2),
Probab=99.05  E-value=1.3e-09  Score=60.82  Aligned_cols=40  Identities=25%  Similarity=0.434  Sum_probs=28.3

Q ss_pred             CCeeeecCCCCceeEEecCCcEEEEEEEecCCCCeeEEEecCCcce
Q psy15390          8 PPNILDTESTPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPI   53 (142)
Q Consensus         8 ~p~~~~~~~~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~   53 (142)
                      +|.+..   .+. ..+.+|++|+|.|... .+...+.|++ +|...
T Consensus         2 kP~L~a---~p~-~vV~~G~~VtL~C~~~-~~~~~f~l~k-~g~~~   41 (91)
T cd05751           2 KPSLWA---EPS-SVVPLGKPVTLRCQGP-YGAVEYRLYR-EGSTF   41 (91)
T ss_pred             CCEEEe---cCC-CccCCCCcEEEEEecC-CCCCEEEEEE-CCCCc
Confidence            455555   443 3678999999999875 5556788888 77653


No 126
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins. Ig_CSPGs_LP: immunoglobulin (Ig)-like domain similar to that found in chondroitin sulfate proteoglycans (CSPGs) and human cartilage link protein (LP).  Included in this group are the CSPGs aggrecan, versican, and neurocan. In CSPGs this Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggrecan and versican have a wide distribution in connective tissue and extracellular matrices. Neurocan is localized almost exclusively in nervous tissue.
Probab=99.04  E-value=2.3e-08  Score=57.33  Aligned_cols=38  Identities=18%  Similarity=0.361  Sum_probs=31.7

Q ss_pred             ccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEEC
Q psy15390        104 YGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDVE  142 (142)
Q Consensus       104 ~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V~  142 (142)
                      ...+|.|.+++.+|+|.|.|.+.+..+. ....+.|.|.
T Consensus        66 ~~~sL~I~~v~~sD~G~Y~C~v~~~~~~-~~~~v~L~V~  103 (106)
T cd05714          66 GDASLVITDLRLEDSGRYRCEVIDGIED-EQDTVELEVR  103 (106)
T ss_pred             CcceEEECCCCHHHCEEEEEEEEcCCCc-eEEEEEEEEE
Confidence            4568999999999999999999987664 5778887773


No 127
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B. Ig_Sema4B_like; Immunoglobulin (Ig)-like domain of Sema4B_like. Sema4B is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4B has extracellular Sema and Ig domains, a transmembrane domain and a short cytoplasmic domain. Sema4B has been shown to preferentially regulate the development of the postsynaptic specialization at the glutamatergic synapses. This cytoplasmic domain includes a PDZ-binding motif upon which the synaptic localization of Sem4B is dependent. Sema4B is a ligand of CLCP1, CLCP1 was identified in an expression profiling analysis, which compared a highly metastic lung cancer subline with its low metastic parental line. Sema4B was shown to promote CLCP1 endocytosis, and their interaction is a potential target for therapeutic intervention of metastasis.
Probab=99.03  E-value=2.1e-09  Score=58.96  Aligned_cols=65  Identities=17%  Similarity=0.289  Sum_probs=46.6

Q ss_pred             CceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEE
Q psy15390         18 PSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIAT   87 (142)
Q Consensus        18 ~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~   87 (142)
                      .+.+.+.+|+++.|.|...+. .+.+.|+. ++..+..+  .++.... ..|.|.+++..|+|.|.|.+.
T Consensus         3 ~~~~tv~~g~~v~L~C~~~s~-~A~v~W~~-ng~~l~~~--~r~~~~~-~GLlI~~~~~~dsG~Y~C~s~   67 (85)
T cd05872           3 VKNRTVAPGADVVLPCQLRSN-LASPVWLF-NGTPLNAQ--FSYRVGT-DGLLILVTSPEHSGTYRCYSE   67 (85)
T ss_pred             ceEEEEecCCCEEEECCCCCC-CccEEEEE-CCcccCCC--cceEEeC-CCCEEEECCHhhCEEEEEEEe
Confidence            456789999999999998765 55899999 77776543  2222222 236677788888888888765


No 128
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain. IgV_TCR_beta: immunoglobulin (Ig) variable domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the alpha chain of alpha/beta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=99.02  E-value=5.1e-09  Score=60.48  Aligned_cols=31  Identities=19%  Similarity=0.445  Sum_probs=26.6

Q ss_pred             CCceeEEecCCcEEEEEEEecCCCCeeEEEec
Q psy15390         17 TPSSVAVREEFNITLTCKAEGFPAPEIKWRRE   48 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~   48 (142)
                      .+..+.+.+|++++|.|...+ +...+.||+.
T Consensus         4 ~p~~~~v~~G~~v~l~C~~~~-~~~~v~Wykq   34 (110)
T cd05899           4 SPRYLIKGRGQSVTLRCSQTS-GHDNMYWYRQ   34 (110)
T ss_pred             CCCceEEcCCCcEEEEEEECC-CCCEEEEEEE
Confidence            567788999999999999877 6668999993


No 129
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP). Ig_LP_like: immunoglobulin (Ig)-like domain similar to that that found in human cartilage link protein (LP). In cartilage, chondroitin-keratan sulfate proteoglycan (CSPG), aggrecan, forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Probab=99.01  E-value=1.3e-08  Score=58.34  Aligned_cols=37  Identities=19%  Similarity=0.353  Sum_probs=31.1

Q ss_pred             cceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEEC
Q psy15390        105 GEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDVE  142 (142)
Q Consensus       105 ~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V~  142 (142)
                      ..+|.|.+++.+|+|+|.|.+.+..+. ....+.|.|+
T Consensus        67 ~~sL~I~~v~~~DsG~Y~C~v~~~~~~-~~~~~~l~v~  103 (106)
T cd05877          67 DASLVITDLRLEDYGRYRCEVIDGLED-ESVVVALRLR  103 (106)
T ss_pred             cEEEEEccCChHHCEEEEEEEEecccc-eEEEEEEEEE
Confidence            457999999999999999999988775 6777877773


No 130
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4  (Necl-4, also known as cell adhesion molecule 4 (CADM4)). Ig2_Necl-4: second immunoglobulin (Ig)-like domain of nectin-like molecule-4  (Necl-4, also known as cell adhesion molecule 4 (CADM4)). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1-Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Ig domains are likely to participate in ligand binding and recognition. Necl-4 is expressed on Schwann cells, and plays a key part in initiating peripheral nervous system (PNS) myelination.  In injured peripheral nerve cells, the mRNA signal for both Necl-4 and Necl-5 was observed to be elevated.  Necl-4 participates in cell-cell adhesion and is proposed to play a role in tumor suppression.
Probab=99.01  E-value=3e-09  Score=57.60  Aligned_cols=76  Identities=16%  Similarity=0.270  Sum_probs=48.3

Q ss_pred             EEEEEEEec-CCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEEEEEeccccce
Q psy15390         29 ITLTCKAEG-FPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYGEQ  107 (142)
Q Consensus        29 v~l~C~~~~-~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~~~~~~~~~~~  107 (142)
                      +.|.|...+ .|++.+.||+ +++.+.....                ...+.+.|+                    ..+.
T Consensus         2 ~~L~C~s~~skP~a~i~W~k-~~~~l~~~~~----------------~~~~~~~~t--------------------~~s~   44 (80)
T cd05885           2 VELTCLSPRSKPAATLRWYR-DRKELKGVIS----------------QQENGKTVS--------------------VSNT   44 (80)
T ss_pred             EEEEEeCCCccCCCeEEEEE-CCEECCCCcc----------------cccCCceEE--------------------EEEE
Confidence            689999755 7888999999 8887743210                001111222                    1234


Q ss_pred             EEEccCCCCCCeEEEEEEecCCCC--CeeeEEEEEE
Q psy15390        108 LNITKISRTEMGAYLCIATNNVPP--SVSKRITVDV  141 (142)
Q Consensus       108 l~i~~~~~~d~g~y~C~a~n~~~~--~~s~~~~l~V  141 (142)
                      |.+......|.+.|+|+|.|..++  .......|+|
T Consensus        45 L~~~~~~~Ddg~~~~C~A~n~a~~~~~~~~~~~l~V   80 (80)
T cd05885          45 IRFPVDRKDDGAILSCEASHPALVSQKKQTQYSLDV   80 (80)
T ss_pred             EEEEeeeccCCcEEEEEEEChhhCCCCeeEEEEEeC
Confidence            777777777888999999987665  2445555554


No 131
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG). Ig_MOG_like:  immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG). MOG, a minor component of the myelin sheath, is an important CNS-specific autoantigen, linked to the pathogenesis of multiple sclerosis (MS) and experimental autoimmune encephalomyelitis (EAE). It is a transmembrane protein having an extracellular Ig domain. MOG is expressed in the CNS on the outermost lamellae of the myelin sheath, and on the surface of oligodendrocytes, and may participate in the completion, compaction, and/or maintenance of myelin. This group also includes butyrophilin (BTN). BTN is the most abundant protein in bovine milk-fat globule membrane (MFGM).
Probab=99.01  E-value=1.5e-08  Score=57.47  Aligned_cols=36  Identities=17%  Similarity=0.307  Sum_probs=30.5

Q ss_pred             cceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        105 GEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       105 ~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      ..+|.|.+++.+|+|.|+|.+.+..+. ....+.|.|
T Consensus        64 ~~sL~I~~v~~~D~G~Y~C~v~~~~~~-~~~~i~l~v   99 (100)
T cd05713          64 SVALRIHNVRASDEGLYTCFFQSDGFY-EEATVELKV   99 (100)
T ss_pred             cEEEEEEcCChhhCEEEEEEEecCCcE-EEEEEEEEE
Confidence            457999999999999999999987765 677777776


No 132
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG). Ig_Aggrecan_like: immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG)s. Included in this group are the Ig domains of other CSPGs: versican, and neurocan. In CSPGs this Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggrecan and versican have a wide distribution in connective tissue and extracellular matrices. Neurocan is localized almost exclusively in nervous tissue. Aggregates having other CSPGs substi
Probab=99.00  E-value=3.2e-08  Score=57.17  Aligned_cols=37  Identities=16%  Similarity=0.437  Sum_probs=28.9

Q ss_pred             ccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        104 YGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       104 ~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      ...+|.|.+++.+|+|+|.|.+...... ....++|.|
T Consensus        70 ~~asL~I~~l~~sD~G~Y~C~v~~~~~~-~~~~v~l~V  106 (110)
T cd05878          70 GDASLEISRLRSSDSGVYRCEVMHGIED-EQDTVPLEV  106 (110)
T ss_pred             CcEEEEECCCChhhCEEEEEEEEeCCCc-ceEEEEEEE
Confidence            4567999999999999999999875443 456666665


No 133
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). IG_CEACAM_D1: immunoglobulin (Ig)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the D
Probab=99.00  E-value=3.1e-09  Score=60.75  Aligned_cols=101  Identities=11%  Similarity=0.015  Sum_probs=54.0

Q ss_pred             CceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEEEE
Q psy15390         18 PSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWE   97 (142)
Q Consensus        18 ~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~w~   97 (142)
                      +.+..+.+|+++.|.|.........+.||+ +....   ....+.......-. ...-....|                 
T Consensus         5 ~~p~~~~~G~~V~L~v~~~p~~~~~~~W~k-g~~~~---~~~~I~~y~~~~~~-~~~gp~~~g-----------------   62 (105)
T cd05774           5 LVPPQVAEGENVLLLVHNLPENLLAYAWYK-GKTVS---PNFLIASYIISTNS-STPGPAYSG-----------------   62 (105)
T ss_pred             ccCCcccCCCCEEEEecCCCCCceEEEEEc-CCCCC---CCEEEEEEECCCcc-cccCcccCC-----------------
Confidence            344567889999999976544444799999 32211   00011011000000 000001111                 


Q ss_pred             EEEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390         98 IIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus        98 ~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                       +.....+++|.|.+++.+|+|.|+|.+.+.-.......+.|.|
T Consensus        63 -R~~~~~ngSL~I~~v~~~D~G~Y~~~v~~~~~~~~~~~v~l~V  105 (105)
T cd05774          63 -RETIYPNGSLLIQNVTQKDTGFYTLQTITTNFQVEQATVHLQV  105 (105)
T ss_pred             -cEEEeCCCcEEEecCCcccCEEEEEEEEeCCccEEEEEEEEEC
Confidence             1222335578888888888888888888766444455565554


No 134
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins. Ig_CEACAM_D1_like : immunoglobulin (IG)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily-like. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surf
Probab=98.97  E-value=1.5e-08  Score=56.55  Aligned_cols=37  Identities=14%  Similarity=0.227  Sum_probs=30.3

Q ss_pred             cceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        105 GEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       105 ~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      +.+|.|.+++.+|+|.|+|.+....+......+.|.|
T Consensus        56 ~~sL~I~~l~~~DsG~Y~c~v~~~~~~~~~~~~~l~v   92 (92)
T cd05741          56 NGSLLIQNLTKEDSGTYTLQIISTNGVTENAKFFLRV   92 (92)
T ss_pred             CceEEEccCCchhcEEEEEEEEcCCCcEEEEEEEEEC
Confidence            3679999999999999999998877766777777765


No 135
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins. Ig_P0ex-like: domain similar to the immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an extracellular Ig domain. The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin. This group also contains the Ig domain of Sodium channel subunit beta-2 
Probab=98.97  E-value=6.6e-08  Score=56.37  Aligned_cols=108  Identities=15%  Similarity=0.207  Sum_probs=55.8

Q ss_pred             CCceeEEecCCcEEEEEEEecCC----CCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCc
Q psy15390         17 TPSSVAVREEFNITLTCKAEGFP----APEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPL   92 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~~~----~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~   92 (142)
                      .|..+.+.+|++++|.|......    ...+.|++....   ......+.....+...     ....+.|.=        
T Consensus         4 ~p~~v~v~~G~~vtL~C~~s~~~~~~~~~~v~W~~~~~~---~~~~~~v~~~~~~~~~-----~~~~~~~~~--------   67 (116)
T cd05715           4 TPREVYAVNGSDVRLKCTFSSSEPISDDISVTWSFQPEG---SGDTESIFHYHKGPYY-----PLKDGRFKD--------   67 (116)
T ss_pred             cCCeEEEEcCCCeEEEeEEeCCCCcCCceEEEEEEecCC---CCCcEEEEEEcCCccc-----cccCccccC--------
Confidence            46667888999999999886532    245899872210   0000010111110000     001111111        


Q ss_pred             cEEEEEEEeccccceEEEccCCCCCCeEEEEEEecCCCCC-eeeEEEEEE
Q psy15390         93 KIFWEIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPS-VSKRITVDV  141 (142)
Q Consensus        93 ~~~w~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~-~s~~~~l~V  141 (142)
                      .+.+.. .......+|.|.+++.+|+|.|.|.+.|.+... -+..+.|.|
T Consensus        68 R~~~~~-~~~~~~~sL~I~~v~~~D~G~Y~C~v~~~~~~~~~~~~~~~~~  116 (116)
T cd05715          68 RVEWVG-NPSRKDASIVIHNLQFTDNGTYTCDVKNPPDIVGKPGEIRLRV  116 (116)
T ss_pred             cEEEec-CCcCCeeEEEEeeCCcccCEEEEEEEEeCCCCCCCccEEEEeC
Confidence            111110 011224568999999999999999999876531 123455554


No 136
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. IgV_L_kappa: Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=98.96  E-value=4.8e-08  Score=56.03  Aligned_cols=32  Identities=22%  Similarity=0.487  Sum_probs=26.0

Q ss_pred             CCceeEEecCCcEEEEEEEecCC-CCeeEEEec
Q psy15390         17 TPSSVAVREEFNITLTCKAEGFP-APEIKWRRE   48 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~~~-~~~~~w~~~   48 (142)
                      .|..+.+.+|++++|.|.+.+.. ...+.||+.
T Consensus         6 ~p~~~~v~~G~~v~L~C~~~~~~~~~~~~Wyrq   38 (106)
T cd04980           6 SPATLSVSPGESATISCKASQSVSSNYLAWYQQ   38 (106)
T ss_pred             CCCcEEECCCCCEEEEEEECCCCCCCcEEEEEE
Confidence            56677899999999999987654 457999983


No 137
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1). Ig1_ IL1RAPL-1_like: domain similar to the first immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1).  IL-1 alpha and IL-1 beta are cytokines which participates in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of 
Probab=98.95  E-value=6.5e-09  Score=58.68  Aligned_cols=34  Identities=9%  Similarity=0.124  Sum_probs=23.6

Q ss_pred             ceeEEecCCcEEEEEEEe-----------cCCCCeeEEEecCCcce
Q psy15390         19 SSVAVREEFNITLTCKAE-----------GFPAPEIKWRREDNQPI   53 (142)
Q Consensus        19 ~~~~~~~g~~v~l~C~~~-----------~~~~~~~~w~~~~~~~~   53 (142)
                      ....+.+|+.+.|.|..-           ......+.||+ ++..+
T Consensus         8 ~~~~~~~GE~v~l~C~~~~~~~~~~~~~~~~~~~~v~WyK-~~~~~   52 (104)
T cd05896           8 KKYMVLAGEPVRIKCALFYGYIRTNYSMAQSAGLSLMWYK-SSGDG   52 (104)
T ss_pred             eeEEEcCCCeEEEECCCccccccccccccccCCceEEEEE-CCCCC
Confidence            346788999999999851           11233789999 65433


No 138
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like. Ig_SLAM-CD84_like_N: The N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like. The SLAM family is a group of immune-cell specific receptors that can regulate both adaptive and innate immune responses. Members of this group include proteins such as CD84, SLAM (CD150), Ly-9 (CD229), NTB-A (ly-108, SLAM6), 19A (CRACC), and SLAMF9. The genes coding for the SLAM family are nested on chromosome 1, in humans at 1q23, and in mice at 1H2. The SLAM family is a subset of the CD2 family, which also includes CD2 and CD58 located on chromosome 1 at 1p13 in humans. In mice, CD2 is located on chromosome 3, and there is no CD58 homolog. The SLAM family proteins are organized as an extracellular domain with either two or four Ig-like domains, a single transmembrane segment, and a cytoplasmic region 
Probab=98.93  E-value=1.6e-08  Score=57.14  Aligned_cols=37  Identities=16%  Similarity=0.332  Sum_probs=31.8

Q ss_pred             cceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        105 GEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       105 ~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      ..+|.|.+++.+|+|.|.|.+.+..+......+.|.|
T Consensus        60 ~~sL~I~~~~~~DsG~Y~c~v~~~~~~~~~~~f~L~v   96 (97)
T cd05775          60 DYSLQISNLKMEDAGSYRAEINTKNGVTITKEFTLHI   96 (97)
T ss_pred             ceeEEECCCchHHCEEEEEEEEcCCCCeEEEEEEEEe
Confidence            4679999999999999999999888777777777776


No 139
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins. Ig1_ MRC-OX-2_like: domain similar to the first immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200). MRC OX-2 is a membrane glycoprotein expressed in a variety of lymphoid and non-lymphoid cells in rats. It has a similar broad distribution pattern in humans. MRC OX-2 may regulate myeloid cell activity. The protein has an extracellular portion containing two Ig-like domains, a transmembrane portion, and a cytoplasmic portion.
Probab=98.92  E-value=4.7e-08  Score=55.18  Aligned_cols=39  Identities=21%  Similarity=0.279  Sum_probs=32.9

Q ss_pred             ccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEEC
Q psy15390        104 YGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDVE  142 (142)
Q Consensus       104 ~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V~  142 (142)
                      ...+|.|.+++.+|+|.|+|.....+....+..+.|+|+
T Consensus        59 ~~~sL~I~nv~~~D~G~Y~C~~~~~p~g~~~~~~~L~v~   97 (97)
T cd05846          59 NSTSITIWNVTLEDEGCYKCIFNTFPDGSKSGTMCLTVY   97 (97)
T ss_pred             CccEEEEeCCceeeeEEEEEEEEeCCCCCeeeEEEEEEC
Confidence            356799999999999999999987765567888888884


No 140
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. Ig3_RPTP_IIa_LAR_like: domain similar to the third immunoglobulin (Ig)-like domain found in the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. LAR belongs to the RPTP type IIa subfamily. Members of this subfamily are cell adhesion molecule-like proteins involved in central nervous system (CNS) development. They have large extracellular portions, comprised of multiple IG-like domains and two to nine fibronectin type III (FNIII) domains, and a cytoplasmic portion having two tandem phosphatase domains. Included in this group is Drosophila LAR (DLAR).
Probab=98.92  E-value=2e-08  Score=53.07  Aligned_cols=58  Identities=19%  Similarity=0.201  Sum_probs=43.1

Q ss_pred             CeEEEEEEEecCCccEEEEEEEec--------cccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEE
Q psy15390         79 MGAYLCIATKIGPLKIFWEIIFHM--------HYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITV  139 (142)
Q Consensus        79 ~G~y~C~~~~~~~~~~~w~~~~~~--------~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l  139 (142)
                      .-...|.+...|.|.+.|.+....        .....|.|.++  .|+|.|+|.|.|..|. +...+.|
T Consensus         3 ~v~L~C~a~G~P~P~v~W~k~g~~l~~~~~~~~~~~~L~i~~~--~d~G~Y~C~A~N~~G~-~~~~a~l   68 (69)
T cd05739           3 SVNLTCVAVGAPMPYVKWMKGGEELTKEDEMPVGRNVLELTNI--YESANYTCVAISSLGM-IEATAQV   68 (69)
T ss_pred             eEEEEEEeeecCCCEEEEEECCEECCCccceecCccEEEEecc--ccCeeEEEEEEeCCCE-EEEEEEE
Confidence            346799999999999999764211        12345777776  4899999999999996 6666654


No 141
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1). Ig2_VEGFR-1: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1). VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-1 binds VEGF-A strongly; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-1 may play an inhibitory rolet in the function of VEGFR-2 by binding VEGF-A and interfering with its interaction with VEGFR-2. VEGFR-1 has a signaling role in mediating monocyte chemotaxis and may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells.
Probab=98.91  E-value=1.2e-08  Score=54.35  Aligned_cols=49  Identities=12%  Similarity=0.068  Sum_probs=39.3

Q ss_pred             EEEEEEecCCccEEEEEEEec---------cccceEEEccCCCCCCeEEEEEEecCCC
Q psy15390         82 YLCIATKIGPLKIFWEIIFHM---------HYGEQLNITKISRTEMGAYLCIATNNVP  130 (142)
Q Consensus        82 y~C~~~~~~~~~~~w~~~~~~---------~~~~~l~i~~~~~~d~g~y~C~a~n~~~  130 (142)
                      +.|.+...|.|.+.|.+....         ....+|.|.++..+|+|.|+|.|.|...
T Consensus         3 l~c~v~g~P~P~v~W~kdg~~l~~~~~~~~~~~~~L~I~~v~~~D~G~YtC~a~~~~~   60 (72)
T cd07702           3 LTPKVKAFPAPEVIWLKDGLPAAEKCSRYHVDGYSLVIKDVTEEDAGIYTILLGIKQY   60 (72)
T ss_pred             EEeeEEEcCCCeEEEEECCEECCCCCcEEEeCCCEEEECcCCHHHCEEEEEEEEcccc
Confidence            579999999999999754211         1244799999999999999999999743


No 142
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA). Ig_EVA: immunoglobulin (Ig) domain of epithelial V-like antigen 1 (EVA). EVA is also known as myelin protein zero-like 2. EVA is an adhesion molecule, which may play a role in structural organization of the thymus and early lymphocyte development.
Probab=98.91  E-value=3.8e-08  Score=57.31  Aligned_cols=107  Identities=17%  Similarity=0.220  Sum_probs=56.2

Q ss_pred             CCceeEEecCCcEEEEEEEecCC----CCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCc
Q psy15390         17 TPSSVAVREEFNITLTCKAEGFP----APEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPL   92 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~~~----~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~   92 (142)
                      .+..+.+.+|++++|.|.....+    ...+.|++.....   .....+......      ......+.|.=++      
T Consensus         4 ~~~~v~~~~G~~v~L~C~~s~~~~~~~~~~i~W~~~~~~~---~~~~~v~~~~~~------~~~~~~~~f~~R~------   68 (115)
T cd05880           4 TSKEVEAVNGTDVRLKCTFSSSAPIGDTLVITWNFRPLDG---GREESVFYYHKR------PYPPPDGRFKGRV------   68 (115)
T ss_pred             cCceEEEEcCCCEEEEEEEEeCCCCCCcEEEEEEEECCCC---CceeEEEEECCC------ccccCcccccCeE------
Confidence            46678899999999999986533    2358998621000   000000000000      0011112221111      


Q ss_pred             cEEEEEEEeccccceEEEccCCCCCCeEEEEEEecCCCC-CeeeEEEEEE
Q psy15390         93 KIFWEIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPP-SVSKRITVDV  141 (142)
Q Consensus        93 ~~~w~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~-~~s~~~~l~V  141 (142)
                        .+.. .......+|.|.+++.+|+|.|+|.+.|.+.. ...-.+.|.|
T Consensus        69 --~~~~-~~~~~~~sL~I~~v~~~D~G~Y~C~v~~~~~~~~~~~~~~~~~  115 (115)
T cd05880          69 --VWDG-NIMRRDASILIWQLQPTDNGTYTCQVKNPPDVHGPIGEIRLRV  115 (115)
T ss_pred             --EEec-CCcCCceEEEEeeCChhhCEEEEEEEEeCCCCCCCccEEEEeC
Confidence              1111 01233557999999999999999999987664 1233444443


No 143
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain. IgV_TCR_gamma: immunoglobulin (Ig) variable (V) domain of the gamma chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is
Probab=98.90  E-value=2.2e-08  Score=58.38  Aligned_cols=32  Identities=31%  Similarity=0.665  Sum_probs=26.8

Q ss_pred             CCceeEEecCCcEEEEEEEec--CCCCeeEEEec
Q psy15390         17 TPSSVAVREEFNITLTCKAEG--FPAPEIKWRRE   48 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~--~~~~~~~w~~~   48 (142)
                      .+..+.+.+|++++|.|...+  .+.+.+.||+.
T Consensus         4 ~p~~~~~~~G~~v~l~C~~~~~~~~~~~v~Wyrq   37 (116)
T cd04982           4 PQLSITREESKSVTISCKVSGIDFSTTYIHWYRQ   37 (116)
T ss_pred             cCCeEEeCCCCCEEEEEEEeCCCccccEEEEEEE
Confidence            566778899999999999877  56678999993


No 144
>cd00099 IgV Immunoglobulin variable domain (IgV). IgV: Immunoglobulin variable domain (IgV). Members of the IgV family are components of immunoglobulin (Ig) and T cell receptors. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. Within the variable domain, there are regions of even more variability called the hypervariable or complementarity-determining regions (CDRs) which are responsible for antigen binding. A predominant feature of most Ig domains is the disulfide bridge connecting 2 beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=98.89  E-value=1.4e-08  Score=57.95  Aligned_cols=27  Identities=33%  Similarity=0.541  Sum_probs=22.5

Q ss_pred             EEecCCcEEEEEEEecC-CCCeeEEEec
Q psy15390         22 AVREEFNITLTCKAEGF-PAPEIKWRRE   48 (142)
Q Consensus        22 ~~~~g~~v~l~C~~~~~-~~~~~~w~~~   48 (142)
                      .+.+|++++|.|..... +...+.|++.
T Consensus         2 ~v~~G~~v~L~C~~~~~~~~~~v~W~k~   29 (105)
T cd00099           2 SVSEGESVTLSCTYSGSFSSYYIFWYRQ   29 (105)
T ss_pred             eecCCCCEEEEEEEeCCcCcceEEEEEE
Confidence            56789999999999876 5668999983


No 145
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins. Ig1_PVR_like: domain similar to the first immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155). Poliovirus (PV) binds to its cellular receptor (PVR/CD155) to initiate infection. CD155 is a membrane-anchored, single-span glycoprotein; its extracellular region has three Ig-like domains. There are four different isotypes of CD155 (referred to as alpha, beta, gamma, and delta), that result from alternate splicing of the CD155 mRNA, and have identical extracellular domains. CD155-beta and - gamma, are secreted, CD155-alpha and delta are membrane-bound and function as PV receptors. The virus recognition site is contained in the amino-terminal domain, D1. Having the virus attachment site on the receptor distal from the plasma membrane, may be important for successful initiation of infection of cells by the virus. CD155 binds in the poliovirus "c
Probab=98.88  E-value=9.8e-08  Score=53.86  Aligned_cols=38  Identities=18%  Similarity=0.296  Sum_probs=30.5

Q ss_pred             ccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        104 YGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       104 ~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      ...+|.|.+++.+|+|.|.|.+.+.+.......+.|.|
T Consensus        60 ~~~sL~I~~v~~~D~G~Y~C~v~~~~~g~~~~~~~l~V   97 (98)
T cd05718          60 EDATISISNLRLEDEGNYICEFATFPQGNRQKVTTLTV   97 (98)
T ss_pred             CceEEEEccCCcccCEEEEEEEEeCCCCcEEEEEEEEe
Confidence            45679999999999999999998755434677777776


No 146
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins. Ig1_Nectin-3_like: domain similar to the first immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3). Nectin-3 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which participate in adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. For example, during spermatid development, the nectin-3,-2 trans-interaction is required for the formation of Sertoli cell-spermatid junctions in testis, and during morphogenesis of the ciliary body, the nectin-3,-1 trans-interaction is important for apex-apex adhesion between the pigment and non-pigment layers of the ciliary epithelia. Nectins also
Probab=98.87  E-value=1.2e-07  Score=53.21  Aligned_cols=38  Identities=18%  Similarity=0.367  Sum_probs=32.2

Q ss_pred             ccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        104 YGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       104 ~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      ...+|.|.+++.+|+|.|+|.+.+.+..+.+..+.|.|
T Consensus        58 ~d~sl~i~nv~~~D~G~Y~C~v~tfP~G~~~~~~~l~~   95 (96)
T cd05887          58 LDATIMLENVGFSDIGVYICKAVTFPLGNTQSSTTVTV   95 (96)
T ss_pred             CccEEEEeCCCccccEEEEEEEEeCCCCCeeEEEEEEE
Confidence            35689999999999999999998877666777888876


No 147
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig1_FcgammaR_like: domain similar to the first immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=98.87  E-value=1.3e-08  Score=55.09  Aligned_cols=64  Identities=17%  Similarity=0.238  Sum_probs=48.9

Q ss_pred             cCCCCCeEEEEEEEecCC-ccEEEEEEEec--cccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390         74 ISRTEMGAYLCIATKIGP-LKIFWEIIFHM--HYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus        74 v~~~d~G~y~C~~~~~~~-~~~~w~~~~~~--~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      +...|.-...|.+...+. ..+.|.+....  .....|.|.++ .+|+|.|+|.|.|.   ..|..+.|+|
T Consensus        12 v~~G~~V~L~C~~~~~p~~~~~~W~kng~~l~~~~~~l~i~~~-~~dsG~Y~C~a~~~---~~S~~v~l~V   78 (78)
T cd05752          12 IFQGEKVTLTCNGFNSPEQNSTQWYHNGKLLETTTNSYRIRAA-NNDSGEYRCQTQGS---SLSDPVHLEV   78 (78)
T ss_pred             eeCCCCEEEEEeCCCCCCCccEEEEECCEEeeccCCeEEEeec-ccCCEEeEEECCCC---cCCCCEEEeC
Confidence            445677778999887654 56999876443  35678999999 99999999999975   3577777765


No 148
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs). Ig_Pro_neuregulin: immunoglobulin (Ig)-like domain in neuregulins (NRGs). NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. There are four members of the neuregulin gene family (NRG1, -2, -3, and -4). The NRG-1 protein, binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. The other NRGs proteins bind one or the other or both of these ErbBs. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates processes such as target cell differentiation, and Schwann cell surv
Probab=98.84  E-value=2.4e-08  Score=53.51  Aligned_cols=22  Identities=32%  Similarity=0.691  Sum_probs=16.8

Q ss_pred             eEEEeecCCCCCeEEEEEEEec
Q psy15390         68 QLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        68 ~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      .|.|.++..+|+|.|.|.+.|.
T Consensus        44 ~L~I~~~~~~D~G~Y~C~a~N~   65 (75)
T cd05750          44 ELQINKAKLADSGEYTCVVENI   65 (75)
T ss_pred             EEEEccCCcccCeEEEEEEEEc
Confidence            5777778888888888877764


No 149
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins. Ig1_Nectin-4_like: domain similar to the first immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor). Nectin-4 belongs to the nectin family, which is comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which participate in adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. For example nectin-4 trans-interacts with nectin-1. Nectin-4 has also been shown to interact with the actin filament-binding protein, afadin. Unlike the other nectins, which are widely expressed in adult tissues, nectin-4 is mainly expressed during embryogenesis, and is not detected in normal adult 
Probab=98.84  E-value=2.1e-07  Score=52.84  Aligned_cols=39  Identities=13%  Similarity=0.192  Sum_probs=32.4

Q ss_pred             ccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEEC
Q psy15390        104 YGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDVE  142 (142)
Q Consensus       104 ~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V~  142 (142)
                      ...+|.|.+++.+|+|+|.|.+.+.++...+..+.|.|.
T Consensus        62 ~~~sL~I~nv~~sD~GtY~C~v~~~p~g~~~~~~~L~V~  100 (100)
T cd05888          62 ADGALILRNAVQADEGKYKCRVITFPAGNFEAELVLTVW  100 (100)
T ss_pred             CceEEEEecCccccceEEEEEEEeCCCCCeeeEEEEEeC
Confidence            356799999999999999999998665556778888873


No 150
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI. IG_FcalphaRI : immunoglobulin (IG)-like domain of of FcalphaRI. FcalphaRI (CD89) is an IgA-specific receptor that is expressed on monocytes, eosinophils, neutrophils and macrophages. FcalphaRI mediates IgA-induced immune effector responses such as phagocytosis, antibody-dependent cell-mediated cytotoxicity and respiratory burst. Both monomeric and dimeric IgA can bind to FcalphaRI, and monomeric or dimeric IgA immune complexes can activate phagocytosis and other immune responses through the clustering of FcalphaRI. The Fc RI ectodomain is comprised of two Ig-like domains oriented at about 90 degree to each another.
Probab=98.84  E-value=2.4e-08  Score=56.06  Aligned_cols=39  Identities=21%  Similarity=0.305  Sum_probs=27.2

Q ss_pred             CCeeeecCCCCceeEEecCCcEEEEEEEecCCCCeeEEEecCCcc
Q psy15390          8 PPNILDTESTPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQP   52 (142)
Q Consensus         8 ~p~~~~~~~~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~   52 (142)
                      +|.+.+   .+ ...+.+|++|+|.|.... ....+.|++ +|..
T Consensus         1 kP~l~a---~p-~~vV~~G~~VTL~C~~~~-~~~~f~l~k-~g~~   39 (94)
T cd05711           1 KPFLSA---HP-SPVVPSGENVTLQCHSDI-RFDRFILYK-EGRS   39 (94)
T ss_pred             CCEEEe---cC-CCccCCCCeEEEEEecCC-CCCEEEEEE-CCCC
Confidence            356655   33 445779999999998754 445788999 5554


No 151
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. Ig_Pro_neuregulin-1: immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. There are many NRG-1 isoforms which arise from the alternative splicing of mRNA. NRG-1 belongs to the neuregulin gene family, which is comprised of four genes. This group represents NRG-1. NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, and heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. The NRG-1 protein binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates process
Probab=98.83  E-value=2.6e-08  Score=53.64  Aligned_cols=24  Identities=29%  Similarity=0.516  Sum_probs=20.9

Q ss_pred             ceEEEeecCCCCCeEEEEEEEecC
Q psy15390         67 EQLNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        67 ~~l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      +.|.|.+++..|+|.|+|.+.|..
T Consensus        44 ~~L~I~~~~~~DsG~Y~C~a~N~~   67 (76)
T cd05895          44 SELQISKASLADNGEYKCMVSSKL   67 (76)
T ss_pred             EEEEECcCCcccCEEEEEEEEeCC
Confidence            468999999999999999998754


No 152
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican. Ig_Versican: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, the CSPG aggrecan (not included in this group) forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Like aggrecan, versican has a wide distribution in connective tissue and extracellular matrices. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA
Probab=98.83  E-value=5.3e-07  Score=52.31  Aligned_cols=38  Identities=21%  Similarity=0.464  Sum_probs=30.7

Q ss_pred             ccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEEC
Q psy15390        104 YGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDVE  142 (142)
Q Consensus       104 ~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V~  142 (142)
                      ...+|.|.+++.+|+|.|.|++...... ....+.|.|+
T Consensus        77 g~asL~i~~v~~sD~G~Y~C~V~~g~~~-~~~~v~L~V~  114 (117)
T cd05901          77 GDASLTIVKLRASDAGVYRCEVMHGIED-TQDTVSLDVS  114 (117)
T ss_pred             CceEEEEcccccccCEEEEEEEEECCcc-cEEEEEEEEE
Confidence            4567999999999999999999987664 5667777663


No 153
>PHA03376 BARF1; Provisional
Probab=98.82  E-value=3.6e-07  Score=56.66  Aligned_cols=118  Identities=16%  Similarity=0.083  Sum_probs=66.2

Q ss_pred             CceeEEecCCcEEEEEEEecC---CCCeeEEEecCCc-----cee----------cCCcceEEe---eccceEEEeecCC
Q psy15390         18 PSSVAVREEFNITLTCKAEGF---PAPEIKWRREDNQ-----PIS----------INKRKKVHM---HYGEQLNITKISR   76 (142)
Q Consensus        18 ~~~~~~~~g~~v~l~C~~~~~---~~~~~~w~~~~~~-----~~~----------~~~~~~~~~---~~~~~l~i~~v~~   76 (142)
                      ...+.+..|+++.|+|.-...   ..-.|.|++ ++.     .+.          ...+.+..+   ..+-+|.|.+++.
T Consensus        18 g~pVta~VGEda~LsC~lnp~ssa~~MrIrWqK-s~p~~~~VvL~~~ggdVv~~QmEyRGrtD~~~~~gnvsLvI~~l~l   96 (221)
T PHA03376         18 GQAVTAFLGERVTLTSYWRRVSLGPEIEVSWFK-LGPGEEQVLIGRMHHDVIFIEWPFRGFFDIHRSANTFFLVVTAANI   96 (221)
T ss_pred             CcchhheeCCcEEEEecccCccCCCceEEEEEe-cCCCCCCEEEEEcCCeeeeeeeccccEEEEEecCCeEEEEEEeeee
Confidence            346678889999999997632   233689999 321     111          112233333   2223699999999


Q ss_pred             CCCeEEEEEEEecCCccEEEEEEEeccccceEEEcc---CCC-CCCeEEEEEEecCCCCCeeeEE
Q psy15390         77 TEMGAYLCIATKIGPLKIFWEIIFHMHYGEQLNITK---ISR-TEMGAYLCIATNNVPPSVSKRI  137 (142)
Q Consensus        77 ~d~G~y~C~~~~~~~~~~~w~~~~~~~~~~~l~i~~---~~~-~d~g~y~C~a~n~~~~~~s~~~  137 (142)
                      +|+|.|+|..+....- .+-.........-.|.+..   ... .+--+.+|.+.+.+.+..+|-.
T Consensus        97 SDdGtY~C~fQkge~~-~~k~ehLt~V~~~~Lsv~a~~~dFp~~~~~~i~C~sggfP~P~~~Wle  160 (221)
T PHA03376         97 SHDGNYLCRMKLGETE-VTKQEHLSVVKPLTLSVHSERSQFPDFSVLTVTCTVNAFPHPHVQWLM  160 (221)
T ss_pred             cCCceEEEEEEcCCCc-eeeeeeeeeeecceEEEEeccccCCCCCeeEEEEecCCcCCchheecc
Confidence            9999999998864321 1111111111111233322   011 2344789995556666777743


No 154
>PF07686 V-set:  Immunoglobulin V-set domain;  InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents the V-set domains, which are Ig-like domains resembling the antibody variable domain. V-set domains are found in diverse protein families, including immunoglobulin light and heavy chains; in several T-cell receptors such as CD2 (Cluster of Differentiation 2), CD4, CD80, and CD86; in myelin membrane adhesion molecules; in junction adhesion molecules (JAM); in tyrosine-protein kinase receptors; and in the programmed cell death protein 1 (PD1).; PDB: 1PY9_A 2NXY_D 1U9K_B 3RNK_A 3BP6_A 3BIK_B 3SBW_A 1NPU_A 3BP5_A 3RNQ_A ....
Probab=98.81  E-value=1.2e-07  Score=54.64  Aligned_cols=31  Identities=32%  Similarity=0.576  Sum_probs=25.6

Q ss_pred             CCceeEEecCCcEEEEEEEe-cCCCCeeEEEe
Q psy15390         17 TPSSVAVREEFNITLTCKAE-GFPAPEIKWRR   47 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~-~~~~~~~~w~~   47 (142)
                      .+..+.+.+|+++.|.|... ......+.|++
T Consensus         7 ~~~~v~~~~G~~v~L~C~~~~~~~~~~v~W~~   38 (114)
T PF07686_consen    7 PPSPVTVQEGESVTLPCSYSSSSNQSSVYWYR   38 (114)
T ss_dssp             EESEEEEETTSEEEEEEEEESSSSGSEEEEEE
T ss_pred             eCCeEEEecCCCEEEEEEEeCCCCcceEEEEE
Confidence            36678899999999999998 44555799998


No 155
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins. Ig1_Nectin-1_like: domain similar to the first immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111). Nectin-1 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. In addition nectins heterophilically trans-interact with other CAMs such as nectin-like molecules (Necls), nectin-1 for example, has been shown to trans-interact with Necl-1. Nectins also interact with various other proteins, including the actin filament (F-actin)-binding protein, afadin. Mutation in the human nectin-1 gene is 
Probab=98.80  E-value=4e-07  Score=51.52  Aligned_cols=39  Identities=10%  Similarity=0.290  Sum_probs=33.1

Q ss_pred             ccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEEC
Q psy15390        104 YGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDVE  142 (142)
Q Consensus       104 ~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V~  142 (142)
                      .+.+|.|.+++.+|+|.|+|.+.+.+....+..+.|.|.
T Consensus        61 ~daSi~i~nl~~~D~G~Y~C~v~t~P~g~~~~~~~L~V~   99 (99)
T cd05886          61 EDGTISLSRLELEDEGVYICEFATFPTGNRESQLNLTVY   99 (99)
T ss_pred             CcceEEEcCCccccCEEEEEEEEeCCCCCeEEEEEEEEC
Confidence            467899999999999999999999665557888888873


No 156
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig2_IL1R_like: domain similar to the second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R).  IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three IG-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta. This group also contains ILIR-like 1 (IL1
Probab=98.80  E-value=3.1e-08  Score=55.36  Aligned_cols=57  Identities=19%  Similarity=0.267  Sum_probs=41.7

Q ss_pred             CCCCCeEEEEEEEe-----cCCccEEEEEEEecc--------ccceEEEccCCCCCCeEEEEEEecCCCC
Q psy15390         75 SRTEMGAYLCIATK-----IGPLKIFWEIIFHMH--------YGEQLNITKISRTEMGAYLCIATNNVPP  131 (142)
Q Consensus        75 ~~~d~G~y~C~~~~-----~~~~~~~w~~~~~~~--------~~~~l~i~~~~~~d~g~y~C~a~n~~~~  131 (142)
                      .....+...|....     .+.+.+.|.+.....        ..+.|.|..+..+|+|.|+|.|.|..+.
T Consensus         8 ~~g~~~~l~Cp~~~~~~~~~~~p~i~Wyk~~~~i~~~~~~~~~~~~L~I~~v~~~DsG~YtC~~~n~~~~   77 (92)
T cd05757           8 FSTKGGKIVCPDLDDFKNENTLPPVQWYKDCKLLEGDRKRFVKGSKLLIQNVTEEDAGNYTCKLTFTHNG   77 (92)
T ss_pred             eeccCCEEECCChHHccCCCCCCcEEEeECCEECCCCccEEecCCEEEEeeCChhhCEEEEEEEEecCCC
Confidence            34556677886542     156789997532211        4578999999999999999999998765


No 157
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan. Ig_Neurocan: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, the CSPG aggrecan (not included in this group) forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Unlike aggrecan which is widely distributed in connective tissue and extracellular matrices, neurocan is localized almost exclusively in nervous tissue. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many differen
Probab=98.79  E-value=2e-07  Score=53.71  Aligned_cols=37  Identities=16%  Similarity=0.461  Sum_probs=29.4

Q ss_pred             ccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        104 YGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       104 ~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      ...+|.|.+++.+|+|.|.|.+...... ....+.|.|
T Consensus        70 ~~asL~i~nv~~~D~G~Y~C~v~~g~~~-~~~~v~L~V  106 (110)
T cd05902          70 YNASLVLSRLRYSDSGTYRCEVVLGIND-EQDTVPLEV  106 (110)
T ss_pred             ceEEEEECCCCHHHCEEEEEEEEECCcc-cEEEEEEEE
Confidence            4567999999999999999999975533 466677766


No 158
>cd04967 Ig1_Contactin First Ig domain of contactin. Ig1_Contactin: First Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 weeks postnata
Probab=98.79  E-value=1.1e-07  Score=53.08  Aligned_cols=58  Identities=26%  Similarity=0.342  Sum_probs=43.4

Q ss_pred             CCeEEEEEEEecCCccEEEEEEEecc----------ccceEEEccCCC-CCCeEEEEEEecCCCCCeee
Q psy15390         78 EMGAYLCIATKIGPLKIFWEIIFHMH----------YGEQLNITKISR-TEMGAYLCIATNNVPPSVSK  135 (142)
Q Consensus        78 d~G~y~C~~~~~~~~~~~w~~~~~~~----------~~~~l~i~~~~~-~d~g~y~C~a~n~~~~~~s~  135 (142)
                      ......|.+...+.+.++|.+.....          ..+.|.|.++.. +|+|.|+|.|.|..|...|.
T Consensus        20 ~~~~l~C~~~g~p~p~i~W~k~~~~l~~~~~~~~~~~~~~L~i~~~~~~~d~G~Y~C~a~N~~G~~~S~   88 (91)
T cd04967          20 GKVSLNCRARGSPPPTYRWLMNGTEIDDEPDSRYSLVGGNLVISNPSKAKDAGRYQCLASNIVGTVLSR   88 (91)
T ss_pred             CEEEEEEeeeEcCCCEEEEEECCEECCCCCCCCEEEECCEEEEecCCccCCCEEEEEEEEcCCCEEEec
Confidence            44678999988889999997632211          235788877764 89999999999999974443


No 159
>KOG3515|consensus
Probab=98.77  E-value=2.8e-08  Score=73.06  Aligned_cols=63  Identities=16%  Similarity=0.261  Sum_probs=43.5

Q ss_pred             EEecCCcEEEEEEEecCCC-CeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEec
Q psy15390         22 AVREEFNITLTCKAEGFPA-PEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        22 ~~~~g~~v~l~C~~~~~~~-~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      .+.+|++|.|.|.+.+.|+ ..+.|++ +++.+. +   +.....+.+|...+..+..-++|.|.+.|+
T Consensus        18 ~~~~g~~v~l~C~v~~~pp~~~~eW~h-~~~~~~-~---~~~~~~~~~~~~~~~~~~~~~~~~c~a~ns   81 (741)
T KOG3515|consen   18 GLRLGEDVPLPCRVNSNPPEIDVEWYH-STSGEH-G---RYATIADPTLVTTGDVRDTVAELNCRAFNS   81 (741)
T ss_pred             hhccCCcceeeeecCCCCCCcceEEEe-cCcccc-c---ccccccCCceeeecchhhhhhhhhhhhccc
Confidence            7888999999999987654 4799999 555443 1   111223345666777777777888877765


No 160
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain. IgV_L_lambda: Immunoglobulin (Ig) light chain, lambda type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=98.75  E-value=8.1e-08  Score=54.28  Aligned_cols=27  Identities=19%  Similarity=0.431  Sum_probs=21.5

Q ss_pred             EEecCCcEEEEEEEecC--CCCeeEEEec
Q psy15390         22 AVREEFNITLTCKAEGF--PAPEIKWRRE   48 (142)
Q Consensus        22 ~~~~g~~v~l~C~~~~~--~~~~~~w~~~   48 (142)
                      .+.+|++++|.|.....  ....+.||+.
T Consensus         2 ~v~~G~~v~l~C~~~~~~~~~~~i~Wy~q   30 (98)
T cd04984           2 SVSPGETVTITCTGSSGNISGNYVNWYQQ   30 (98)
T ss_pred             ccCCCCCEEEEEEEcCCCcCCCCEEEEEE
Confidence            46789999999998764  4457999983


No 161
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins. Ig3_Perlecan_like: domain similar to the third immunoglobulin (Ig)-like domain found in Perlecan. Perlecan is a large multi-domain heparin sulfate proteoglycan, important in tissue development and organogenesis.  Perlecan can be represented as 5 major portions; its fourth major portion (domain IV) is a tandem repeat of immunoglobulin-like domains (Ig2-Ig15), which can vary in size due to alternative splicing. Perlecan binds many cellular and extracellular ligands. Its domain IV region has many binding sites.  Some of these have been mapped at the level of individual Ig-like domains, including a site restricted to the Ig5 domain for heparin/sulfatide, a site restricted to the Ig3 domain for nidogen-1 and nidogen-2, a site restricted to Ig4-5 for fibronectin, and sites restricted to Ig2 and to Ig13-15 for fibulin-2.
Probab=98.75  E-value=7.8e-08  Score=52.88  Aligned_cols=65  Identities=17%  Similarity=0.398  Sum_probs=49.7

Q ss_pred             cCCCCCeEEEEEEEe-cCCccEEEEEEEe------ccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEE
Q psy15390         74 ISRTEMGAYLCIATK-IGPLKIFWEIIFH------MHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITV  139 (142)
Q Consensus        74 v~~~d~G~y~C~~~~-~~~~~~~w~~~~~------~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l  139 (142)
                      +...+.....|.+.. .+.+.+.|.+...      ....+.|.|..+..+|+|.|.|.|.|..|. .+..+.|
T Consensus        13 v~~G~~v~L~C~~~~~~~~~~i~W~~~~~~~~~~~~~~~~~L~I~~v~~~DsG~Y~C~a~n~~g~-~~~~~~l   84 (85)
T cd05754          13 VRPGADVSFICRAKSKSPAYTLVWTRVGGGLPSRAMDFNGILTIRNVQLSDAGTYVCTGSNMLDT-DEATATL   84 (85)
T ss_pred             EcCCCCEEEEEEcCCCCCCcEEEEEECCCcCCCcccccCCEEEECCCCHHHCEEEEEEEeccCCe-EeEEEEE
Confidence            456777889998864 5778899976321      223568999999999999999999999986 5555544


No 162
>PHA02987 Ig domain OX-2-like protein; Provisional
Probab=98.74  E-value=5.3e-07  Score=55.86  Aligned_cols=30  Identities=23%  Similarity=0.667  Sum_probs=24.1

Q ss_pred             ceeEEecCCcEEEEEEEe-cCCCCeeEEEec
Q psy15390         19 SSVAVREEFNITLTCKAE-GFPAPEIKWRRE   48 (142)
Q Consensus        19 ~~~~~~~g~~v~l~C~~~-~~~~~~~~w~~~   48 (142)
                      ..+++.+|++++|.|... +...+++.|++.
T Consensus        23 ~~v~V~ege~VtLsCs~t~s~~~~qVtWkK~   53 (189)
T PHA02987         23 VKITVSEHVNVKISCNKTSSFNSILITWKKN   53 (189)
T ss_pred             EEEEEcCCCCEEEEEecCCCCccceEEEEEc
Confidence            356889999999999974 445668999983


No 163
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins. Ig5_KIRREL3-like: domain similar to the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=98.73  E-value=1.4e-07  Score=53.29  Aligned_cols=27  Identities=19%  Similarity=0.289  Sum_probs=21.3

Q ss_pred             cCCCCCeEEEEEEEecCCc-cEEEEEEE
Q psy15390         74 ISRTEMGAYLCIATKIGPL-KIFWEIIF  100 (142)
Q Consensus        74 v~~~d~G~y~C~~~~~~~~-~~~w~~~~  100 (142)
                      +...+.....|.+...+.+ .+.|.+..
T Consensus        13 ~~~G~~v~L~C~~~g~P~P~~v~W~~~~   40 (98)
T cd05758          13 AILGDKGRVECFIFSTPPPDRIVWTWKE   40 (98)
T ss_pred             EeCCCcEEEEEEEcccCCCCEeEEEECC
Confidence            4567888899999988887 59997643


No 164
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Ig1_Necl-3: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-3, Necl-3 (also known as cell adhesion molecule 2 (CADM2), SynCAM2, IGSF4D).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses.  Necl-3 accumulates in central and peripheral nervous system tissue, and has been shown to selectively interact with oligodendrocytes.
Probab=98.73  E-value=2.5e-07  Score=51.99  Aligned_cols=66  Identities=12%  Similarity=0.234  Sum_probs=48.9

Q ss_pred             cCCCCCeEEEEEEEecCCccEEEEE-----------------EEec----cccceEEEccCCCCCCeEEEEEEecCCCCC
Q psy15390         74 ISRTEMGAYLCIATKIGPLKIFWEI-----------------IFHM----HYGEQLNITKISRTEMGAYLCIATNNVPPS  132 (142)
Q Consensus        74 v~~~d~G~y~C~~~~~~~~~~~w~~-----------------~~~~----~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~  132 (142)
                      +...++....|.+.+.+.+.+.|.+                 .+..    .....|.|.++..+|+|.|+|.+.+.++  
T Consensus         9 v~eG~~v~L~C~~~~~p~~~v~W~~~~~~~l~~~~~~~~~~~r~~~~~~~~~~~sL~I~~v~~~DsG~Y~C~~~t~~~--   86 (95)
T cd07701           9 VVEGGTANLTCRVDQNDNTSLQWSNPAQQTLYFDDKKALRDNRIELVRASWHELSISISDVSLSDEGQYTCSLFTMPV--   86 (95)
T ss_pred             EecCCcEEEEEEEecCCceEEEEeCCCCeEEEEcCcccccCCCEEEEECCCCcEEEEECcCCcccCEEEEEEeEeecC--
Confidence            4556777889999988888999952                 1111    1235789999999999999999998544  


Q ss_pred             eeeEEEEEE
Q psy15390        133 VSKRITVDV  141 (142)
Q Consensus       133 ~s~~~~l~V  141 (142)
                      .++...|.|
T Consensus        87 ~~~~~~l~v   95 (95)
T cd07701          87 KTSKAYLTV   95 (95)
T ss_pred             ccEEEEEEC
Confidence            366676665


No 165
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain. IgV_TCR_delta: immunoglobulin (Ig) variable (V) domain of the delta chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is
Probab=98.73  E-value=1.7e-07  Score=54.59  Aligned_cols=32  Identities=25%  Similarity=0.400  Sum_probs=25.6

Q ss_pred             CCceeEEecCCcEEEEEEEecC-CCCeeEEEec
Q psy15390         17 TPSSVAVREEFNITLTCKAEGF-PAPEIKWRRE   48 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~~-~~~~~~w~~~   48 (142)
                      .+..+.+.+|++|+|+|..... ....+.||+.
T Consensus         5 ~~~~v~~~~G~~v~L~C~~~~~~~~~~v~Wyrq   37 (116)
T cd07706           5 AQPDVSVQVGEEVTLNCRYETSWTNYYIFWYKQ   37 (116)
T ss_pred             eCCceEEcCCCCEEEEEEEeCCCCceEEEEEEE
Confidence            5667789999999999998753 3457899983


No 166
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Ig_Siglec_N: immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Siglec refers to a structurally related protein family that specifically recognizes sialic acid in oligosaccharide chains of glycoproteins and glycolipids. Siglecs are type I transmembrane proteins, organized as an extracellular module composed of Ig-like domains (an N-terminal variable set of Ig-like carbohydrate recognition domains, and 1 to 16 constant Ig-like domains), followed by transmembrane and short cytoplasmic domains. Human siglecs are classified into two subgroups, one subgroup is comprised of sialoadhesin (Siglec-1), CD22 (Siglec-2), and MAG, the other subgroup is comprised of CD33-related Siglecs which include CD33 (Siglec-3) and human Siglecs 5-11.
Probab=98.72  E-value=3.9e-07  Score=53.39  Aligned_cols=32  Identities=22%  Similarity=0.368  Sum_probs=24.1

Q ss_pred             CCceeEEecCCcEEEEEEEecCC------CCeeEEEec
Q psy15390         17 TPSSVAVREEFNITLTCKAEGFP------APEIKWRRE   48 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~~~------~~~~~w~~~   48 (142)
                      .|+.+.+.+|++|+|+|......      ...+.||+.
T Consensus         5 ~P~~v~~~~G~~VtL~C~f~~~~~~~~~~~~~~~Wykq   42 (119)
T cd05712           5 MPKSVSVQEGLCVLIPCSFSYPADWPVSNGVHGIWYKG   42 (119)
T ss_pred             CCCEEEEeccccEEEEEEeeCcccccCCCceEEEEEeC
Confidence            56677889999999999875332      235889984


No 167
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2). Ig2_IL1R2_like: domain similar to the second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds the type II (IL1R2) represented in this group. Mature IL1R2 consists of three IG-like domains, a transmembrane domain, and a short cytoplasmic domain. It lacks the large cytoplasmic domain of Mature IL1R1, and does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta.
Probab=98.66  E-value=1.2e-07  Score=53.15  Aligned_cols=67  Identities=15%  Similarity=0.255  Sum_probs=46.9

Q ss_pred             CCCCCeEEEEEE---E--ecCCccEEEEEEEec-----------cccceEEEccCCCCCCeEEEEEEecCCCC---Ceee
Q psy15390         75 SRTEMGAYLCIA---T--KIGPLKIFWEIIFHM-----------HYGEQLNITKISRTEMGAYLCIATNNVPP---SVSK  135 (142)
Q Consensus        75 ~~~d~G~y~C~~---~--~~~~~~~~w~~~~~~-----------~~~~~l~i~~~~~~d~g~y~C~a~n~~~~---~~s~  135 (142)
                      ....+|...|.-   .  +...+.+.|.+.-..           .....|.|.++..+|+|.|+|.|.+..+.   .++.
T Consensus         8 ~~~~~~~l~Cp~~~~f~~~~~~~~v~WYKd~~~l~~~~~~~~~~~~~~~L~I~~v~~~D~G~YtC~~~~~~~g~~y~vtr   87 (95)
T cd05897           8 FTSTSGKLVCPDLSDFTINRTDVELQWYKDSVLLDKDNEKFYSLKGSTYLHIIDVSLNDSGYYTCKLQFTHEGKKYNITR   87 (95)
T ss_pred             ccccCcEEECCCHHHcccCCCCCcEEEccCCEECcCCCcceEecCCCCEEEEEEcChhhCEEEEEEEEEeeCCEEEEEEE
Confidence            345567778852   1  346678999753221           23457999999999999999999997654   4566


Q ss_pred             EEEEEE
Q psy15390        136 RITVDV  141 (142)
Q Consensus       136 ~~~l~V  141 (142)
                      .+.|.|
T Consensus        88 ~~~l~v   93 (95)
T cd05897          88 IIKLRI   93 (95)
T ss_pred             EEEEEE
Confidence            666665


No 168
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Ig2_Necl-2: second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Nectin-like molecules (Necls) have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Necl-2 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is expressed in a wide variety of tissues, and is a putative tumour suppressor gene, which is downregulated in aggressive neuroblastoma. Ig domains are likely to participate in ligand binding and recognition.
Probab=98.65  E-value=8.2e-07  Score=48.29  Aligned_cols=25  Identities=36%  Similarity=0.765  Sum_probs=20.6

Q ss_pred             EEEEEEEec-CCCCeeEEEecCCccee
Q psy15390         29 ITLTCKAEG-FPAPEIKWRREDNQPIS   54 (142)
Q Consensus        29 v~l~C~~~~-~~~~~~~w~~~~~~~~~   54 (142)
                      +.|.|.+.+ .|.+.|.||+ +++.+.
T Consensus         2 ~~L~C~s~gSkP~A~I~W~k-~~~~l~   27 (82)
T cd05883           2 IELNCTAMASKPAATIRWFK-GNKELT   27 (82)
T ss_pred             EEEEEEecCCCCCCEEEEEE-CCEECc
Confidence            689999876 6778999999 887764


No 169
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain. IgV_CD8_beta: immunoglobulin (Ig)-like domain in CD8 beta. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alpha/alpha or alpha/beta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a V-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain.
Probab=98.64  E-value=1.6e-06  Score=49.80  Aligned_cols=27  Identities=30%  Similarity=0.599  Sum_probs=21.4

Q ss_pred             EEecCCcEEEEEEEecC-CCCeeEEEec
Q psy15390         22 AVREEFNITLTCKAEGF-PAPEIKWRRE   48 (142)
Q Consensus        22 ~~~~g~~v~l~C~~~~~-~~~~~~w~~~   48 (142)
                      .+.+|++++|.|..... ....+.||+.
T Consensus         2 ~v~~G~~vtL~C~~~~~~~~~~~~Wyrq   29 (107)
T cd07700           2 LVQTNNTVKLSCEAKGISENTRIYWLRW   29 (107)
T ss_pred             EEcCCCCEEEEEEEecCCCCCeEEEEEE
Confidence            57889999999998653 3447999984


No 170
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin. Ig_Semaphorin_class III; Immunoglobulin (Ig)-like domain of class III semaphorins. Semaphorins are classified into various classes on the basis of structural features additional to the Sema domain. Class III semaphorins are a vertebrate class having a Sema domain, an Ig domain, a short basic domain, and are secreted. They have been shown to be axonal guidance cues and have a part in the regulation of the cardiovascular, immune and respiratory systems. Sema3A, the prototype member of this class III subfamily, induces growth cone collapse and is an inhibitor of axonal sprouting. In perinatal rat cortex as a chemoattractant, it functions to direct, for pyramidal neurons, the orientated extension of apical dendrites. It may play a role, prior to the development of apical dendrites, in signaling the radial migration of newborn cortical neurons towards the upper layers. Sema3A selectively inhibits vascula
Probab=98.61  E-value=5.3e-07  Score=50.29  Aligned_cols=63  Identities=17%  Similarity=0.347  Sum_probs=43.9

Q ss_pred             CCCeEEEEEEEecCCccEEEEEEE--------------eccccceEEEccCCCCCCeEEEEEEec-CCCCCeeeEEEEEE
Q psy15390         77 TEMGAYLCIATKIGPLKIFWEIIF--------------HMHYGEQLNITKISRTEMGAYLCIATN-NVPPSVSKRITVDV  141 (142)
Q Consensus        77 ~d~G~y~C~~~~~~~~~~~w~~~~--------------~~~~~~~l~i~~~~~~d~g~y~C~a~n-~~~~~~s~~~~l~V  141 (142)
                      .++-...|... .+.+.++|.+..              .....+.|.|.++..+|+|.|+|.|.| ..+. ....++|.|
T Consensus        11 G~~v~L~C~~~-~p~p~v~Wykq~~g~~~~~~~~~~~r~~~~~~~L~I~~~~~~DsG~Y~C~a~~~~~~~-~~~~~~l~v   88 (91)
T cd05871          11 NNSTFLECLPK-SPQASVKWLFQRGGDQRKEEVKTEERLIHTERGLLLRSLQRSDAGVYTCTAVEHSFSQ-TLAKYTLHV   88 (91)
T ss_pred             CCcEEEEEECC-CCCceEEEEEECCCCCccccccccccEEEecCeEEEeeCChhHCEEEEEEEEccCCeE-EEEEEEEEE
Confidence            44556788764 677788997521              111245699999999999999999985 5543 445777776


No 171
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively). Ig2_Necl-1-4_like: domain similar to the second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), Necl-3 (CADM2) and Necl-4 (CADM4). These nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 and Necl-2 have Ca(2+)-independent homophilic and heterophilic cell-cel
Probab=98.60  E-value=1.7e-06  Score=47.21  Aligned_cols=25  Identities=32%  Similarity=0.840  Sum_probs=20.3

Q ss_pred             EEEEEEEecC-CCCeeEEEecCCccee
Q psy15390         29 ITLTCKAEGF-PAPEIKWRREDNQPIS   54 (142)
Q Consensus        29 v~l~C~~~~~-~~~~~~w~~~~~~~~~   54 (142)
                      +.|.|.+.+. |.+.+.|++ +++.+.
T Consensus         2 ~~L~C~~~~~~P~~~v~W~~-~~~~l~   27 (82)
T cd05761           2 VELTCTSSGSKPAATIRWFK-GDKELK   27 (82)
T ss_pred             EEEEEEecCcCcCCeEEEEE-CCEEcc
Confidence            6899999774 777999999 777663


No 172
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). Ig_pIgR: Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). pIgR delivers dimeric IgA and pentameric IgM to mucosal secretions. Polymeric immunoglobulin (pIgs) are the first defense against pathogens and toxins. IgA and IgM can form polymers via an 18-residue extension at their c-termini referred to as the tailpiece. pIgR transports pIgs across mucosal epithelia into mucosal secretions. Human pIgR is a glycosylated type I transmembrane protein, comprised of a 620 residue extracellular region, a 23 residue transmembrane region, and a 103 residue cytoplasmic tail. The extracellular region contains five domains that share sequence similarity with Ig variable (v) regions.
Probab=98.57  E-value=3.5e-07  Score=51.64  Aligned_cols=28  Identities=18%  Similarity=0.146  Sum_probs=21.7

Q ss_pred             eEEecCCcEEEEEEEec-CCCCeeEEEec
Q psy15390         21 VAVREEFNITLTCKAEG-FPAPEIKWRRE   48 (142)
Q Consensus        21 ~~~~~g~~v~l~C~~~~-~~~~~~~w~~~   48 (142)
                      +.+.+|++++|.|.... .....+.|++.
T Consensus         2 v~~~~G~~vtl~C~~~~~~~~~~~~W~r~   30 (98)
T cd05716           2 VTGELGGSVTIPCPYPPKNRSYEKYWCKW   30 (98)
T ss_pred             EEEEeCCeEEEEeeCCCCCCCcEeEeECC
Confidence            46788999999998765 34557899983


No 173
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins. Ig1_DNAM-1_like: domain similar to the first immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226). DNAM-1 is a transmembrane protein having two Ig-like domains. It is an adhesion molecule which plays a part in tumor-directed cytotoxicity and adhesion in natural killer (NK) cells and T lymphocytes. It has been shown to regulate the NK cell killing of several tumor types, including myeloma cells and ovarian carcinoma cells. DNAM-1 interacts specifically with poliovirus receptor (PVR; CD155) and nectin -2 (CD211), other members of the Ig superfamily. DNAM-1 is expressed in most peripheral T cells, NK cells, monocytes and a subset of B lymphocytes.
Probab=98.57  E-value=5.5e-06  Score=46.58  Aligned_cols=35  Identities=20%  Similarity=0.275  Sum_probs=27.3

Q ss_pred             ccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEE
Q psy15390        104 YGEQLNITKISRTEMGAYLCIATNNVPPSVSKRIT  138 (142)
Q Consensus       104 ~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~  138 (142)
                      .+.++.|.+++.+|+|.|+|.....+.......+.
T Consensus        58 ~d~sI~i~nvt~~D~G~Y~C~~~t~P~g~~~~~i~   92 (96)
T cd05889          58 EDMSLSFNNATEEDVGLYCCSLVTYPQGSWEKVIE   92 (96)
T ss_pred             CccEEEEcCCCcccCEEEEEEEEeCCCCCeEEEEE
Confidence            45679999999999999999999876544444443


No 174
>cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). Ig2_Necl-1: second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). These nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 and Necl-2 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue and is important to the formation of synapses, axon bundles, and myel
Probab=98.56  E-value=3.6e-06  Score=46.09  Aligned_cols=25  Identities=40%  Similarity=0.897  Sum_probs=20.6

Q ss_pred             EEEEEEEecC-CCCeeEEEecCCccee
Q psy15390         29 ITLTCKAEGF-PAPEIKWRREDNQPIS   54 (142)
Q Consensus        29 v~l~C~~~~~-~~~~~~w~~~~~~~~~   54 (142)
                      +.|.|.+.+. |.+.+.|++ +|+.+.
T Consensus         2 ~~LtC~a~g~~P~~~ItW~k-~g~~l~   27 (83)
T cd07705           2 AKLRCTSSGSKPAANIKWRK-GDQELE   27 (83)
T ss_pred             EEEEEEecCccCCCEeEEEE-CCEECC
Confidence            6899999884 777999999 887664


No 175
>smart00408 IGc2 Immunoglobulin C-2 Type.
Probab=98.54  E-value=7.2e-07  Score=45.47  Aligned_cols=53  Identities=25%  Similarity=0.296  Sum_probs=39.8

Q ss_pred             CCeEEEEEEEecCCccEEEEEEE--------eccccceEEEccCCCCCCeEEEEEEecCCC
Q psy15390         78 EMGAYLCIATKIGPLKIFWEIIF--------HMHYGEQLNITKISRTEMGAYLCIATNNVP  130 (142)
Q Consensus        78 d~G~y~C~~~~~~~~~~~w~~~~--------~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~  130 (142)
                      +.....|.+...+.+.+.|.+..        .......|.|.++...|+|.|+|.+.|..|
T Consensus         3 ~~~~l~C~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~L~i~~~~~~d~G~Y~C~~~n~~g   63 (63)
T smart00408        3 QSVTLTCPAEGDPVPNITWLKDGKPLPESNRLSASGSTLTIKSVSLEDSGEYTCVAENSAG   63 (63)
T ss_pred             ceEEEEeeCccCCCCeEEEEECCEECCCCCEEecCCcEEEEeeCCcccCEEEEEEEecCCC
Confidence            34557788766777889997532        123456799999999999999999998754


No 176
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain. IgV_H: Immunoglobulin (Ig) heavy chain (H), variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin: IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which can associate with any of the heavy chains. This family includes alpha, gamma, delta, epsilon, and mu heavy chains.
Probab=98.53  E-value=1.1e-06  Score=51.38  Aligned_cols=32  Identities=28%  Similarity=0.613  Sum_probs=24.4

Q ss_pred             CCceeEEecCCcEEEEEEEecCC--CCeeEEEec
Q psy15390         17 TPSSVAVREEFNITLTCKAEGFP--APEIKWRRE   48 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~~~--~~~~~w~~~   48 (142)
                      .+....+.+|++++|.|......  ...+.||+.
T Consensus         3 ~~~~~~v~~G~~vtL~C~~~~~~~~~~~~~WYkQ   36 (117)
T cd04981           3 ESGPGLVKPGQSLKLSCKASGFTFTSYGVNWVRQ   36 (117)
T ss_pred             cCCCeEEcCCCCEEEEEEEeCCCcccceEEEEEE
Confidence            45567889999999999876433  346899983


No 177
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain. IgC_Tapasin_R: Immunoglobulin-like domain on Tapasin-R. Tapasin is a V-C1 (variable-constant) immunoglobulin superfamily molecule present in the endoplasmic reticulum (ER), where it links MHC class I molecules to the transporter associated with antigen processing (TAP). Tapasin-R is a tapasin-related protein that contains similar structural motifs to Tapasin, with some marked differences, especially in the V domain, transmembrane and cytoplasmic regions. The majority of Tapasin-R is located within the ER; however, there may be some expression of Tapasin-R at the cell surface. Tapasin-R lacks an obvious ER retention signal.
Probab=98.48  E-value=7.3e-06  Score=49.26  Aligned_cols=44  Identities=25%  Similarity=0.469  Sum_probs=31.3

Q ss_pred             cccCCCeeeecCCCCceeEEecCCcEEEEEEEecC-CC-CeeEEEecCCc
Q psy15390          4 YKSVPPNILDTESTPSSVAVREEFNITLTCKAEGF-PA-PEIKWRREDNQ   51 (142)
Q Consensus         4 ~~~~~p~~~~~~~~~~~~~~~~g~~v~l~C~~~~~-~~-~~~~w~~~~~~   51 (142)
                      .+..+|.+..   .+......+|+.+.|.|.+.+. |. ..+.|++ ++.
T Consensus        34 ~v~~~P~v~~---~~~~~~~~~~~~~~L~C~a~g~~P~~~~i~W~~-~g~   79 (139)
T cd05771          34 SVSEPPRVRL---SLEKLVSMIEEPQTLICHIAGYYPLDVQVEWTR-EPP   79 (139)
T ss_pred             EEecCCceEE---eCCCceeecCCcEEEEEEECCCCCCCeEEEEEE-CCC
Confidence            3456777765   4444455578999999999985 43 4799999 654


No 178
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain. Ig_CD8_alpha: immunoglobulin (Ig)-like domain in CD8 alpha. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alphaalpha or alphabeta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a v-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain. The Ig domain of CD8 alpha binds to antibodies.
Probab=98.48  E-value=1.2e-06  Score=50.13  Aligned_cols=27  Identities=11%  Similarity=0.236  Sum_probs=21.3

Q ss_pred             EEecCCcEEEEEEEecCCCCeeEEEec
Q psy15390         22 AVREEFNITLTCKAEGFPAPEIKWRRE   48 (142)
Q Consensus        22 ~~~~g~~v~l~C~~~~~~~~~~~w~~~   48 (142)
                      .+.+|++|+|.|.........+.||+.
T Consensus         2 ~v~~G~~vtL~C~~~~~~~~~v~Wyrq   28 (104)
T cd05720           2 DAELGQKVELKCEVLNSSPTGCSWLFQ   28 (104)
T ss_pred             cccCCCeEEEEEEecCCCCCcEEEEEe
Confidence            357899999999986554557999994


No 179
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively). Ig1_Necl-1-3_like:  N-terminal immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), and Necl-3 (CADM2). At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1, Necl-2, and Necl-3 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the form
Probab=98.46  E-value=2.7e-06  Score=47.70  Aligned_cols=22  Identities=23%  Similarity=0.564  Sum_probs=13.7

Q ss_pred             eEEEeecCCCCCeEEEEEEEec
Q psy15390         68 QLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        68 ~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      .|.|.+++.+|+|.|.|.+.+.
T Consensus        63 ~L~I~~v~~~DsG~Y~C~~~~~   84 (95)
T cd05717          63 SISISNVSLSDEGRYTCSLYTM   84 (95)
T ss_pred             EEEEccCCcccCEEEEEEEecC
Confidence            4666666666666666665543


No 180
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of  intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins. Ig2_ ICAM-1_like: domain similar to the second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54). During the inflammation process, these molecules recruit leukocytes onto the vascular endothelium before extravasation to the injured tissues. ICAM-1 may be involved in organ targeted tumor metastasis. The interaction of ICAM-1 with leukocyte function-associated antigen-1 (LFA-1) plays a part in leukocyte-endothelial cell recognition. This group also contains ICAM-2, which also interacts with LFA-1. Transmigration of immature dendritic cells across resting endothelium is dependent on the interaction of ICAM-2 with, yet unidentified, ligand(s) on the dendritic cells. ICAM-1 has five Ig-like domains and ICAM-2 has two. ICAM-1 may also act as host receptor for viruses and parasites.
Probab=98.41  E-value=2.9e-06  Score=47.94  Aligned_cols=37  Identities=27%  Similarity=0.375  Sum_probs=27.9

Q ss_pred             CCceeEEecCCcEEEEEEEec-CCCCe--eEEEecCCccee
Q psy15390         17 TPSSVAVREEFNITLTCKAEG-FPAPE--IKWRREDNQPIS   54 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~-~~~~~--~~w~~~~~~~~~   54 (142)
                      .+.+..+.+|+.++|.|.+.+ .|.+.  +.||+ ++..+.
T Consensus         7 ~~~p~~~~eG~~~tL~C~v~g~~P~a~L~i~W~r-G~~~l~   46 (100)
T cd05755           7 SPLPSWQPVGKNYTLQCDVPGVAPRQNLTVVLLR-GNETLS   46 (100)
T ss_pred             ecCCCcccCCCcEEEEEEEcCcCCCCcEEEEEee-CCEEcc
Confidence            444445689999999999977 55655  69999 777664


No 181
>cd00098 IgC Immunoglobulin Constant domain. IgC: Immunoglobulin constant domain (IgC). Members of the IgC family are components of immunoglobulin, T-cell receptors, CD1 cell surface glycoproteins, secretory glycoproteins A/C, and Major Histocompatibility Complex (MHC) class I/II molecules. In immunoglobulins, each chain is composed of one variable domain (IgV) and one or more IgC domains. These names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. The IgV domain is responsible for antigen binding, and the IgC domain is involved in oligomerization and molecular interactions.
Probab=98.40  E-value=1.1e-06  Score=49.25  Aligned_cols=31  Identities=29%  Similarity=0.602  Sum_probs=25.0

Q ss_pred             ecCCcEEEEEEEecC-C-CCeeEEEecCCcceec
Q psy15390         24 REEFNITLTCKAEGF-P-APEIKWRREDNQPISI   55 (142)
Q Consensus        24 ~~g~~v~l~C~~~~~-~-~~~~~w~~~~~~~~~~   55 (142)
                      ..|+.+.|.|.+.+. | ...+.|++ +|..+..
T Consensus        11 ~~~~~~~L~C~a~g~~P~~~~i~W~~-~g~~~~~   43 (95)
T cd00098          11 LLGGSVTLTCLATGFYPPDITVTWLK-NGKELTS   43 (95)
T ss_pred             HcCCCeEEEEEEeeEECCCcEEEEEE-CCEECCC
Confidence            468999999999996 4 35799999 8877643


No 182
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D. Ig_Sema4D_like; Immunoglobulin (Ig)-like domain of Sema4D. Sema4D is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4D has extracellular Sema and Ig domains, a transmembrane domain, and a short cytoplasmic domain. Sema4D plays a part in the development of GABAergic synapses. Sema4D in addition is an immune semaphorin. It is abundant on resting T cells; its expression is weak on resting B cells and antigen presenting cells (APCs), but is upregulated by various stimuli. The receptor used by Sema4D in the immune system is CD72. Sem4D enhances the activation of B cells and DCs through binding CD72, perhaps by reducing CD72s inhibitory signals. The receptor used by Sema4D in the non-lymphatic tissues is plexin-B1. Sem4D is anchored to the cell surface but its extracellular domain can be released from the cell surface by a metalloproteas
Probab=98.37  E-value=1.2e-06  Score=48.31  Aligned_cols=54  Identities=17%  Similarity=0.375  Sum_probs=39.9

Q ss_pred             CCCCCeEEEEEEEecCCccEEEEEEEe---------ccccceEEEccCCCCCCeEEEEEEecCC
Q psy15390         75 SRTEMGAYLCIATKIGPLKIFWEIIFH---------MHYGEQLNITKISRTEMGAYLCIATNNV  129 (142)
Q Consensus        75 ~~~d~G~y~C~~~~~~~~~~~w~~~~~---------~~~~~~l~i~~~~~~d~g~y~C~a~n~~  129 (142)
                      ...++....|.+.. +.+.+.|.+...         ....+.|.|.+++.+|+|.|+|.|.+..
T Consensus         9 ~~G~~v~L~C~~~~-~~~~i~W~~ng~~i~~~~~r~~~~~~~L~I~nv~~~DsG~Y~C~a~e~~   71 (87)
T cd05873           9 KLGNNAELKCSPKS-NLARVVWKFDGKVLTPESAKYLLYRDGLLIFNASEADAGRYQCLSVEKS   71 (87)
T ss_pred             ECCCCEEEEEECCC-CCCeEEEEECCEECCCCCceEEEECCcEEEeCCCHHHCEEEEEEEEecc
Confidence            34566678898753 567899976421         1224579999999999999999999764


No 183
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. Ig2_CD4; second immunoglobulin (Ig) domain of CD4.  CD4 and CD8 are the two primary co-receptor proteins found on the surface of T cells, and the presence of either CD4 or CD8 determines the function of the T cell.  CD4 is found on helper T cells, where it is required for the binding of MHC (major histocompatibility complex) class II molecules, while CD8 is found on cytotoxic T cells, where it is required for the binding of MHC class I molecules.  CD4 contains four immunoglobulin domains, with the first three included in this hierarchy.  The fourth domain has a general Ig architecture, but has slight topological changes in the arrangement of beta strands relative to the other structures in this family and is not specifically included in the hierarchy.
Probab=98.35  E-value=4.7e-06  Score=45.52  Aligned_cols=61  Identities=25%  Similarity=0.438  Sum_probs=39.1

Q ss_pred             eEEecCCcEEEEEEEecCCCC--eeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEE
Q psy15390         21 VAVREEFNITLTCKAEGFPAP--EIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIAT   87 (142)
Q Consensus        21 ~~~~~g~~v~l~C~~~~~~~~--~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~   87 (142)
                      ..+..|++++|.|.....+.|  .+.|..+.++....      ......+|.+.++...|+|..+|.+.
T Consensus         9 ~~lL~G~sLtLtl~~~s~s~p~~~i~w~~P~n~~~~~------~~~~~ktL~~~qv~~qdSG~WtC~V~   71 (88)
T cd07694           9 DHVLSGTNLTLTLHGSSNSLPAFKVEWRGPGNKSKQI------LNQDKKTLNLVQLGPNDSGTWDCIVS   71 (88)
T ss_pred             CeeecCCcEEEEEecCCCCCCCccEEEeCCCCcccee------ccCCccEEEeceeCcccCCEEEEEEE
Confidence            356789999999998664444  89999865543321      12233456666666666666666553


No 184
>cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain. IgC_SIRP: Immunoglobulin-like domain of signal-regulatory proteins (SIRP); the signal-regulatory proteins (SIRP) are Ig-like cell surface receptors detected in hematopoietic and non-hematopoietic cells. While their extracellular domains are similar, SIRP are classified as alpha or beta based on the length of the intracytoplasmic domain.  Those having a 110- to 113-amino acid tail are classified as SIRP-alpha, and those having a 5-amino acid tail as SIRP-beta. SIRP-alpha and SIRP-beta molecules are thought to have complementary roles in signal regulation:  SIRP-alpha inhibit signalling via their immunoreceptor tyrosine (IT)-based inhibition motifs while SIRP-beta are activating.  SIRP-beta lack the cytoplasmic domainof SIRP-alpha, and associate with at least one other transmembrane protein (DAP-12 or KARAP). The IT-based activation motifs within DAP-12's cytoplasmic domain may link SIRP-beta to the activating 
Probab=98.32  E-value=9.7e-06  Score=46.84  Aligned_cols=47  Identities=21%  Similarity=0.447  Sum_probs=31.5

Q ss_pred             ccCCCeeeecCCCCceeEEecCCcEEEEEEEecCCC--CeeEEEecCCccee
Q psy15390          5 KSVPPNILDTESTPSSVAVREEFNITLTCKAEGFPA--PEIKWRREDNQPIS   54 (142)
Q Consensus         5 ~~~~p~~~~~~~~~~~~~~~~g~~v~l~C~~~~~~~--~~~~w~~~~~~~~~   54 (142)
                      +.++|.....  .........|+.++|.|.+.+..+  ..+.|++ ||+.+.
T Consensus         2 v~~~P~~p~i--~~~~~~~~~g~~~tL~C~a~gF~P~~i~v~W~k-ng~~~~   50 (111)
T cd05772           2 VRAKPSVPVV--SGPSGRANPGQSVNFTCSAHGFSPRDITVKWLK-NGNELS   50 (111)
T ss_pred             cccCCCCcEe--CCchhccCCCCCEEEEEEEeeEeCCCCEEEEEE-CCEECc
Confidence            4455554432  223334557888999999998433  4789999 888764


No 185
>PF00047 ig:  Immunoglobulin domain The Prosite family only concerns antibodies and MHCs.;  InterPro: IPR013151 Members of the immunoglobulin superfamily are found in hundreds of proteins of different functions. Examples include antibodies, the giant muscle kinase titin and receptor tyrosine kinases. Immunoglobulin-like domains may be involved in protein-protein and protein-ligand interactions. The Pfam alignments do not include the first and last strand of the immunoglobulin-like domain.; PDB: 1B6U_A 3O4O_C 3VH8_H 1BIH_A 2C9A_A 2V5Y_A 1BQH_K 2ATP_A 3B9K_A 1NEZ_H ....
Probab=98.30  E-value=6.8e-06  Score=42.44  Aligned_cols=47  Identities=17%  Similarity=0.398  Sum_probs=34.4

Q ss_pred             CeEEEEEE-EecCCccEEEEEE----------Eeccccc----eEEEccCCCCCCeEEEEEE
Q psy15390         79 MGAYLCIA-TKIGPLKIFWEII----------FHMHYGE----QLNITKISRTEMGAYLCIA  125 (142)
Q Consensus        79 ~G~y~C~~-~~~~~~~~~w~~~----------~~~~~~~----~l~i~~~~~~d~g~y~C~a  125 (142)
                      +-...|.+ ...+...+.|.+.          .......    .|.|.+++.+|+|+|+|.|
T Consensus         3 ~v~L~C~~~~~~~~~~~~W~~~~~~~~~~~~~~~~~~~~~~~~~L~i~~v~~~d~G~Y~C~v   64 (64)
T PF00047_consen    3 SVTLTCSVSSGPPPTTVTWSKNGQSLPEGSTTNRSTNSVSSTSRLTISNVTPEDSGTYTCVV   64 (64)
T ss_dssp             EEEEEEEEEESSSTSEEEEEETTTTTSEEEEEEEEETTTEEEEEEEESSCTGGGTEEEEEEE
T ss_pred             eEEEEeecCCCCCCcEEEEEECCccccCcceeEeecccceeeeEEEEccCCHHHCEEEEEEC
Confidence            34678999 6778889999742          1111111    2999999999999999986


No 186
>cd00096 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as, T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as, butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=98.29  E-value=3.9e-06  Score=43.32  Aligned_cols=59  Identities=29%  Similarity=0.638  Sum_probs=31.1

Q ss_pred             EEEEEEEecCCCCeeEEEecCCcceecCCcc-----eEEeeccceEEEeecCCCCCeEEEEEEEe
Q psy15390         29 ITLTCKAEGFPAPEIKWRREDNQPISINKRK-----KVHMHYGEQLNITKISRTEMGAYLCIATK   88 (142)
Q Consensus        29 v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~-----~~~~~~~~~l~i~~v~~~d~G~y~C~~~~   88 (142)
                      +.|.|.+.+.+...+.|++ ++.........     .........|.|.+++..|.|.|.|.+.+
T Consensus         1 ~~l~C~~~~~~~~~~~W~~-~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~g~y~C~~~~   64 (74)
T cd00096           1 VTLTCLASGPPPPTITWLK-NGKPLPSSVLTRVRSSRGTSSGSSTLTISNVTLEDSGTYTCVASN   64 (74)
T ss_pred             CEEEEEecCCCCCcEEEEE-CCEECCCcccEEeccccCcceeEEEEEECccCcccCcEEEEEEec
Confidence            4688999886677899999 54433221100     00011122355555555555555555443


No 187
>PF13927 Ig_3:  Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C ....
Probab=98.28  E-value=2.6e-06  Score=45.13  Aligned_cols=48  Identities=29%  Similarity=0.452  Sum_probs=37.2

Q ss_pred             eEEEEEEEecC-CccEEEE------EE---EeccccceEEEccCCCCCCeEEEEEEec
Q psy15390         80 GAYLCIATKIG-PLKIFWE------II---FHMHYGEQLNITKISRTEMGAYLCIATN  127 (142)
Q Consensus        80 G~y~C~~~~~~-~~~~~w~------~~---~~~~~~~~l~i~~~~~~d~g~y~C~a~n  127 (142)
                      -...|.+...+ .+.++|.      ..   ......+.|.+..+..+|.|+|+|.|.|
T Consensus        18 ~~l~C~~~~~~~~~~~~W~~~~~~~~~~~~~~~~~~~~L~i~~v~~~~~g~y~C~a~N   75 (75)
T PF13927_consen   18 VTLTCSAEGGPPPPSISWYDSNPSFNSNSRGSSSSNSTLTISNVTRSDNGTYTCIASN   75 (75)
T ss_dssp             EEEEEEESSEESSEEEEEETEEEEEEEEEEEEEEEEEEEEESSCCGGGTEEEEEEEEE
T ss_pred             EEEEEEEccccCCeEEEEEecCCceeeeeeeccceeeEEEEccCCHHhCcEEEEEEEC
Confidence            45789988765 8899998      11   1223456799999999999999999987


No 188
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain. IgC_MHC_I_alpha3;  Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class I alpha chain. Class I MHC proteins bind antigenic peptide fragments and present them to CD8+ T lymphocytes.  Class I molecules consist of a transmembrane alpha chain and a small chain called the beta2 microglobulin. The alpha chain contains three extracellular domains, two of which fold together to form the peptide-binding cleft (alpha1 and alpha2), and one which has an Ig fold (alpha3).  Peptide binding to class I molecules occurs in the endoplasmic reticulum (ER) and involves both chaperones and dedicated factors to assist in peptide loading.  Class I MHC molecules are expressed on most nucleated cells.
Probab=98.26  E-value=2.3e-05  Score=43.82  Aligned_cols=25  Identities=44%  Similarity=0.983  Sum_probs=20.2

Q ss_pred             CCcEEEEEEEecC-CCC-eeEEEecCCc
Q psy15390         26 EFNITLTCKAEGF-PAP-EIKWRREDNQ   51 (142)
Q Consensus        26 g~~v~l~C~~~~~-~~~-~~~w~~~~~~   51 (142)
                      |+.++|.|.+.+. |.. .+.|++ +|+
T Consensus        14 ~~~~~L~C~a~gF~P~~i~v~W~~-~g~   40 (93)
T cd07698          14 DGSLTLSCHATGFYPRDIEVTWLR-DGE   40 (93)
T ss_pred             CCcEEEEEEEEEEeCCCcEEEEEE-CCE
Confidence            7789999999995 433 789999 775


No 189
>cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Ig2_Necl-3: second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Necl-3 has been shown to accumulate in tissues of the central and peripheral nervous system, where it is expressed in ependymal cells and myelinated axons.  It is observed at the interface between the axon shaft and the myelin sheath. Ig domains are likely to participate in ligand binding and recognition.
Probab=98.25  E-value=3.4e-05  Score=42.19  Aligned_cols=25  Identities=40%  Similarity=0.942  Sum_probs=20.1

Q ss_pred             EEEEEEEec-CCCCeeEEEecCCccee
Q psy15390         29 ITLTCKAEG-FPAPEIKWRREDNQPIS   54 (142)
Q Consensus        29 v~l~C~~~~-~~~~~~~w~~~~~~~~~   54 (142)
                      ++|.|.+.+ .|...+.|++ +|+.+.
T Consensus         2 ~~LtC~a~gf~P~~~itW~k-ng~~l~   27 (83)
T cd05884           2 MQLTCKTSGSKPAADIRWFK-NDKEIK   27 (83)
T ss_pred             EEEEEEeCCccCCCEEEEEE-CCEECc
Confidence            689999987 5667899999 887753


No 190
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins. Ig_CEACAM_D1_like : immunoglobulin (IG)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily-like. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surf
Probab=98.20  E-value=1.8e-05  Score=43.97  Aligned_cols=29  Identities=14%  Similarity=0.211  Sum_probs=23.6

Q ss_pred             eeccceEEEeecCCCCCeEEEEEEEecCC
Q psy15390         63 MHYGEQLNITKISRTEMGAYLCIATKIGP   91 (142)
Q Consensus        63 ~~~~~~l~i~~v~~~d~G~y~C~~~~~~~   91 (142)
                      ...+.+|.|.+++.+|+|.|.|.+.....
T Consensus        53 ~~~~~sL~I~~l~~~DsG~Y~c~v~~~~~   81 (92)
T cd05741          53 IYPNGSLLIQNLTKEDSGTYTLQIISTNG   81 (92)
T ss_pred             EcCCceEEEccCCchhcEEEEEEEEcCCC
Confidence            33456799999999999999999876543


No 191
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. Ig1_CD4; first immunoglobulin (Ig) domain of CD4.  CD4 and CD8 are the two primary co-receptor proteins found on the surface of T cells, and the presence of either CD4 or CD8 determines the function of the T cell.  CD4 is found on helper T cells, where it is required for the binding of MHC (major histocompatibility complex) class II molecules, while CD8 is found on cytotoxic T cells, where it is required for the binding of MHC class I molecules.  CD4 contains four immunoglobulin domains, with the first three included in this hierarchy.  The fourth domain has a general Ig architecture, but has slight topological changes in the arrangement of beta strands relative to the other structures in this family and is not specifically included in the hierarchy.
Probab=98.18  E-value=8.1e-06  Score=45.72  Aligned_cols=21  Identities=14%  Similarity=0.529  Sum_probs=10.9

Q ss_pred             CCCeEEEEEEEecCCccEEEE
Q psy15390         77 TEMGAYLCIATKIGPLKIFWE   97 (142)
Q Consensus        77 ~d~G~y~C~~~~~~~~~~~w~   97 (142)
                      .|.-...|.+...+.+.+.|.
T Consensus         7 G~~VtL~C~~s~~~~~~i~W~   27 (94)
T cd07690           7 GDTAELPCTASQKKSIQFHWK   27 (94)
T ss_pred             CCCEEEEEEeCCCCCcEEEEE
Confidence            444445555554455555554


No 192
>smart00406 IGv Immunoglobulin V-Type.
Probab=98.17  E-value=1.2e-05  Score=43.34  Aligned_cols=20  Identities=25%  Similarity=0.625  Sum_probs=16.1

Q ss_pred             cceEEEccCCCCCCeEEEEE
Q psy15390        105 GEQLNITKISRTEMGAYLCI  124 (142)
Q Consensus       105 ~~~l~i~~~~~~d~g~y~C~  124 (142)
                      ...|.|.+++.+|+|.|.|.
T Consensus        61 ~~~L~i~~~~~~D~G~Y~C~   80 (81)
T smart00406       61 DVSLTISNLRVEDTGTYYCA   80 (81)
T ss_pred             EEEEEEcCCCHHHCEEEEEc
Confidence            44688888888888888885


No 193
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. Ig2_L1-CAM_like: domain similar to the second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=98.17  E-value=7.9e-06  Score=45.78  Aligned_cols=59  Identities=17%  Similarity=0.323  Sum_probs=45.2

Q ss_pred             ecCCCCCeEEEEE-EEecCCccEEEEEE----------EeccccceEEEccCCCCCCe-EEEEEEecCCCC
Q psy15390         73 KISRTEMGAYLCI-ATKIGPLKIFWEII----------FHMHYGEQLNITKISRTEMG-AYLCIATNNVPP  131 (142)
Q Consensus        73 ~v~~~d~G~y~C~-~~~~~~~~~~w~~~----------~~~~~~~~l~i~~~~~~d~g-~y~C~a~n~~~~  131 (142)
                      .+...+.-...|. ....+.+.++|...          +....++.|.|.++..+|+| .|.|.|.|....
T Consensus        14 ~V~eG~~~~L~C~pP~g~P~P~i~W~~~~~~~i~~~~Ri~~~~~GnL~fs~v~~~D~g~~Y~C~a~~~~~~   84 (95)
T cd05845          14 EVEEGDSVVLPCNPPKSAVPLRIYWMNSDLLHITQDERVSMGQNGNLYFANVEEQDSHPDYICHAHFPGLR   84 (95)
T ss_pred             EEecCCCEEEEecCCCCCCCCEEEEECCCCccccccccEEECCCceEEEEEEehhhCCCCeEEEEEccccc
Confidence            3455666678897 57788899999632          23334688999999999999 899999987654


No 194
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins. Ig1_LILRB1_like: domain similar to the first immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1). This group includes, LILRA5 (LIR9), an activating natural cytotoxicity receptor NKp46, and the immune-type receptor glycoprotein VI (GPVI). LILRs are a family of immunoreceptors expressed on expressed on T and B cells, on monocytes, dendritic cells, and subgroups of natural killer (NK) cells. The human LILR family contains nine proteins (LILRA1-3,and 5, and LILRB1-5). From functional assays, and as the cytoplasmic domains of various LILRs, for example LILRB1 (LIR-1), LILRB2 (LIR-2), and LILRB3 (LIR-3) contain immunoreceptor tyrosine-based inhibitory motifs (ITIMs) it is thought that LIR proteins are inhibitory receptors. Of the eight LIR family proteins, only LIR-1(LILRB1), and LIR-2 (LILRB2),
Probab=98.15  E-value=2.2e-05  Score=43.74  Aligned_cols=68  Identities=15%  Similarity=0.146  Sum_probs=43.4

Q ss_pred             cCCCCCeEEEEEEEecCCccEEEEEEE---------eccccceEEEccCCCCCCeEEEEEEecCC--CCCeeeEEEEEEC
Q psy15390         74 ISRTEMGAYLCIATKIGPLKIFWEIIF---------HMHYGEQLNITKISRTEMGAYLCIATNNV--PPSVSKRITVDVE  142 (142)
Q Consensus        74 v~~~d~G~y~C~~~~~~~~~~~w~~~~---------~~~~~~~l~i~~~~~~d~g~y~C~a~n~~--~~~~s~~~~l~V~  142 (142)
                      |...+.-..+|... .+...+.|.+..         .......|.|..++.+|+|.|+|+..+..  -+..|..+.|.|.
T Consensus        13 V~~G~~VtL~C~~~-~~~~~f~l~k~g~~~~~~~~~~~~~~~~f~i~~v~~~~~G~Y~C~~~~~~~~~S~~Sd~lel~Vt   91 (91)
T cd05751          13 VPLGKPVTLRCQGP-YGAVEYRLYREGSTFAVKKPPEPQNKAKFFIPSMKREHAGRYRCYYRSGVALWSEPSDPLELVVT   91 (91)
T ss_pred             cCCCCcEEEEEecC-CCCCEEEEEECCCCccccccCCCceeEEEEccCCChhHCEEEEEEEECCCCccCCCCCcEEEEeC
Confidence            34455556677664 333344444321         01224568999999999999999999862  2346778888874


No 195
>cd07699 IgC_L Immunoglobulin Constant domain. IgC_L: Immunoglobulin (Ig) light chain constant (C) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=98.13  E-value=3.1e-05  Score=43.89  Aligned_cols=32  Identities=25%  Similarity=0.592  Sum_probs=24.2

Q ss_pred             EEecCCcEEEEEEEecC-C-CCeeEEEecCCccee
Q psy15390         22 AVREEFNITLTCKAEGF-P-APEIKWRREDNQPIS   54 (142)
Q Consensus        22 ~~~~g~~v~l~C~~~~~-~-~~~~~w~~~~~~~~~   54 (142)
                      ...+++.++|.|.+.+. | ...+.|++ +|+.+.
T Consensus        13 ~~~~~~~~~L~C~~~gfyP~~i~v~W~~-~g~~~~   46 (100)
T cd07699          13 ELEKSGKATLVCLINDFYPGFATVQWKV-DGATVS   46 (100)
T ss_pred             HHccCCCcEEEEEEEeEECCCCEEEEEE-CCEECc
Confidence            34567889999999983 3 34689999 888763


No 196
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1). Ig1_ IL1RAPL-1_like: domain similar to the first immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1).  IL-1 alpha and IL-1 beta are cytokines which participates in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of 
Probab=98.11  E-value=1.8e-05  Score=44.82  Aligned_cols=37  Identities=14%  Similarity=0.271  Sum_probs=29.8

Q ss_pred             ccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        104 YGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       104 ~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      ....|.+..+..+|+|.|+|.+.|.-.. ..+.+.|+|
T Consensus        68 ~~~~Lwf~Pa~~eDSG~Y~C~~rN~t~C-~~~~i~l~V  104 (104)
T cd05896          68 EEDSIWFRPAELQDSGLYTCVLRNSTYC-MKVSMSLTV  104 (104)
T ss_pred             eCCEEEEEeCChhhCeEEEEEECCCCcc-eEEEEEEEC
Confidence            3567899999999999999999988654 466666654


No 197
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). IG_CEACAM_D1: immunoglobulin (Ig)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the D
Probab=98.10  E-value=4.7e-05  Score=43.54  Aligned_cols=31  Identities=13%  Similarity=0.205  Sum_probs=25.5

Q ss_pred             eEEeeccceEEEeecCCCCCeEEEEEEEecC
Q psy15390         60 KVHMHYGEQLNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        60 ~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      |.....+++|.|.+++..|+|.|.|.+.+..
T Consensus        63 R~~~~~ngSL~I~~v~~~D~G~Y~~~v~~~~   93 (105)
T cd05774          63 RETIYPNGSLLIQNVTQKDTGFYTLQTITTN   93 (105)
T ss_pred             cEEEeCCCcEEEecCCcccCEEEEEEEEeCC
Confidence            3445567899999999999999999987653


No 198
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig2_Contactin-2-like: second Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=98.10  E-value=1.7e-05  Score=44.55  Aligned_cols=55  Identities=16%  Similarity=0.248  Sum_probs=39.6

Q ss_pred             CCCeEEEEEEE-ecCCccEEEEEEE------------eccccceEEEccCCCCCCeEEEEEEecCCCC
Q psy15390         77 TEMGAYLCIAT-KIGPLKIFWEIIF------------HMHYGEQLNITKISRTEMGAYLCIATNNVPP  131 (142)
Q Consensus        77 ~d~G~y~C~~~-~~~~~~~~w~~~~------------~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~  131 (142)
                      .+.-...|..- ..+.+.++|.+..            .....+.|.+.+++.+|+|.|+|.|.|....
T Consensus        18 G~~~~L~C~pP~g~P~p~~~W~k~~~~~~~~~d~r~~~~~~~G~L~fs~v~~~D~g~Y~C~A~n~~~~   85 (96)
T cd05727          18 GWGVVLFCDPPPHYPDLSYRWLLNEFPNFIPEDGRRFVSQTNGNLYIAKVEASDRGNYSCFVSSPSST   85 (96)
T ss_pred             CCcEEEeeCCCCCCCCCEEEEEECCcccccccCCCeEEeCCCCcEEEeecCHhhCceeEEEEEecccC
Confidence            33445677554 3577889997541            1123578999999999999999999997654


No 199
>smart00407 IGc1 Immunoglobulin C-Type.
Probab=98.06  E-value=0.00015  Score=38.77  Aligned_cols=24  Identities=38%  Similarity=0.861  Sum_probs=18.7

Q ss_pred             EEEEEEEecC-CC-CeeEEEecCCcce
Q psy15390         29 ITLTCKAEGF-PA-PEIKWRREDNQPI   53 (142)
Q Consensus        29 v~l~C~~~~~-~~-~~~~w~~~~~~~~   53 (142)
                      ++|.|.+.+. |. ..+.|++ +|+.+
T Consensus         2 ~~L~C~a~gf~P~~i~v~W~k-~g~~~   27 (75)
T smart00407        2 ATLVCLVSGFYPPDITVTWLR-NGQEV   27 (75)
T ss_pred             eEEEEEEEeEeCCCCEEEEEE-CCEEC
Confidence            6899999985 33 4789999 88754


No 200
>KOG1480|consensus
Probab=98.05  E-value=1.1e-05  Score=59.63  Aligned_cols=128  Identities=23%  Similarity=0.359  Sum_probs=78.2

Q ss_pred             CCeeeecCCCCceeEEecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeecc--------ceEEEeecCCCCC
Q psy15390          8 PPNILDTESTPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYG--------EQLNITKISRTEM   79 (142)
Q Consensus         8 ~p~~~~~~~~~~~~~~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~--------~~l~i~~v~~~d~   79 (142)
                      .|.|..   .++...+..|..+.+.|.+.  +.+++.+.. +...+...+...+...+.        -...|.....++.
T Consensus        24 l~~~~~---~p~~~yii~~~p~~l~c~a~--~a~~i~~kc-~~~wv~~~~~~~~~~~d~tsg~~~~~~si~Isr~~v~~~   97 (909)
T KOG1480|consen   24 LPHFTT---EPKSAYIIKNKPLRLQCKAN--PATQIRFKC-NSEWVHQSRHEKLEGTDETSGLGVREVSIDISRQQVETS   97 (909)
T ss_pred             cceeee---cCCccceecCCCccceecCC--ccccccccc-ChhhhcCccceeeeccCcccceeEEeeeeeeehhhhhcc
Confidence            344555   77888899999999999875  444444333 555444333222221111        1234444444443


Q ss_pred             e---EEEEEEEec-----------------------------------------------CCccEEEEEE---------E
Q psy15390         80 G---AYLCIATKI-----------------------------------------------GPLKIFWEII---------F  100 (142)
Q Consensus        80 G---~y~C~~~~~-----------------------------------------------~~~~~~w~~~---------~  100 (142)
                      |   .|.|+..-.                                               +.+.+.|.+.         +
T Consensus        98 ~~~~d~~cQc~a~~~~g~~~s~~a~vr~ay~rk~f~~~p~~q~V~~~s~~~l~cr~pe~~paae~~w~k~e~~~~pd~n~  177 (909)
T KOG1480|consen   98 GGPEDYWCQCVAWSDDGTVKSRKATVRIAYLRKHFEQSPVGQEVQEETTLQLPCRPPEGDPKAEVEWLKNEVVIDPDANV  177 (909)
T ss_pred             cCccceeeeeeeecCCCcchhhhHHHHHHHHHHhhccChhhheecccccccccccCcccchhhhhhccccCCCCCccccc
Confidence            3   488865421                                               1134555432         2


Q ss_pred             eccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        101 HMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       101 ~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      .......+.+..+...|+|+|+|.|.|..+.+.++.+.+.|
T Consensus       178 ~~~~d~~li~~~arlsd~~nytc~a~ni~~~r~~~~~~v~v  218 (909)
T KOG1480|consen  178 IRASDHNLIISQARLSDSGNYTCEATNIVAKRKSDPATVQV  218 (909)
T ss_pred             hhhhcCCccccchhhhhcccceeeeehhhccccccceEEEE
Confidence            33446678899999999999999999999888888776654


No 201
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain. IgC_Tapasin_R: Immunoglobulin-like domain on Tapasin-R. Tapasin is a V-C1 (variable-constant) immunoglobulin superfamily molecule present in the endoplasmic reticulum (ER), where it links MHC class I molecules to the transporter associated with antigen processing (TAP). Tapasin-R is a tapasin-related protein that contains similar structural motifs to Tapasin, with some marked differences, especially in the V domain, transmembrane and cytoplasmic regions. The majority of Tapasin-R is located within the ER; however, there may be some expression of Tapasin-R at the cell surface. Tapasin-R lacks an obvious ER retention signal.
Probab=98.04  E-value=5.4e-05  Score=45.48  Aligned_cols=70  Identities=14%  Similarity=0.226  Sum_probs=39.8

Q ss_pred             eEEEeecCCCCCeEEEEEEEecCCcc-EEEEEEEeccccceEEEccCC--CCCCeEEEEEEecCCCC--CeeeEE
Q psy15390         68 QLNITKISRTEMGAYLCIATKIGPLK-IFWEIIFHMHYGEQLNITKIS--RTEMGAYLCIATNNVPP--SVSKRI  137 (142)
Q Consensus        68 ~l~i~~v~~~d~G~y~C~~~~~~~~~-~~w~~~~~~~~~~~l~i~~~~--~~d~g~y~C~a~n~~~~--~~s~~~  137 (142)
                      +|.|.+++..|+|.|.|.+.+.+... ..-...+.....-.+......  .++...++|.|.+....  .+.|.-
T Consensus         2 sL~i~~v~~~D~G~Y~C~~~~~~~~~~~~~~l~v~~~P~v~~~~~~~~~~~~~~~~L~C~a~g~~P~~~~i~W~~   76 (139)
T cd05771           2 SLTLPGLTVHDEGTYICSVSTPPHQAQQIIQLSVSEPPRVRLSLEKLVSMIEEPQTLICHIAGYYPLDVQVEWTR   76 (139)
T ss_pred             eEEECCCCHHHCEEEEEEEEccCcceeeEEEEEEecCCceEEeCCCceeecCCcEEEEEEECCCCCCCeEEEEEE
Confidence            58999999999999999987643221 111112211111111111111  34556899999986443  456643


No 202
>PF08205 C2-set_2:  CD80-like C2-set immunoglobulin domain ;  InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents the C2-set type domains found in the T-cell antigen CD80, as well as in related proteins. CD80 (B7-1) is a glycoprotein expressed on antigen-presenting cells []. The shared ligands on CD80 and CD86 (B7-2) deliver the co-stimulatory signal through CD28 and CTLA-4 on T-cells, where CD28 augments the T-cell response and CTLA-4 attenuates it [].; PDB: 3S58_A 3O3U_N 3CJJ_A 3S59_A 2PF6_B 2PET_A 3ALP_A 3SKU_D 3U83_A 3U82_B ....
Probab=97.98  E-value=6.6e-05  Score=41.46  Aligned_cols=27  Identities=41%  Similarity=0.977  Sum_probs=21.1

Q ss_pred             CCcEEEEEEEe-cCCCCeeEEEecCCcce
Q psy15390         26 EFNITLTCKAE-GFPAPEIKWRREDNQPI   53 (142)
Q Consensus        26 g~~v~l~C~~~-~~~~~~~~w~~~~~~~~   53 (142)
                      |+.+.+.|.+. +.|.+.+.|+. ++..+
T Consensus        14 ~~~~~~~C~s~~~~P~~~i~W~~-~~~~~   41 (89)
T PF08205_consen   14 GEEVTLTCSSSGGYPPPQITWYL-DGGPV   41 (89)
T ss_dssp             TEEEEEEEEEEEEBS-EEEEEEE-TTCEE
T ss_pred             ceEEEEEEEeCCeECCeEEEEEE-CCCce
Confidence            78999999764 47888999999 66655


No 203
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Ig1_Necl-2: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-2, Necl-2 (also known as cell adhesion molecule 1 (CADM1), SynCAM1, IGSF4A, Tslc1, sgIGSF, and RA175).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-2 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-2 is expressed in a wide variety of tissues, and is a 
Probab=97.93  E-value=0.0003  Score=39.48  Aligned_cols=65  Identities=17%  Similarity=0.269  Sum_probs=41.8

Q ss_pred             CCCCCeEEEEEEEecCCccEEEEE-----------------EEec----cccceEEEccCCCCCCeEEEEEEecCCCCCe
Q psy15390         75 SRTEMGAYLCIATKIGPLKIFWEI-----------------IFHM----HYGEQLNITKISRTEMGAYLCIATNNVPPSV  133 (142)
Q Consensus        75 ~~~d~G~y~C~~~~~~~~~~~w~~-----------------~~~~----~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~  133 (142)
                      ...++....|.+.+.+...+.|.+                 ++..    ...-.|.|..+..+|+|.|.|.+...+.  .
T Consensus        10 ~~G~ta~L~C~v~~~~~~~v~w~~~~~~~i~~~~~~~~~d~Rf~~~~~~~~~~tL~I~~vq~~D~G~Y~Cqv~t~p~--~   87 (95)
T cd05881          10 VEGEVAIISCRVKNNDDSVIQLLNPNRQTIYFRDVRPLKDSRFQLVNFSSNELRVSLSNVSLSDEGRYFCQLYTDPP--Q   87 (95)
T ss_pred             cCCCcEEEEEEEccCCccEEEEEecCCcEEEecCccccCCcCEEEEeCCCCEEEEEECcCCcccCEEEEEEEEcccC--e
Confidence            445666677777776555555531                 1111    1223589999999999999999987653  4


Q ss_pred             eeEEEEEE
Q psy15390        134 SKRITVDV  141 (142)
Q Consensus       134 s~~~~l~V  141 (142)
                      +..+++.|
T Consensus        88 ~~~~~~~~   95 (95)
T cd05881          88 EAYTTITV   95 (95)
T ss_pred             EEEEEEEC
Confidence            55555544


No 204
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin. IgC_beta2m: Immunoglobulin-like domain in beta2-Microglobulin (beta2m). Beta2m is the non-covalently bound light chain of the human class I major histocompatibility complex (MHC-I). Beta2m is structured as a beta-sandwich domain composed of two facing beta-sheets (four stranded and three stranded), that is typical of the C-type immunoglobulin superfamily. This structure is stabilized by an intramolecular disulfide bridge connecting two Cys residues in the facing beta -sheets. In vivo, MHC-I continuously exposes beta2m on the cell surface, where it may be released to plasmatic fluids, transported to the kidneys, degraded and then excreted.
Probab=97.89  E-value=0.00037  Score=38.96  Aligned_cols=30  Identities=27%  Similarity=0.476  Sum_probs=22.8

Q ss_pred             ecCCcEEEEEEEecCCCC--eeEEEecCCccee
Q psy15390         24 REEFNITLTCKAEGFPAP--EIKWRREDNQPIS   54 (142)
Q Consensus        24 ~~g~~v~l~C~~~~~~~~--~~~w~~~~~~~~~   54 (142)
                      ..|+..+|.|.+.+.-++  .+.|.+ +|+.+.
T Consensus        13 ~~g~~~~L~C~a~gFyP~~i~v~W~~-dg~~~~   44 (93)
T cd05770          13 ENGKPNVLNCYVTGFHPPDIEIRLLK-NGVKIP   44 (93)
T ss_pred             cCCCceEEEEEEEEEeCCCCEEEEEE-CCEECC
Confidence            447777999999994333  679999 888764


No 205
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins. IgV_TCR_alpha: immunoglobulin (Ig) variable domain of the alpha chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group represents the variable domain of the alpha chain of TCRs and also includes the variable domain of delta chains of TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=97.89  E-value=0.00017  Score=41.27  Aligned_cols=22  Identities=18%  Similarity=0.475  Sum_probs=15.8

Q ss_pred             eEEEeecCCCCCeEEEEEEEec
Q psy15390         68 QLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        68 ~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      .|.|.+++.+|+|.|.|.+.+.
T Consensus        71 ~L~I~~~~~~DsG~Y~C~~~~~   92 (109)
T cd04983          71 SLHISAAQLSDSAVYFCALSES   92 (109)
T ss_pred             EEEECCCCHHHCEEEEEEEecC
Confidence            5777777777777777776643


No 206
>cd00099 IgV Immunoglobulin variable domain (IgV). IgV: Immunoglobulin variable domain (IgV). Members of the IgV family are components of immunoglobulin (Ig) and T cell receptors. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. Within the variable domain, there are regions of even more variability called the hypervariable or complementarity-determining regions (CDRs) which are responsible for antigen binding. A predominant feature of most Ig domains is the disulfide bridge connecting 2 beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=97.88  E-value=0.0001  Score=41.89  Aligned_cols=26  Identities=15%  Similarity=0.304  Sum_probs=22.7

Q ss_pred             cceEEEccCCCCCCeEEEEEEecCCC
Q psy15390        105 GEQLNITKISRTEMGAYLCIATNNVP  130 (142)
Q Consensus       105 ~~~l~i~~~~~~d~g~y~C~a~n~~~  130 (142)
                      ..+|.|.+++.+|+|.|.|.+.+..+
T Consensus        66 ~~sL~I~~v~~~D~G~Y~C~v~~~~~   91 (105)
T cd00099          66 SFTLTISSLQPEDSAVYYCAVSLSGG   91 (105)
T ss_pred             EEEEEECCCCHHHCEEEEEEEecCCC
Confidence            34789999999999999999998764


No 207
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain. IgC_MHC_II_beta: Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class II beta chain.  MHC class II molecules play a key role in the initiation of the antigen-specific immune reponse. In both humans and in mice these molecules have been shown to be expressed constitutively on the cell surface of professional antigen-presenting cells (APCs), for example on B-lymphocytes, monocytes, and macrophages. The expression of these molecules has been shown to be induced in nonprofessional APCs such as keratinocyctes, and they are expressed on the surface of activated human T cells and on T cells from other species. The MHC II molecules present antigenic peptides to CD4(+) T-lymphocytes. These peptides derive mostly from protelytic processing via the endocytic pathway, of antigens internalized by the APC. These peptides bind to the MHC class II molecules in the endosome be
Probab=97.85  E-value=0.00037  Score=39.02  Aligned_cols=31  Identities=26%  Similarity=0.472  Sum_probs=23.7

Q ss_pred             ecCCcEEEEEEEecCCCC--eeEEEecCCcceec
Q psy15390         24 REEFNITLTCKAEGFPAP--EIKWRREDNQPISI   55 (142)
Q Consensus        24 ~~g~~v~l~C~~~~~~~~--~~~w~~~~~~~~~~   55 (142)
                      ..|+.++|.|.+.+..++  .+.|++ +|+.+..
T Consensus        12 ~~~~~~~L~C~~~gFyP~~i~v~W~~-~g~~~~~   44 (94)
T cd05766          12 SLSHPHLLVCHVWGFYPPEITVKWFK-NGQEETE   44 (94)
T ss_pred             cCCCCeEEEEEEeeecCCCCEEEEEE-CCeecCC
Confidence            468899999999994333  679999 8886543


No 208
>cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain. IgC_TCR_beta: Constant domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the beta chain. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The antigen binding site is formed by the variable domains of the alpha and beta chains, located at the N-terminus of each chain. Alpha/beta TCRs recognize antigens differently from gamma/delta TCRs.
Probab=97.76  E-value=0.00047  Score=40.08  Aligned_cols=33  Identities=27%  Similarity=0.671  Sum_probs=24.1

Q ss_pred             EEecCCcEEEEEEEecC-CC-CeeEEEecCCcceec
Q psy15390         22 AVREEFNITLTCKAEGF-PA-PEIKWRREDNQPISI   55 (142)
Q Consensus        22 ~~~~g~~v~l~C~~~~~-~~-~~~~w~~~~~~~~~~   55 (142)
                      .+.++..++|.|.+.+. |. -.+.|++ +++.+..
T Consensus        14 e~~~~~~~tL~Cla~gFyP~~I~V~W~k-ng~~l~~   48 (115)
T cd05769          14 EIRNKRKATLVCLATGFYPDHVSLSWKV-NGKEVTD   48 (115)
T ss_pred             HhccCCCcEEEEEEEeEeCCCcEEEEEE-CCEECCC
Confidence            34467789999999984 33 3689999 8876643


No 209
>cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH4: The fourth immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=97.76  E-value=0.0003  Score=40.01  Aligned_cols=31  Identities=35%  Similarity=0.694  Sum_probs=23.2

Q ss_pred             EecCCcEEEEEEEecCCCC--eeEEEecCCccee
Q psy15390         23 VREEFNITLTCKAEGFPAP--EIKWRREDNQPIS   54 (142)
Q Consensus        23 ~~~g~~v~l~C~~~~~~~~--~~~w~~~~~~~~~   54 (142)
                      +..|..++|.|.+.+..++  .+.|++ +|+.+.
T Consensus        13 ~~~~~~~tL~C~a~gFyP~~i~v~W~k-~g~~~~   45 (102)
T cd05768          13 LSLQETATLTCLVKGFSPSDIFVKWLQ-NGQPLS   45 (102)
T ss_pred             hCcCCceEEEEEEeeEeCCCCEEEEEE-CCEECC
Confidence            3457889999999994433  579999 887653


No 210
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig6_Contactin-4: sixth Ig domain of the neural cell adhesion molecule contactin-4. Contactins are neural cell adhesion molecules, and are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. Highest expresson of contactin-4 is in testes, thyroid, small intestine, uterus and brain. Contactin-4 plays a role in the response of neuroblastoma cells to differentiating agents, such as retinoids. The contactin 4 gene is associated with cerebellar degeneration in spinocerebellar ataxia type 16.
Probab=97.75  E-value=2.1e-05  Score=43.24  Aligned_cols=25  Identities=24%  Similarity=0.460  Sum_probs=22.2

Q ss_pred             ccceEEEeecCCCCCeEEEEEEEec
Q psy15390         65 YGEQLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        65 ~~~~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      ..+.|.|.+++..|+|+|+|.+.|.
T Consensus        45 ~~~~L~I~nv~~~dsG~YtC~a~n~   69 (85)
T cd05853          45 SAGDLMIRSIQLKHAGKYVCMVQTS   69 (85)
T ss_pred             CCCcEEEecCCHHHCEEEEEEEEcc
Confidence            3457999999999999999999875


No 211
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain. Ig_CD3_epsilon; immunoglobulin (Ig)-like domain of CD3 epsilon chain. CD3 is a T cell surface receptor that is associated with alpha/beta T cell receptors (TCRs).  The CD3 complex consists of one gamma, one delta, two epsilon, and two zeta chains.  The CD3 subunits form heterodimers as gamma/epsilon, delta/epsilon, and zeta/zeta.  The gamma, delta, and epsilon chains each contain an extracellular Ig domain, whereas the extracellular domains of the zeta chains are very small and have unknown structure. The CD3 domain participates in intracellular signalling once the TCR has bound an MHC/antigen complex.
Probab=97.73  E-value=0.00013  Score=37.61  Aligned_cols=52  Identities=25%  Similarity=0.402  Sum_probs=32.8

Q ss_pred             EecCCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEe
Q psy15390         23 VREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATK   88 (142)
Q Consensus        23 ~~~g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~   88 (142)
                      ...|.+|+|+|+....   .+.|++ ++..+..         .+..+.+.+-. ++.|.|.|.+.+
T Consensus         4 sisGTtVtlTCP~~~~---~i~W~~-n~~~~~g---------~~~~~~~~~~~-e~~G~Y~C~~~~   55 (65)
T cd07692           4 SISGTTVTVTCPLSGD---DIKWKK-NDQVSQG---------SDEKYLSLNHF-SSSGYYHCTADN   55 (65)
T ss_pred             EEeccEEEEECCCCCC---CceEEe-CCccCCC---------CCceEEeeccC-CCCceEEEEeCC
Confidence            3569999999975522   389999 5544321         11233344444 778888887753


No 212
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain. IgV_L_lambda: Immunoglobulin (Ig) light chain, lambda type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=97.70  E-value=0.00058  Score=38.41  Aligned_cols=23  Identities=17%  Similarity=0.381  Sum_probs=20.3

Q ss_pred             ceEEEccCCCCCCeEEEEEEecC
Q psy15390        106 EQLNITKISRTEMGAYLCIATNN  128 (142)
Q Consensus       106 ~~l~i~~~~~~d~g~y~C~a~n~  128 (142)
                      ..|.|.+++.+|+|+|.|.+.+.
T Consensus        63 ~~L~I~~~~~~Dsg~Y~C~~~~~   85 (98)
T cd04984          63 ASLTISGAQTEDEADYYCQVWDS   85 (98)
T ss_pred             EEEEECCCChhhCEEEEEEEccC
Confidence            46899999999999999998764


No 213
>cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins. Ig2_PVR_like: domain similar to the second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155). Poliovirus (PV) binds to its cellular receptor (PVR/CD155) to initiate infection. CD155 is a membrane-anchored, single-span glycoprotein; its extracellular region has three Ig-like domains. There are four different isotypes of CD155 (referred to as alpha, beta, gamma, and delta), these result from alternate splicing of the CD155 mRNA, and have identical extracellular domains. CD155-beta and - gamma, are secreted, CD155-alpha and delta are membrane-bound and function as PV receptors. The virus recognition site is contained in the amino-terminal domain, D1. Having the virus attachment site on the receptor distal from the plasma membrane may be important for successful initiation of infection of cells by the virus. CD155 binds in the poliovirus 
Probab=97.70  E-value=0.0013  Score=36.98  Aligned_cols=23  Identities=30%  Similarity=0.569  Sum_probs=18.3

Q ss_pred             cCCcEEEEEEE-ecCCCCeeEEEe
Q psy15390         25 EEFNITLTCKA-EGFPAPEIKWRR   47 (142)
Q Consensus        25 ~g~~v~l~C~~-~~~~~~~~~w~~   47 (142)
                      ......+.|.+ .+.|.+.|.|++
T Consensus        14 ~~~~~va~C~s~~gkP~a~ItW~~   37 (95)
T cd05719          14 GEPVTVATCVSANGKPPATISWET   37 (95)
T ss_pred             CCccEEEEEECCCCcCCCEEEEEe
Confidence            34567778998 568889999998


No 214
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig3_Robo: domain similar to the third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagoni
Probab=97.69  E-value=4.9e-05  Score=39.87  Aligned_cols=22  Identities=27%  Similarity=0.581  Sum_probs=20.1

Q ss_pred             EEEeecCCCCCeEEEEEEEecC
Q psy15390         69 LNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        69 l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      |.|.+++.+|+|.|+|.+.|..
T Consensus        37 L~I~~v~~~D~G~Y~C~a~N~~   58 (69)
T cd05725          37 LKIRNVTAGDEGSYTCEAENMV   58 (69)
T ss_pred             EEECcCChhHCEEEEEEEEcCC
Confidence            8999999999999999998853


No 215
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig6_Contactin-2: Sixth Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=97.65  E-value=5.2e-05  Score=41.64  Aligned_cols=26  Identities=23%  Similarity=0.345  Sum_probs=22.6

Q ss_pred             cceEEEeecCCCCCeEEEEEEEecCC
Q psy15390         66 GEQLNITKISRTEMGAYLCIATKIGP   91 (142)
Q Consensus        66 ~~~l~i~~v~~~d~G~y~C~~~~~~~   91 (142)
                      .+.|.|.+++..|+|.|+|.+.|...
T Consensus        46 ~~~L~I~~v~~~D~G~YtC~A~n~~g   71 (85)
T cd05854          46 IGDLVIVNAQLSHAGTYTCTAQTVVD   71 (85)
T ss_pred             EeEEEEccCChhhCeEEEEEEecCCC
Confidence            35799999999999999999998643


No 216
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin. Ig_Myotilin_C: C-terminal immunoglobulin (Ig)-like domain of myotilin. Mytolin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to the latter family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Myotilin is most abundant in skeletal and cardiac muscle, and is involved in maintaining sarcomere integrity. It binds to alpha-actinin, filamin and actin. Mutations in myotilin lead to muscle disorders.
Probab=97.63  E-value=6.1e-05  Score=40.37  Aligned_cols=23  Identities=22%  Similarity=0.341  Sum_probs=21.0

Q ss_pred             eEEEeecCCCCCeEEEEEEEecC
Q psy15390         68 QLNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        68 ~l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      +|.|.+++.+|+|.|+|.+.|..
T Consensus        42 ~L~I~~~~~~D~G~Y~C~A~N~~   64 (75)
T cd05892          42 TLLIKNVNKKDAGWYTVSAVNEA   64 (75)
T ss_pred             EEEECCCChhhCEEEEEEEEcCc
Confidence            59999999999999999999853


No 217
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4). IgV_CTLA-4: domain similar to the variable(v)-type immunoglobulin (Ig) domain found in cytotoxic T lymphocyte-associated antigen 4 (CTLA-4).  CTLA-4 is involved in the regulation of T cell response, acting as an inhibitor of intracellular signalling.  CTLA-4 is similar to CD28, a T cell co-receptor protein that recognizes the B7 proteins (CD80 and CD86). CD28 binding of the B7 proteins occurs after the presentation of antigen to the T cell receptor (TCR) via the peptide-MHC complex on the surface of an antigen presenting cell (APC).  CTLA-4 also binds the B7 molecules with a higher affinity than does CD28.  The B7/CTLA-4 interaction generates inhibitory signals down-regulating the response, and may prevent T cell activation by weak TCR signals. CD28 and CTLA-4 then elicit opposing signals in the regulation of T cell responsiveness and homeostasis. T cell activation leads to increased 
Probab=97.62  E-value=0.0022  Score=37.14  Aligned_cols=31  Identities=13%  Similarity=-0.007  Sum_probs=22.9

Q ss_pred             CceeEEecCCcEEEEEEEecCCC---CeeEEEec
Q psy15390         18 PSSVAVREEFNITLTCKAEGFPA---PEIKWRRE   48 (142)
Q Consensus        18 ~~~~~~~~g~~v~l~C~~~~~~~---~~~~w~~~   48 (142)
                      .....+..|..++|.|.+++...   ..+.|++.
T Consensus         5 ~~~~lv~p~~sv~LsC~~sg~~~s~e~~~~wvRq   38 (115)
T cd05721           5 QSPVLASSNGAASLVCEYTYNGFSKEFRASLLKG   38 (115)
T ss_pred             cCCeEEcCCCCEEEEEEecCCccccEEEEEEEEe
Confidence            44556778999999999977443   35789884


No 218
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. Ig1_NCAM-1: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (trans
Probab=97.62  E-value=7.3e-05  Score=42.05  Aligned_cols=24  Identities=21%  Similarity=0.466  Sum_probs=21.9

Q ss_pred             cceEEEeecCCCCCeEEEEEEEec
Q psy15390         66 GEQLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        66 ~~~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      .++|.|.+++.+|+|.|+|.+.|.
T Consensus        59 ~~~L~I~~v~~~D~G~YtC~A~N~   82 (96)
T cd05865          59 SSTLTIYNANIDDAGIYKCVVSNE   82 (96)
T ss_pred             ceEEEEeccChhhCEEEEEEEEcC
Confidence            457999999999999999999986


No 219
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG). Ig_MOG_like:  immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG). MOG, a minor component of the myelin sheath, is an important CNS-specific autoantigen, linked to the pathogenesis of multiple sclerosis (MS) and experimental autoimmune encephalomyelitis (EAE). It is a transmembrane protein having an extracellular Ig domain. MOG is expressed in the CNS on the outermost lamellae of the myelin sheath, and on the surface of oligodendrocytes, and may participate in the completion, compaction, and/or maintenance of myelin. This group also includes butyrophilin (BTN). BTN is the most abundant protein in bovine milk-fat globule membrane (MFGM).
Probab=97.59  E-value=0.00042  Score=39.09  Aligned_cols=66  Identities=20%  Similarity=0.321  Sum_probs=41.6

Q ss_pred             CCcEEEEEEEecCC---CCeeEEEecCCccee---c-----------CCcceEEee------ccceEEEeecCCCCCeEE
Q psy15390         26 EFNITLTCKAEGFP---APEIKWRREDNQPIS---I-----------NKRKKVHMH------YGEQLNITKISRTEMGAY   82 (142)
Q Consensus        26 g~~v~l~C~~~~~~---~~~~~w~~~~~~~~~---~-----------~~~~~~~~~------~~~~l~i~~v~~~d~G~y   82 (142)
                      |++++|+|...+..   ...+.|++.+.....   .           ..+.|....      ...+|.|.+++.+|+|.|
T Consensus         1 G~~v~L~C~~~~~~~~~~~~v~W~k~~~~~~v~~~~~~~~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y   80 (100)
T cd05713           1 GEDAELPCHLSPKMSAEHMEVRWFRSQFSPAVHLYRDGQDQYGEQMPEYRGRTELLKDAIAEGSVALRIHNVRASDEGLY   80 (100)
T ss_pred             CCcEEEEeEEcCCCCCCeeEEEEEECCCceeEEEEcCCcccccccCccccceEEeecccccCCcEEEEEEcCChhhCEEE
Confidence            78999999986332   225788874322110   0           011233221      124699999999999999


Q ss_pred             EEEEEecCC
Q psy15390         83 LCIATKIGP   91 (142)
Q Consensus        83 ~C~~~~~~~   91 (142)
                      .|.+.+.+.
T Consensus        81 ~C~v~~~~~   89 (100)
T cd05713          81 TCFFQSDGF   89 (100)
T ss_pred             EEEEecCCc
Confidence            999987543


No 220
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA). Ig_EVA: immunoglobulin (Ig) domain of epithelial V-like antigen 1 (EVA). EVA is also known as myelin protein zero-like 2. EVA is an adhesion molecule, which may play a role in structural organization of the thymus and early lymphocyte development.
Probab=97.58  E-value=0.00019  Score=41.77  Aligned_cols=26  Identities=19%  Similarity=0.342  Sum_probs=22.7

Q ss_pred             cceEEEeecCCCCCeEEEEEEEecCC
Q psy15390         66 GEQLNITKISRTEMGAYLCIATKIGP   91 (142)
Q Consensus        66 ~~~l~i~~v~~~d~G~y~C~~~~~~~   91 (142)
                      +.+|.|.+++.+|+|.|.|.+.+.+.
T Consensus        78 ~~sL~I~~v~~~D~G~Y~C~v~~~~~  103 (115)
T cd05880          78 DASILIWQLQPTDNGTYTCQVKNPPD  103 (115)
T ss_pred             ceEEEEeeCChhhCEEEEEEEEeCCC
Confidence            34799999999999999999988654


No 221
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB. TrkB_d5: the fifth domain of Trk receptor TrkB, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors, which mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. The Trks are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkB shares significant sequence homology and domain organization with TrkA, and TrkC. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. In some cell systems NT-3 can activate TrkA and TrkB receptors. TrKB transcripts are found throughout multiple structures of the central and peripheral nervous systems.
Probab=97.56  E-value=0.00011  Score=39.79  Aligned_cols=23  Identities=17%  Similarity=0.241  Sum_probs=21.3

Q ss_pred             ceEEEeecCCCCCeEEEEEEEec
Q psy15390         67 EQLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        67 ~~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      +.|.|.++...|+|.|+|.|.|.
T Consensus        44 ~~L~i~~~~~~D~G~YtC~A~N~   66 (79)
T cd05855          44 GCLQLDNPTHLNNGIYTLVAKNE   66 (79)
T ss_pred             EEEEECCCCcccCEEEEEEEEcC
Confidence            46999999999999999999985


No 222
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain. IgC_MHC_II_alpha: Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class II alpha chain.  MHC class II molecules play a key role in the initiation of the antigen-specific immune reponse. In both humans and in mice these molecules have been shown to be expressed constitutively on the cell surface of professional antigen-presenting cells (APCs), for example on B-lymphocytes, monocytes, and macrophages. The expression of these molecules has been shown to be induced in nonprofessional APCs such as keratinocyctes, and they are expressed on the surface of activated human T cells and on T cells from other species. The MHC II molecules present antigenic peptides to CD4(+) T-lymphocytes. These peptides derive mostly from protelytic processing via the endocytic pathway, of antigens internalized by the APC. These peptides bind to the MHC class II molecules in the endosom
Probab=97.56  E-value=0.0031  Score=35.32  Aligned_cols=29  Identities=21%  Similarity=0.454  Sum_probs=21.8

Q ss_pred             cCCcEEEEEEEecCCC--CeeEEEecCCccee
Q psy15390         25 EEFNITLTCKAEGFPA--PEIKWRREDNQPIS   54 (142)
Q Consensus        25 ~g~~v~l~C~~~~~~~--~~~~w~~~~~~~~~   54 (142)
                      .|+..+|.|.+.+.-+  -.+.|.+ +|+.+.
T Consensus        14 ~~~~~tL~C~a~gFyP~~I~v~W~~-~g~~~~   44 (94)
T cd05767          14 LGEPNTLICFVDNFFPPVLNVTWLK-NGVPVT   44 (94)
T ss_pred             CCCCeEEEEEEEEEECCcCEEEEEE-CCeEcc
Confidence            4667899999999433  3679999 887654


No 223
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2. Ig1_NCAM-2:  first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 (OCAM/mamFas II, RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=97.55  E-value=8.1e-05  Score=41.54  Aligned_cols=24  Identities=29%  Similarity=0.462  Sum_probs=21.6

Q ss_pred             ceEEEeecCCCCCeEEEEEEEecC
Q psy15390         67 EQLNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        67 ~~l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      ..|.|.++..+|+|.|+|.+.|..
T Consensus        56 ~~L~I~~v~~~D~G~Y~C~A~N~~   79 (92)
T cd05866          56 SRLTIYNANIEDAGIYRCQATDAK   79 (92)
T ss_pred             eEEEEecCChHHCEEEEEEEEcCC
Confidence            469999999999999999999864


No 224
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins. Ig1_NCAM-1 like: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the s
Probab=97.54  E-value=0.00012  Score=40.82  Aligned_cols=24  Identities=29%  Similarity=0.513  Sum_probs=21.5

Q ss_pred             cceEEEeecCCCCCeEEEEEEEec
Q psy15390         66 GEQLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        66 ~~~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      .+.|.|.+++.+|+|.|+|.+.|.
T Consensus        56 ~~~L~I~~v~~~D~G~Y~C~A~N~   79 (92)
T cd04977          56 RSTLTIYNANIEDAGIYKCVATDA   79 (92)
T ss_pred             EEEEEEecCCcccCEEEEEEEEcC
Confidence            346999999999999999999986


No 225
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins. Ig1_VEGFR_like: first immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) related proteins. The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGF-A interacts with both VEGFR-1 and VEGFR-2. VEGFR-1 binds strongest to VEGF, VEGF-2 binds more weakly. VEGFR-3 appears not to bind VEGF, but binds other members of the VEGF family (VEGF-C and -D). VEGFRs bind VEGFs with high affinity with the IG-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGF
Probab=97.54  E-value=8.3e-05  Score=40.63  Aligned_cols=25  Identities=24%  Similarity=0.437  Sum_probs=22.1

Q ss_pred             cceEEEeecCCCCCeEEEEEEEecC
Q psy15390         66 GEQLNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        66 ~~~l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      .+.|.|.+++..|+|.|.|.+.|..
T Consensus        48 ~s~L~I~~v~~~DsG~Y~C~a~n~~   72 (84)
T cd05742          48 SSTLTIPNATLKDSGTYTCAASSGT   72 (84)
T ss_pred             EEEEEECCCChhhCEEEEEEEccCC
Confidence            3579999999999999999998853


No 226
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). Ig1_PDGFR-alphabeta: The first immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFRalpha binds to all three PDGFs, whereas the PDGFRbeta binds only to PDGF-B. PDGFRs alpha and beta have similar organization: an extracellular component with five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFRalpha and PDGFRbeta are essential for normal development.
Probab=97.53  E-value=0.00012  Score=40.02  Aligned_cols=25  Identities=20%  Similarity=0.383  Sum_probs=22.1

Q ss_pred             cceEEEeecCCCCCeEEEEEEEecC
Q psy15390         66 GEQLNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        66 ~~~l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      .+.|.|.+++.+|+|.|.|.+.+..
T Consensus        45 ~s~L~I~~~~~~DsG~Y~C~a~n~~   69 (84)
T cd05861          45 RSTLTFPHATVEDSGTYECAAHEST   69 (84)
T ss_pred             EEEEEECCCCcCCCEEEEEEEEECc
Confidence            4579999999999999999998753


No 227
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig3_FGFR: third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for FGFs.
Probab=97.53  E-value=0.00011  Score=40.74  Aligned_cols=24  Identities=29%  Similarity=0.493  Sum_probs=21.6

Q ss_pred             ceEEEeecCCCCCeEEEEEEEecC
Q psy15390         67 EQLNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        67 ~~l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      ..|.|.+++.+|+|.|+|.+.|..
T Consensus        55 ~~L~I~~v~~~D~G~Y~C~A~N~~   78 (90)
T cd04974          55 EVLYLRNVSFDDAGEYTCLAGNSI   78 (90)
T ss_pred             ceEEEeccccccCcEEEEEeeccc
Confidence            469999999999999999999863


No 228
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin. Ig_Palladin_C: C-terminal immunoglobulin (Ig)-like domain of palladin. Palladin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to this family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Palladin binds to alpha-actinin ezrin, vasodilator-stimulated phosphoprotein VASP, SPIN90 (DIP, mDia interacting protein), and Src. Palladin also binds F-actin directly, via its Ig3 domain. Palladin is expressed as several alternatively spliced isoforms, having various combinations of Ig-like domains, in a cell-type-specific manner. It has been suggested that palladin's different Ig-like domains may be specialized for distinct functions.
Probab=97.53  E-value=8.3e-05  Score=39.83  Aligned_cols=23  Identities=22%  Similarity=0.228  Sum_probs=20.8

Q ss_pred             eEEEeecCCCCCeEEEEEEEecC
Q psy15390         68 QLNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        68 ~l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      .|.|.+++.+|+|.|+|.+.|..
T Consensus        42 ~L~I~~v~~~D~G~Y~C~A~N~~   64 (75)
T cd05893          42 CLLIQGATKEDAGWYTVSAKNEA   64 (75)
T ss_pred             EEEECCCCHHHCEEEEEEEEcCC
Confidence            48999999999999999999853


No 229
>PHA02633 hypothetical protein; Provisional
Probab=97.52  E-value=0.0004  Score=35.30  Aligned_cols=36  Identities=17%  Similarity=0.375  Sum_probs=21.8

Q ss_pred             cceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        105 GEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       105 ~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      ...|.|.++..+|+|.|.|...|.--. ...++.|.|
T Consensus        17 ~~nLwilpa~~sDSGiYiC~~rn~t~c-~~~si~l~V   52 (63)
T PHA02633         17 CNNMLILNPTQSDSGIYMCITKNETYS-DMMKFDLCI   52 (63)
T ss_pred             cccEEEeccccccCcEEEEEEcCCCee-EEEEEEEEE
Confidence            345677777778888888888765332 233344443


No 230
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). Ig5_NCAM-2: the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=97.51  E-value=0.00014  Score=40.93  Aligned_cols=24  Identities=25%  Similarity=0.401  Sum_probs=21.8

Q ss_pred             ceEEEeecCCCCCeEEEEEEEecC
Q psy15390         67 EQLNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        67 ~~l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      ..|.|.+++.+|+|.|+|.+.|..
T Consensus        64 ~~L~I~~v~~~D~G~Y~C~A~N~~   87 (98)
T cd05870          64 SSLHIKDVKLSDSGRYDCEAASRI   87 (98)
T ss_pred             eEEEEeeCCcCCCEEEEEEEeccC
Confidence            479999999999999999999863


No 231
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). Ig8_DSCAM:  the eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion.
Probab=97.49  E-value=0.00013  Score=40.27  Aligned_cols=23  Identities=26%  Similarity=0.417  Sum_probs=21.3

Q ss_pred             ceEEEeecCCCCCeEEEEEEEec
Q psy15390         67 EQLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        67 ~~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      +.|.|.++...|+|.|+|.+.|.
T Consensus        47 s~L~I~~~~~~D~G~YtC~A~N~   69 (88)
T cd05735          47 STLQILPTVREDSGFFSCHAINS   69 (88)
T ss_pred             EEEEECCCCcccCEEEEEEEEcC
Confidence            46999999999999999999986


No 232
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2). Ig3_FGFR-2-like; domain similar to the third immunoglobulin (Ig)-like domain of human fibroblast growth factor receptor 2 (FGFR2). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for FGFs. FGFR2 is required for male sex determination.
Probab=97.48  E-value=8.8e-05  Score=41.12  Aligned_cols=24  Identities=25%  Similarity=0.481  Sum_probs=21.8

Q ss_pred             ceEEEeecCCCCCeEEEEEEEecC
Q psy15390         67 EQLNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        67 ~~l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      +.|.|.+++.+|+|.|+|.+.|..
T Consensus        55 ~~L~I~~v~~~D~G~Y~C~A~N~~   78 (90)
T cd05858          55 EVLYLRNVTFEDAGEYTCLAGNSI   78 (90)
T ss_pred             eEEEEccCCHHHCEEEEEEEEeCC
Confidence            579999999999999999999853


No 233
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily. Ig_1: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=97.47  E-value=0.00019  Score=38.23  Aligned_cols=22  Identities=23%  Similarity=0.465  Sum_probs=20.2

Q ss_pred             eEEEeecCCCCCeEEEEEEEec
Q psy15390         68 QLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        68 ~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      .|.|.+++.+|+|.|.|.+.|.
T Consensus        41 ~L~I~~~~~~D~G~Y~C~A~N~   62 (75)
T cd05763          41 VFFIVDVKIEDTGVYSCTAQNT   62 (75)
T ss_pred             EEEEeeCCcccCEEEEEEEEcC
Confidence            4889999999999999999885


No 234
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin. Ig_Myotilin_like_C: immunoglobulin (Ig)-like domain in myotilin, palladin, and myopalladin.  Myotilin, palladin, and myopalladin function as scaffolds that regulate actin organization. Myotilin and myopalladin are most abundant in skeletal and cardiac muscle; palladin is ubiquitously expressed in the organs of developing vertebrates and  plays a key role in cellular morphogenesis. The three family members each interact with specific molecular partners: all three bind to alpha-actinin; in addition, palladin also binds to vasodilator-stimulated phosphoprotein (VASP) and ezrin, myotilin binds to filamin and actin, and myopalladin also binds to nebulin and cardiac ankyrin repeat protein (CARP).
Probab=97.47  E-value=0.00016  Score=38.68  Aligned_cols=23  Identities=22%  Similarity=0.245  Sum_probs=20.9

Q ss_pred             eEEEeecCCCCCeEEEEEEEecC
Q psy15390         68 QLNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        68 ~l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      .|.|.+++.+|+|.|+|.+.|..
T Consensus        42 ~L~I~~~~~~D~G~Y~C~a~N~~   64 (75)
T cd05744          42 CLLIQNANKEDAGWYTVSAVNEA   64 (75)
T ss_pred             EEEECCCCcccCEEEEEEEEcCC
Confidence            59999999999999999999853


No 235
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0). Ig_P0ex: immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an Ig domain.  The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin.
Probab=97.47  E-value=0.0013  Score=38.28  Aligned_cols=26  Identities=15%  Similarity=0.308  Sum_probs=22.9

Q ss_pred             cceEEEeecCCCCCeEEEEEEEecCC
Q psy15390         66 GEQLNITKISRTEMGAYLCIATKIGP   91 (142)
Q Consensus        66 ~~~l~i~~v~~~d~G~y~C~~~~~~~   91 (142)
                      +.++.|.+++.+|.|.|+|.+.|.+.
T Consensus        79 daSI~I~nv~~sD~G~Y~C~v~n~p~  104 (116)
T cd05879          79 DGSIVIHNLDYTDNGTFTCDVKNPPD  104 (116)
T ss_pred             eeEEEEccCCcccCEEEEEEEEcCCC
Confidence            35799999999999999999998654


No 236
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R). IG1_VEGFR: first immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGF_A interacts with both VEGFR-1 and VEGFR-2. VEGFR-1 binds strongest to VEGF, VEGF-2 binds more weakly. VEGFR-3 appears not to bind VEGF, but binds other members of the VEGF family (VEGF-C and -D). VEGFRs bind VEGFs with high affinity with the IG-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-2 is a major mediator of the mitogenic, angioge
Probab=97.46  E-value=0.00017  Score=39.73  Aligned_cols=64  Identities=17%  Similarity=0.403  Sum_probs=43.1

Q ss_pred             CCcEEEEEEEecCCC--CeeEEEecCCcceecC--Cc--ceE--EeeccceEEEeecCCCCCeEEEEEEEec
Q psy15390         26 EFNITLTCKAEGFPA--PEIKWRREDNQPISIN--KR--KKV--HMHYGEQLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        26 g~~v~l~C~~~~~~~--~~~~w~~~~~~~~~~~--~~--~~~--~~~~~~~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      |+++.|.|.+.+.+.  ..+.|..++.......  ..  ...  .....+.|.|.+++..|+|.|+|.+.|.
T Consensus         1 Ge~~~L~C~~~~~~~~~~~~~W~~p~~~~~~~~~~~~~~~~~~~~~~~~s~L~I~~~~~~DsG~Y~C~a~n~   72 (86)
T cd05862           1 GEKLVLNCTARTELNVGIDFQWDYPGKKEQRAKSVSENRRSLQEHTELSSTLTIENVTLSDLGRYTCTASSG   72 (86)
T ss_pred             CCcEEEEEEEEeCCCCcEEEEEEcCCcccccceecccccccccccceeeeEEEEecCCcccCEEEEEEEeec
Confidence            789999999987554  4679988443221111  10  000  0123457999999999999999999874


No 237
>PF07654 C1-set:  Immunoglobulin C1-set domain;  InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents C1-set domains, which are classical Ig-like domains resembling the antibody constant domain. C1-set domains are found almost exclusively in molecules involved in the immune system, such as in immunoglobulin light and heavy chains, in the major histocompatibility complex (MHC) class I and II complex molecules [, ], and in various T-cell receptors.; PDB: 3BVN_D 3BXN_A 3PWV_E 3L9R_F 2XFX_B 1BMG_A 1K8I_A 3M1B_G 3M17_C 1EXU_A ....
Probab=97.46  E-value=0.0018  Score=35.27  Aligned_cols=30  Identities=27%  Similarity=0.637  Sum_probs=22.8

Q ss_pred             cCCcEEEEEEEecC-CCC-eeEEEecCCcceec
Q psy15390         25 EEFNITLTCKAEGF-PAP-EIKWRREDNQPISI   55 (142)
Q Consensus        25 ~g~~v~l~C~~~~~-~~~-~~~w~~~~~~~~~~   55 (142)
                      .++.++|.|.+.+. |.. .+.|++ ++..+..
T Consensus         7 ~~~~~~L~C~v~~f~P~~i~v~W~~-~~~~~~~   38 (83)
T PF07654_consen    7 LGGSVTLTCLVSGFYPKDITVTWLK-NGKEVTE   38 (83)
T ss_dssp             STSEEEEEEEEEEEBSSTEEEEEEE-TTEEETT
T ss_pred             CCCCEEEEEEEEEEECCCcEEEEEe-ccceeee
Confidence            38899999999984 433 689999 7776643


No 238
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). Ig_CEACAM_D4:  immunoglobulin (Ig)-like domain 4 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the
Probab=97.45  E-value=0.00014  Score=40.42  Aligned_cols=24  Identities=25%  Similarity=0.551  Sum_probs=21.2

Q ss_pred             eEEEeecCCCCCeEEEEEEEecCC
Q psy15390         68 QLNITKISRTEMGAYLCIATKIGP   91 (142)
Q Consensus        68 ~l~i~~v~~~d~G~y~C~~~~~~~   91 (142)
                      .|.|.+++.+|+|.|.|.+.|...
T Consensus        56 ~L~I~~v~~~D~G~Y~C~a~N~~G   79 (91)
T cd05740          56 TLTFNNVTRSDTGHYQCEASNEVS   79 (91)
T ss_pred             EEEECcCChhhCEEEEEEEEcCCC
Confidence            489999999999999999998643


No 239
>cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins. Ig2_Nectin-2_like: domain similar to the second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112). Nectin-2 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through 4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion.  Nectin-2 and nectin-3 localize at Sertoli-spermatid junctions where they form heterophilic trans-interactions between the cells that are essential for the formation and maintenance of the junctions and for spermatid development.
Probab=97.45  E-value=0.0042  Score=34.87  Aligned_cols=22  Identities=23%  Similarity=0.431  Sum_probs=17.6

Q ss_pred             CCcEEEEEEEe-cCCCCeeEEEe
Q psy15390         26 EFNITLTCKAE-GFPAPEIKWRR   47 (142)
Q Consensus        26 g~~v~l~C~~~-~~~~~~~~w~~   47 (142)
                      -..+.+.|.+. +.|.+.|.|++
T Consensus        15 ~~~~va~C~s~~gkPaa~IsW~~   37 (95)
T cd07703          15 IPVPVAKCVSANGRPPARISWSS   37 (95)
T ss_pred             CccEEEEEEcCCCCCCcEEEEEc
Confidence            34577899875 57888999998


No 240
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig5_NCAM-1: The fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM) and heterophilic (NCAM-non-NCAM) interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (tr
Probab=97.44  E-value=0.0002  Score=40.29  Aligned_cols=24  Identities=33%  Similarity=0.577  Sum_probs=21.6

Q ss_pred             ceEEEeecCCCCCeEEEEEEEecC
Q psy15390         67 EQLNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        67 ~~l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      +.|.|.+++.+|+|.|+|.+.|..
T Consensus        63 ~~L~I~~v~~~D~G~Y~C~A~N~~   86 (97)
T cd05869          63 SSLTLKYIQYTDAGEYLCTASNTI   86 (97)
T ss_pred             EEEEEecCccCcCEEEEEEEecCC
Confidence            479999999999999999999853


No 241
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins. Ig5_NCAM-1 like: domain similar to the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic  (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM mole
Probab=97.44  E-value=0.00019  Score=40.10  Aligned_cols=24  Identities=25%  Similarity=0.422  Sum_probs=21.8

Q ss_pred             ceEEEeecCCCCCeEEEEEEEecC
Q psy15390         67 EQLNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        67 ~~l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      +.|.|.+++..|+|.|.|.+.|..
T Consensus        62 ~~L~I~~v~~~D~G~Y~C~a~N~~   85 (96)
T cd05732          62 SSLTLKDVQLTDAGRYDCEASNRI   85 (96)
T ss_pred             EEEEECcCCcCcCEEeEEEEEeCC
Confidence            479999999999999999999863


No 242
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins. Ig_Titin_like: immunoglobulin (Ig)-like domain found in titin-like proteins. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic, depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone.  It appears to function similarly to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching. Within the sarcomere, titin is also attached to or is associated with myosin binding protein C (MyBP-C). MyBP-C appears to contribute to the generation of passive tension by titin, and similar to titin has repeated Ig-like and FN-
Probab=97.43  E-value=0.00021  Score=38.00  Aligned_cols=22  Identities=23%  Similarity=0.327  Sum_probs=20.4

Q ss_pred             eEEEeecCCCCCeEEEEEEEec
Q psy15390         68 QLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        68 ~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      .|.|.++...|+|.|+|.+.|.
T Consensus        41 ~L~I~~~~~~D~G~Y~C~a~N~   62 (74)
T cd05748          41 SLVIKNAERSDSGKYTLTLKNP   62 (74)
T ss_pred             EEEECCCCcCcCEEEEEEEECC
Confidence            4899999999999999999985


No 243
>cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain. IgC_TCR_gamma;  immunoglobulin (Ig) constant (C) domain of the gamma chain of gamma-delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha-beta TCRs but a small subset contain gamma-delta TCRs. Alpha-beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma-delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma-delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds.
Probab=97.43  E-value=0.0015  Score=36.79  Aligned_cols=31  Identities=23%  Similarity=0.467  Sum_probs=22.7

Q ss_pred             EecCCcEEEEEEEecCCCC--eeEEEecCCccee
Q psy15390         23 VREEFNITLTCKAEGFPAP--EIKWRREDNQPIS   54 (142)
Q Consensus        23 ~~~g~~v~l~C~~~~~~~~--~~~w~~~~~~~~~   54 (142)
                      ...+..++|.|.+.+.-++  .+.|.+ +|+.+.
T Consensus        13 ~~~~~~~tL~C~a~gFyP~~I~v~W~k-ng~~~~   45 (96)
T cd07697          13 IEKQGQGIYLCLLENFFPDVIQVHWRE-GNSPSI   45 (96)
T ss_pred             HccCCCEEEEEEEEEEeCCCeEEEEEE-CCEECc
Confidence            3446779999999994333  579999 887653


No 244
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins. Ig1_Nectin-1_like: domain similar to the first immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111). Nectin-1 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. In addition nectins heterophilically trans-interact with other CAMs such as nectin-like molecules (Necls), nectin-1 for example, has been shown to trans-interact with Necl-1. Nectins also interact with various other proteins, including the actin filament (F-actin)-binding protein, afadin. Mutation in the human nectin-1 gene is 
Probab=97.42  E-value=0.00027  Score=40.01  Aligned_cols=25  Identities=12%  Similarity=0.472  Sum_probs=22.1

Q ss_pred             ceEEEeecCCCCCeEEEEEEEecCC
Q psy15390         67 EQLNITKISRTEMGAYLCIATKIGP   91 (142)
Q Consensus        67 ~~l~i~~v~~~d~G~y~C~~~~~~~   91 (142)
                      .+|.|.+++.+|+|.|.|.+.+.|.
T Consensus        63 aSi~i~nl~~~D~G~Y~C~v~t~P~   87 (99)
T cd05886          63 GTISLSRLELEDEGVYICEFATFPT   87 (99)
T ss_pred             ceEEEcCCccccCEEEEEEEEeCCC
Confidence            5799999999999999999988543


No 245
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B. Ig_Sema4B_like; Immunoglobulin (Ig)-like domain of Sema4B_like. Sema4B is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4B has extracellular Sema and Ig domains, a transmembrane domain and a short cytoplasmic domain. Sema4B has been shown to preferentially regulate the development of the postsynaptic specialization at the glutamatergic synapses. This cytoplasmic domain includes a PDZ-binding motif upon which the synaptic localization of Sem4B is dependent. Sema4B is a ligand of CLCP1, CLCP1 was identified in an expression profiling analysis, which compared a highly metastic lung cancer subline with its low metastic parental line. Sema4B was shown to promote CLCP1 endocytosis, and their interaction is a potential target for therapeutic intervention of metastasis.
Probab=97.42  E-value=0.00069  Score=37.20  Aligned_cols=47  Identities=17%  Similarity=0.126  Sum_probs=30.7

Q ss_pred             CeEEEEEEEecCCccEEEEEEEe--------ccccceEEEccCCCCCCeEEEEEEe
Q psy15390         79 MGAYLCIATKIGPLKIFWEIIFH--------MHYGEQLNITKISRTEMGAYLCIAT  126 (142)
Q Consensus        79 ~G~y~C~~~~~~~~~~~w~~~~~--------~~~~~~l~i~~~~~~d~g~y~C~a~  126 (142)
                      +-...|.... ..+.+.|.....        ......|.|..++.+|+|.|.|.+.
T Consensus        13 ~v~L~C~~~s-~~A~v~W~~ng~~l~~~~r~~~~~~GLlI~~~~~~dsG~Y~C~s~   67 (85)
T cd05872          13 DVVLPCQLRS-NLASPVWLFNGTPLNAQFSYRVGTDGLLILVTSPEHSGTYRCYSE   67 (85)
T ss_pred             CEEEECCCCC-CCccEEEEECCcccCCCcceEEeCCCCEEEECCHhhCEEEEEEEe
Confidence            3344565443 355788865321        1123347788999999999999997


No 246
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain. IgV_TCR_beta: immunoglobulin (Ig) variable domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the alpha chain of alpha/beta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=97.42  E-value=0.0016  Score=37.41  Aligned_cols=25  Identities=20%  Similarity=0.369  Sum_probs=21.4

Q ss_pred             cceEEEccCCCCCCeEEEEEEecCC
Q psy15390        105 GEQLNITKISRTEMGAYLCIATNNV  129 (142)
Q Consensus       105 ~~~l~i~~~~~~d~g~y~C~a~n~~  129 (142)
                      ...|.|.++..+|+|.|.|.+.+..
T Consensus        71 ~~~L~I~~~~~~Dsg~Y~Ca~~~~~   95 (110)
T cd05899          71 RSSLTIKSAEPEDSAVYLCASSLGG   95 (110)
T ss_pred             ccEEEECCCChhhCEEEEEEeeCCC
Confidence            3468999999999999999998653


No 247
>cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE). IgC_CH2_IgE: The second constant domain of the heavy chain of immunoglobulin E (IgE). The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma, and mu, all consisting of a variable domain (VH) and three (in alpha, delta, and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). The different classes of antibodies vary in their heavy chains; the IgE class has the epsilon type. This domain (Cepsilon2) of IgE is in place of the flexible hinge region found in IgG.
Probab=97.41  E-value=0.0016  Score=36.49  Aligned_cols=28  Identities=32%  Similarity=0.625  Sum_probs=21.3

Q ss_pred             cCCcEEEEEEEecC-CC-CeeEEEecCCcce
Q psy15390         25 EEFNITLTCKAEGF-PA-PEIKWRREDNQPI   53 (142)
Q Consensus        25 ~g~~v~l~C~~~~~-~~-~~~~w~~~~~~~~   53 (142)
                      .+..++|.|.+.+. |. -.+.|++ +|..+
T Consensus        13 ~~~~~~L~C~a~gFyP~~I~vtW~~-dg~~~   42 (94)
T cd05847          13 TSETIQLLCLISGYTPGTIEVEWLV-DGQVA   42 (94)
T ss_pred             CCCCEEEEEEEEeEECCCCEEEEEE-CCEEC
Confidence            45669999999994 33 3689999 88765


No 248
>cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH3: The third immunoglobulin constant domain (IgC) of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=97.40  E-value=0.00038  Score=39.18  Aligned_cols=29  Identities=17%  Similarity=0.445  Sum_probs=22.2

Q ss_pred             EEecCCcEEEEEEEecC-CCC--eeEEEecCCc
Q psy15390         22 AVREEFNITLTCKAEGF-PAP--EIKWRREDNQ   51 (142)
Q Consensus        22 ~~~~g~~v~l~C~~~~~-~~~--~~~w~~~~~~   51 (142)
                      .+..|+.++|.|.+.+. .++  .+.|.+ ++.
T Consensus        10 ~l~~~~~~tLtC~v~gf~yP~~i~v~W~r-~~~   41 (96)
T cd07696          10 QLLLTKSVKLTCLVTNLTSPEGVNVTWTR-GSG   41 (96)
T ss_pred             HhccCCCeEEEEEEeCCCCCCCcEEEEEE-CCe
Confidence            35568999999999998 333  579999 654


No 249
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI. IG_FcalphaRI : immunoglobulin (IG)-like domain of of FcalphaRI. FcalphaRI (CD89) is an IgA-specific receptor that is expressed on monocytes, eosinophils, neutrophils and macrophages. FcalphaRI mediates IgA-induced immune effector responses such as phagocytosis, antibody-dependent cell-mediated cytotoxicity and respiratory burst. Both monomeric and dimeric IgA can bind to FcalphaRI, and monomeric or dimeric IgA immune complexes can activate phagocytosis and other immune responses through the clustering of FcalphaRI. The Fc RI ectodomain is comprised of two Ig-like domains oriented at about 90 degree to each another.
Probab=97.38  E-value=0.002  Score=36.01  Aligned_cols=37  Identities=16%  Similarity=0.336  Sum_probs=26.6

Q ss_pred             cceEEEccCCCCCCeEEEEEEecCCCC----CeeeEEEEEE
Q psy15390        105 GEQLNITKISRTEMGAYLCIATNNVPP----SVSKRITVDV  141 (142)
Q Consensus       105 ~~~l~i~~~~~~d~g~y~C~a~n~~~~----~~s~~~~l~V  141 (142)
                      ...|.|..++.+|+|.|.|.......+    ..|..+.|.|
T Consensus        54 ~a~f~I~~~~~~~~G~Y~C~~~~~~~~~~wS~~Sdpl~l~V   94 (94)
T cd05711          54 QASFPLGPVTPAHAGTYRCYGSYNHSLYEWSAPSDPLKIVV   94 (94)
T ss_pred             EEEEEecCCCcccCEEEEEEEECCCCCccccCCCCCeEEeC
Confidence            346899999999999999997532211    4566776654


No 250
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig3_Contactin-1: Third Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=97.36  E-value=0.00023  Score=39.27  Aligned_cols=24  Identities=33%  Similarity=0.490  Sum_probs=20.9

Q ss_pred             eEEEeecCCCCCeEEEEEEEecCC
Q psy15390         68 QLNITKISRTEMGAYLCIATKIGP   91 (142)
Q Consensus        68 ~l~i~~v~~~d~G~y~C~~~~~~~   91 (142)
                      .|.|.+++.+|+|.|.|.+.|...
T Consensus        54 ~L~I~~v~~~D~G~Y~C~A~N~~G   77 (88)
T cd05851          54 VLKIFNIQPEDEGTYECEAENIKG   77 (88)
T ss_pred             EEEECcCChhhCEEEEEEEEcCCC
Confidence            488999999999999999998643


No 251
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan. Ig_Neurocan: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, the CSPG aggrecan (not included in this group) forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Unlike aggrecan which is widely distributed in connective tissue and extracellular matrices, neurocan is localized almost exclusively in nervous tissue. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many differen
Probab=97.35  E-value=0.001  Score=38.39  Aligned_cols=63  Identities=19%  Similarity=0.382  Sum_probs=40.8

Q ss_pred             CCcEEEEEEEecCC-------CCeeEEEecC----Ccce------------ecCCcceEEeec------cceEEEeecCC
Q psy15390         26 EFNITLTCKAEGFP-------APEIKWRRED----NQPI------------SINKRKKVHMHY------GEQLNITKISR   76 (142)
Q Consensus        26 g~~v~l~C~~~~~~-------~~~~~w~~~~----~~~~------------~~~~~~~~~~~~------~~~l~i~~v~~   76 (142)
                      |++++|+|...-.|       .+.+.|++..    .+..            ....+.|.....      +.+|.|.+++.
T Consensus         2 ~~~v~LpC~~~~~p~~~~~~~~~~I~W~k~~~~~~~~~~~v~v~~~~~~~~~~~y~gRvsl~~~~~~~~~asL~i~nv~~   81 (110)
T cd05902           2 SSSVLLPCVFTLPPSASSPPEGPRIKWTKLRPASGQKQRPVLVARDNVVRVAKAFQGRVSLPGYPKNRYNASLVLSRLRY   81 (110)
T ss_pred             CCcEEEeeEEEcCccccCCCCCCEEEEEEeCCCCCceEEEEEECCCCcEEEchhcccEEEeecCCCCCceEEEEECCCCH
Confidence            78899999965322       3578998731    1111            111123333322      34799999999


Q ss_pred             CCCeEEEEEEEe
Q psy15390         77 TEMGAYLCIATK   88 (142)
Q Consensus        77 ~d~G~y~C~~~~   88 (142)
                      +|+|.|.|.+..
T Consensus        82 ~D~G~Y~C~v~~   93 (110)
T cd05902          82 SDSGTYRCEVVL   93 (110)
T ss_pred             HHCEEEEEEEEE
Confidence            999999998875


No 252
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Ig_Perlecan_D2_like: the immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Perlecan consists of five domains. Domain I has three putative heparan sulfate attachment sites; domain II has four LDL receptor-like repeats, and one Ig-like repeat; domain III resembles the short arm of laminin chains; domain IV has multiple Ig-like repeats (21 repeats in human perlecan); and domain V resembles the globular G domain of the laminin A chain and internal repeats of EGF. Perlecan may participate in a variety of biological functions including cell binding, LDL-metabolism, basement membrane assembly and selective permeability, calcium binding, and growth- and neurite-promoting activities.
Probab=97.34  E-value=0.00022  Score=38.38  Aligned_cols=23  Identities=30%  Similarity=0.593  Sum_probs=20.6

Q ss_pred             eEEEeecCCCCCeEEEEEEEecC
Q psy15390         68 QLNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        68 ~l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      .|.|.+++.+|+|.|.|.+.|..
T Consensus        43 ~L~I~~v~~~D~G~Y~C~a~N~~   65 (78)
T cd05743          43 TLTIRDVKESDQGAYTCEAINTR   65 (78)
T ss_pred             EEEECCCChHHCEEEEEEEEecC
Confidence            48999999999999999998853


No 253
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). Ig_C5_MyBP_C : the C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). MyBP_C consists of repeated domains, Ig and fibronectin type 3, and various linkers. Three isoforms of MYBP_C exist and are included in this group: cardiac(c), and fast and slow skeletal muscle (s) MyBP_C. cMYBP_C has insertions between and inside domains and an additional cardiac-specific Ig domain at the N-terminus. For cMYBP_C  an interaction has been demonstrated between this C5 domain and the Ig C8 domain.
Probab=97.34  E-value=0.00032  Score=38.58  Aligned_cols=24  Identities=21%  Similarity=0.219  Sum_probs=21.7

Q ss_pred             cceEEEeecCCCCCeEEEEEEEec
Q psy15390         66 GEQLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        66 ~~~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      .+.|.|.++..+|+|.|.|.+.|.
T Consensus        51 ~~~L~I~~~~~~D~G~Y~c~a~N~   74 (86)
T cd05894          51 LSSFVIEGAEREDEGVYTITVTNP   74 (86)
T ss_pred             eEEEEECCCccCcCEEEEEEEEeC
Confidence            356999999999999999999985


No 254
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican. Ig_Versican: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, the CSPG aggrecan (not included in this group) forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Like aggrecan, versican has a wide distribution in connective tissue and extracellular matrices. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA
Probab=97.34  E-value=0.0043  Score=36.17  Aligned_cols=23  Identities=26%  Similarity=0.495  Sum_probs=20.4

Q ss_pred             ceEEEeecCCCCCeEEEEEEEec
Q psy15390         67 EQLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        67 ~~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      .+|.|.+++..|+|.|.|.+...
T Consensus        79 asL~i~~v~~sD~G~Y~C~V~~g  101 (117)
T cd05901          79 ASLTIVKLRASDAGVYRCEVMHG  101 (117)
T ss_pred             eEEEEcccccccCEEEEEEEEEC
Confidence            47999999999999999988753


No 255
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. IG4_PDGFR-alpha: The fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFR alpha binds to all three PDGFs, whereas the PDGFR beta (not included in this group) binds only to PDGF-B. PDGF alpha is organized as an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFR alpha and PDGFR beta are essential for normal development.
Probab=97.33  E-value=0.00021  Score=40.56  Aligned_cols=26  Identities=19%  Similarity=0.419  Sum_probs=22.8

Q ss_pred             ccceEEEeecCCCCCeEEEEEEEecC
Q psy15390         65 YGEQLNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        65 ~~~~l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      ..+.|.|.+++.+|+|.|+|.+.|..
T Consensus        63 ~~s~L~I~~v~~~D~G~Ytc~A~N~~   88 (101)
T cd05859          63 YVSKLKLIRAKEEDSGLYTALAQNED   88 (101)
T ss_pred             eccEEEEeeCCHHHCEEEEEEEEcCC
Confidence            34679999999999999999999863


No 256
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily. Ig_3: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=97.31  E-value=0.00031  Score=37.86  Aligned_cols=25  Identities=28%  Similarity=0.337  Sum_probs=22.2

Q ss_pred             ccceEEEeecCCCCCeEEEEEEEec
Q psy15390         65 YGEQLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        65 ~~~~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      ..+.|.|.+++.+|+|.|.|.+.|.
T Consensus        45 ~~~~L~I~~~~~~D~G~Y~C~a~N~   69 (81)
T cd05765          45 NIGQLVIYNAQPQDAGLYTCTARNS   69 (81)
T ss_pred             cccEEEEccCCcccCEEEEEEEecC
Confidence            3457999999999999999999985


No 257
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Ig_Myomesin_like_C: domain similar to the C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Myomesin and M-protein are both structural proteins localized to the M-band, a transverse structure in the center of the sarcomere, and are candidates for M-band bridges. Both proteins are modular, consisting mainly of repetitive Ig-like and fibronectin type III (FnIII) domains. Myomesin is expressed in all types of vertebrate striated muscle; M-protein has a muscle-type specific expression pattern. Myomesin is present in both slow and fast fibers; M-protein is present only in fast fibers. It has been suggested that myomesin acts as a molecular spring with alternative splicing as a means of modifying its elasticity.
Probab=97.30  E-value=0.0003  Score=39.10  Aligned_cols=22  Identities=23%  Similarity=0.373  Sum_probs=20.2

Q ss_pred             eEEEeecCCCCCeEEEEEEEec
Q psy15390         68 QLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        68 ~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      .|.|.+++.+|+|.|+|.+.|.
T Consensus        59 ~L~I~~v~~~D~G~Y~C~a~N~   80 (92)
T cd05737          59 SLTIKGVSSEDSGKYGIVVKNK   80 (92)
T ss_pred             EEEEccCChhhCEEEEEEEEEC
Confidence            3899999999999999999984


No 258
>cd04968 Ig3_Contactin_like Third Ig domain of contactin. Ig3_Contactin_like: Third Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=97.28  E-value=0.00038  Score=38.30  Aligned_cols=23  Identities=35%  Similarity=0.534  Sum_probs=20.6

Q ss_pred             eEEEeecCCCCCeEEEEEEEecC
Q psy15390         68 QLNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        68 ~l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      .|.|.+++.+|+|.|.|.+.|..
T Consensus        54 ~L~i~~v~~~D~G~Y~C~a~N~~   76 (88)
T cd04968          54 VLKIPNIQFEDEGTYECEAENIK   76 (88)
T ss_pred             EEEECCCCcccCEEEEEEEEECC
Confidence            48999999999999999998853


No 259
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins. Ig1_Nectin-4_like: domain similar to the first immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor). Nectin-4 belongs to the nectin family, which is comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which participate in adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. For example nectin-4 trans-interacts with nectin-1. Nectin-4 has also been shown to interact with the actin filament-binding protein, afadin. Unlike the other nectins, which are widely expressed in adult tissues, nectin-4 is mainly expressed during embryogenesis, and is not detected in normal adult 
Probab=97.28  E-value=0.00045  Score=39.12  Aligned_cols=63  Identities=17%  Similarity=0.351  Sum_probs=39.6

Q ss_pred             cEEEEEEEecCC---CCeeEEEecCCc--c--e---ec--------CCcceEEee-----ccceEEEeecCCCCCeEEEE
Q psy15390         28 NITLTCKAEGFP---APEIKWRREDNQ--P--I---SI--------NKRKKVHMH-----YGEQLNITKISRTEMGAYLC   84 (142)
Q Consensus        28 ~v~l~C~~~~~~---~~~~~w~~~~~~--~--~---~~--------~~~~~~~~~-----~~~~l~i~~v~~~d~G~y~C   84 (142)
                      +++|+|......   ...+.|++....  .  +   ..        ....|....     .+..|.|.+++.+|+|.|.|
T Consensus         2 ~v~L~C~~~~~~~~~~~~v~W~k~~~~~~~~~i~~~~~~~~~~~~~~~~~Rv~f~~~~~~~~~sL~I~nv~~sD~GtY~C   81 (100)
T cd05888           2 DTRLPCRYNVSDGETVVQVLWIRENAGGVEEEIALLHFKYGQTEFHAYEGRVRFETPNPIADGALILRNAVQADEGKYKC   81 (100)
T ss_pred             CEEEEeEEecCCCCcEEEEEEEEccCCCCcEEEEEEeccCCcccCCCccCcEEEeCCCCCCceEEEEecCccccceEEEE
Confidence            689999986543   237889884211  1  1   00        111122222     23479999999999999999


Q ss_pred             EEEecC
Q psy15390         85 IATKIG   90 (142)
Q Consensus        85 ~~~~~~   90 (142)
                      .+.+.+
T Consensus        82 ~v~~~p   87 (100)
T cd05888          82 RVITFP   87 (100)
T ss_pred             EEEeCC
Confidence            987743


No 260
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). Ig1_Necl-1: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-1, Necl-1 (also known as celll adhesion molecule 3 (CADM3), SynCAM2, IGSF4). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the format
Probab=97.27  E-value=0.00034  Score=39.25  Aligned_cols=22  Identities=18%  Similarity=0.433  Sum_probs=20.3

Q ss_pred             ceEEEeecCCCCCeEEEEEEEe
Q psy15390         67 EQLNITKISRTEMGAYLCIATK   88 (142)
Q Consensus        67 ~~l~i~~v~~~d~G~y~C~~~~   88 (142)
                      ..|.|.+++.+|+|.|+|.+..
T Consensus        62 ~~L~I~nV~~~D~G~YtC~~~t   83 (95)
T cd05882          62 LIISISNVQLSDEGEYTCSIFT   83 (95)
T ss_pred             EEEEECCCCcccCEEEEEEEEe
Confidence            5799999999999999999875


No 261
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins. Ig1_DNAM-1_like: domain similar to the first immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226). DNAM-1 is a transmembrane protein having two Ig-like domains. It is an adhesion molecule which plays a part in tumor-directed cytotoxicity and adhesion in natural killer (NK) cells and T lymphocytes. It has been shown to regulate the NK cell killing of several tumor types, including myeloma cells and ovarian carcinoma cells. DNAM-1 interacts specifically with poliovirus receptor (PVR; CD155) and nectin -2 (CD211), other members of the Ig superfamily. DNAM-1 is expressed in most peripheral T cells, NK cells, monocytes and a subset of B lymphocytes.
Probab=97.26  E-value=0.00054  Score=38.52  Aligned_cols=66  Identities=15%  Similarity=0.271  Sum_probs=41.7

Q ss_pred             CcEEEEEEEecC-CCCeeEEEecCCc---ce-----------ecCCcceEEee----ccceEEEeecCCCCCeEEEEEEE
Q psy15390         27 FNITLTCKAEGF-PAPEIKWRREDNQ---PI-----------SINKRKKVHMH----YGEQLNITKISRTEMGAYLCIAT   87 (142)
Q Consensus        27 ~~v~l~C~~~~~-~~~~~~w~~~~~~---~~-----------~~~~~~~~~~~----~~~~l~i~~v~~~d~G~y~C~~~   87 (142)
                      ++++|.|..... ...++.|.+..+.   .+           ......|+...    .+.+|.|.|++.+|+|.|.|.+.
T Consensus         1 ~~vtL~C~~~~~~~~~qV~W~k~~~~~~~~iavy~~~~g~~~~~~y~~Rv~f~~~~~~d~sI~i~nvt~~D~G~Y~C~~~   80 (96)
T cd05889           1 EKMKLECVYPKTGVLIQVSWTKHNGSHKENIAVYHPIYGMHIEDKYRGRVYFLNSTREDMSLSFNNATEEDVGLYCCSLV   80 (96)
T ss_pred             CCEEEEeEcCCCCcEEEEEEEEcCCCCCceEEEEECCCCCEECccccCeEEEecCCCCccEEEEcCCCcccCEEEEEEEE
Confidence            468899987542 2346889874321   11           01111233322    23579999999999999999998


Q ss_pred             ecCCc
Q psy15390         88 KIGPL   92 (142)
Q Consensus        88 ~~~~~   92 (142)
                      ..|.-
T Consensus        81 t~P~g   85 (96)
T cd05889          81 TYPQG   85 (96)
T ss_pred             eCCCC
Confidence            76543


No 262
>cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins. Ig2_ VCAM-1_like: domain similar to the second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106). During the inflammation process, these molecules recruit leukocytes onto the vascular endothelium before extravasation to the injured tissues. The interaction of VCAM-1 binding to the beta1 integrin very late antigen (VLA-4) expressed by lymphocytes and monocytes mediates the adhesion of leucocytes to blood vessel walls, and regulates migration across the endothelium. During metastasis, some circulating cancer cells extravasate to a secondary site by a similar process.  VCAM-1 may be involved in organ targeted tumor metastasis and may also act as host receptors for viruses and parasites.  VCAM-1 contains seven Ig domains.
Probab=97.26  E-value=0.0024  Score=35.88  Aligned_cols=30  Identities=20%  Similarity=0.378  Sum_probs=22.2

Q ss_pred             EecCCcEEEEEEEecC-CC--CeeEEEecCCcce
Q psy15390         23 VREEFNITLTCKAEGF-PA--PEIKWRREDNQPI   53 (142)
Q Consensus        23 ~~~g~~v~l~C~~~~~-~~--~~~~w~~~~~~~~   53 (142)
                      +.+|..+++.|.+.+. |.  ..+.|++ +...+
T Consensus        12 l~~G~~vtv~C~v~~v~P~~~l~v~Llk-G~~~l   44 (99)
T cd07689          12 LEEGKPVTVKCEVPDVYPFDRLEIELLK-GETLL   44 (99)
T ss_pred             ccCCceEEEEEEecCcccCCceEEEEec-Cccee
Confidence            4789999999999763 33  4688998 55544


No 263
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins. Ig1_Nectin-3_like: domain similar to the first immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3). Nectin-3 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which participate in adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. For example, during spermatid development, the nectin-3,-2 trans-interaction is required for the formation of Sertoli cell-spermatid junctions in testis, and during morphogenesis of the ciliary body, the nectin-3,-1 trans-interaction is important for apex-apex adhesion between the pigment and non-pigment layers of the ciliary epithelia. Nectins also
Probab=97.20  E-value=0.00068  Score=38.11  Aligned_cols=65  Identities=15%  Similarity=0.409  Sum_probs=41.3

Q ss_pred             CcEEEEEEEecCC-CCeeEEEecCCc---cee-----------cCCcceEEe----eccceEEEeecCCCCCeEEEEEEE
Q psy15390         27 FNITLTCKAEGFP-APEIKWRREDNQ---PIS-----------INKRKKVHM----HYGEQLNITKISRTEMGAYLCIAT   87 (142)
Q Consensus        27 ~~v~l~C~~~~~~-~~~~~w~~~~~~---~~~-----------~~~~~~~~~----~~~~~l~i~~v~~~d~G~y~C~~~   87 (142)
                      ++++|+|.....+ ..++.|.+..+.   .+.           .....|...    ..+.+|.|.+++.+|+|.|.|.+.
T Consensus         1 ~~vtL~C~~~~~~~~~qV~W~k~~~~~~~~ia~y~~~~g~~~~~~y~~Rv~~~~~~~~d~sl~i~nv~~~D~G~Y~C~v~   80 (96)
T cd05887           1 KNVTLKCRIQVNETITQSSWEKIHGKGSVTLAVHHPMYGISIQPDYQGRVSFKNYSLLDATIMLENVGFSDIGVYICKAV   80 (96)
T ss_pred             CCEEEEEEecCCCcEEEEEEEEcCCCCcEEEEEEcccCCcccChhhCCcEEEcCCCCCccEEEEeCCCccccEEEEEEEE
Confidence            4689999986433 337899874221   111           011123222    124579999999999999999988


Q ss_pred             ecCC
Q psy15390         88 KIGP   91 (142)
Q Consensus        88 ~~~~   91 (142)
                      ..|.
T Consensus        81 tfP~   84 (96)
T cd05887          81 TFPL   84 (96)
T ss_pred             eCCC
Confidence            7543


No 264
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig1_FGFR: The first immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for all FGFs.
Probab=97.19  E-value=0.00043  Score=37.34  Aligned_cols=21  Identities=19%  Similarity=0.504  Sum_probs=19.0

Q ss_pred             EEEeecCCCCCeEEEEEEEec
Q psy15390         69 LNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        69 l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      |.|.+++.+|+|.|+|.+.|.
T Consensus        47 L~I~~~~~~DsG~Y~C~a~n~   67 (79)
T cd04973          47 VQIKDAVPRDSGLYACVTSSP   67 (79)
T ss_pred             EEECCCChhhCEEEEEEEeCC
Confidence            778999999999999999874


No 265
>cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH1: The first immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fab antigen-binding fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=97.17  E-value=0.0034  Score=35.21  Aligned_cols=27  Identities=26%  Similarity=0.546  Sum_probs=20.7

Q ss_pred             cCCcEEEEEEEecCCC--CeeEEEecCCcc
Q psy15390         25 EEFNITLTCKAEGFPA--PEIKWRREDNQP   52 (142)
Q Consensus        25 ~g~~v~l~C~~~~~~~--~~~~w~~~~~~~   52 (142)
                      .++.++|.|.+.+.-+  -.+.|++ +|+.
T Consensus        15 ~~~~~~L~C~a~gFyP~~i~vtW~k-~g~~   43 (95)
T cd04985          15 SSDSVTLGCLATGFLPEPVTFTWNS-GSNS   43 (95)
T ss_pred             CCCcEEEEEEEeeEECCCcEEEEeE-CCEE
Confidence            4667999999998433  3678999 8775


No 266
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like. Ig_SLAM-CD84_like_N: The N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like. The SLAM family is a group of immune-cell specific receptors that can regulate both adaptive and innate immune responses. Members of this group include proteins such as CD84, SLAM (CD150), Ly-9 (CD229), NTB-A (ly-108, SLAM6), 19A (CRACC), and SLAMF9. The genes coding for the SLAM family are nested on chromosome 1, in humans at 1q23, and in mice at 1H2. The SLAM family is a subset of the CD2 family, which also includes CD2 and CD58 located on chromosome 1 at 1p13 in humans. In mice, CD2 is located on chromosome 3, and there is no CD58 homolog. The SLAM family proteins are organized as an extracellular domain with either two or four Ig-like domains, a single transmembrane segment, and a cytoplasmic region 
Probab=97.17  E-value=0.001  Score=37.47  Aligned_cols=67  Identities=13%  Similarity=0.167  Sum_probs=44.9

Q ss_pred             ecCCcEEEEEEEec-CCCCeeEEEecCCccee-cC--------------CcceEEeec-cceEEEeecCCCCCeEEEEEE
Q psy15390         24 REEFNITLTCKAEG-FPAPEIKWRREDNQPIS-IN--------------KRKKVHMHY-GEQLNITKISRTEMGAYLCIA   86 (142)
Q Consensus        24 ~~g~~v~l~C~~~~-~~~~~~~w~~~~~~~~~-~~--------------~~~~~~~~~-~~~l~i~~v~~~d~G~y~C~~   86 (142)
                      ..|++|+|+|.... .....+.|++ ....+. ..              .+.|+.... +.+|.|.+++.+|+|.|.|.+
T Consensus         2 ~~G~sVtL~c~~~~~~~~~~v~W~~-~~~~~i~~~~~~~~~~~~~~~~~f~~R~~~~~~~~sL~I~~~~~~DsG~Y~c~v   80 (97)
T cd05775           2 ILGGSVTLPLNIPDGTEIESITWSF-NTSLAIITPGEETAPEIIVTDPSYKERVNFSQNDYSLQISNLKMEDAGSYRAEI   80 (97)
T ss_pred             ccCCeEEEeCCCCCCcEEEEEEEec-CCEeEEEecCCCCCCccEEeCCCceeeEEecCCceeEEECCCchHHCEEEEEEE
Confidence            36999999998754 3445789998 322211 10              012233333 357999999999999999998


Q ss_pred             EecCC
Q psy15390         87 TKIGP   91 (142)
Q Consensus        87 ~~~~~   91 (142)
                      ...+.
T Consensus        81 ~~~~~   85 (97)
T cd05775          81 NTKNG   85 (97)
T ss_pred             EcCCC
Confidence            87654


No 267
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3). Ig2_VEGFR-3: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-3 (Flt-4) binds two members of the VEGF family (VEGF-C and -D) and is involved in tumor angiogenesis and growth.
Probab=97.14  E-value=0.00032  Score=36.69  Aligned_cols=22  Identities=18%  Similarity=0.373  Sum_probs=19.6

Q ss_pred             EEEeecCCCCCeEEEEEEEecC
Q psy15390         69 LNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        69 l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      |.|.++..+|+|.|+|.+.|..
T Consensus        33 L~i~~v~~~D~G~YtC~a~N~~   54 (67)
T cd05863          33 LQIKDVTEASAGTYTLVLWNSA   54 (67)
T ss_pred             EEECCCCHHHCEEEEEEEEECC
Confidence            6788899999999999999863


No 268
>PHA02982 hypothetical protein; Provisional
Probab=97.12  E-value=0.028  Score=36.00  Aligned_cols=117  Identities=9%  Similarity=0.169  Sum_probs=63.4

Q ss_pred             eEEecCCcEEEEEEEec-CCCCeeEEEecCCcceecCCc------------------ceEEe-eccceEEEeecCCCCCe
Q psy15390         21 VAVREEFNITLTCKAEG-FPAPEIKWRREDNQPISINKR------------------KKVHM-HYGEQLNITKISRTEMG   80 (142)
Q Consensus        21 ~~~~~g~~v~l~C~~~~-~~~~~~~w~~~~~~~~~~~~~------------------~~~~~-~~~~~l~i~~v~~~d~G   80 (142)
                      +.+..++.|.|.|.... .......|+..++.-+.....                  .+... ...++|+|.++.....|
T Consensus        34 v~a~vd~~V~L~C~~~~~~~i~~~~W~~~~~~~la~~~~~~~~iN~~~y~~~~~kd~y~~sv~g~~STLTIkk~~i~N~G  113 (251)
T PHA02982         34 VNATVDQEVKLQCLFKDADEISRAMWKGDAGFMLAQEANGGTGINAFNYVPGPYKDKYALSVSGNSSTFTMKKPDPQNLG  113 (251)
T ss_pred             hhccCCCcEEEEecCCCcchhhhheeeCCCCeEEEeeecCcceeccccccCCccceeEEEEEeccceeEEeccCCcccCC
Confidence            34566999999998533 223357798855544432111                  01111 12357999999999999


Q ss_pred             EEEEEEEecCCccEEEEEEEeccccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEE
Q psy15390         81 AYLCIATKIGPLKIFWEIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRIT  138 (142)
Q Consensus        81 ~y~C~~~~~~~~~~~w~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~  138 (142)
                      .|+|++.......-.-.+-........+..-. ...+....+|.+-...++-..|.+.
T Consensus       114 CYtc~~ks~~~k~E~c~kCl~V~~~~V~~~W~-e~nNeT~V~CyVgS~~~dvp~W~V~  170 (251)
T PHA02982        114 CFTCEAKDAEGKEETCEKCLEIQKEDILYVVE-EHNNETIITCFVGSKHGDVPRFIVA  170 (251)
T ss_pred             ceEEEEecCCCchheeheeeeEecceEEEEEE-ecCCeEEEEEEEEeccCCCccEEEe
Confidence            99999886432222111212221111111111 2344557788887666553456554


No 269
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig3_NCAM-1_like: domain similar to the third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1,and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the
Probab=97.11  E-value=0.00058  Score=38.12  Aligned_cols=24  Identities=21%  Similarity=0.505  Sum_probs=21.0

Q ss_pred             eEEEeecCCCCCeEEEEEEEecCC
Q psy15390         68 QLNITKISRTEMGAYLCIATKIGP   91 (142)
Q Consensus        68 ~l~i~~v~~~d~G~y~C~~~~~~~   91 (142)
                      .|.|.+++.+|.|.|+|.+.|...
T Consensus        59 ~L~I~~v~~~D~G~Y~C~a~N~~G   82 (95)
T cd05730          59 EMTILDVDKLDEAEYTCIAENKAG   82 (95)
T ss_pred             EEEECCCChhhCEEEEEEEEcCCC
Confidence            488999999999999999998643


No 270
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins. Ig_P0ex-like: domain similar to the immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an extracellular Ig domain. The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin. This group also contains the Ig domain of Sodium channel subunit beta-2 
Probab=97.10  E-value=0.00092  Score=38.86  Aligned_cols=25  Identities=20%  Similarity=0.343  Sum_probs=21.9

Q ss_pred             ceEEEeecCCCCCeEEEEEEEecCC
Q psy15390         67 EQLNITKISRTEMGAYLCIATKIGP   91 (142)
Q Consensus        67 ~~l~i~~v~~~d~G~y~C~~~~~~~   91 (142)
                      .+|.|.+++.+|+|.|.|.+.+.+.
T Consensus        80 ~sL~I~~v~~~D~G~Y~C~v~~~~~  104 (116)
T cd05715          80 ASIVIHNLQFTDNGTYTCDVKNPPD  104 (116)
T ss_pred             eEEEEeeCCcccCEEEEEEEEeCCC
Confidence            4699999999999999999987543


No 271
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. Ig_CD3_gamma_delta; immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. CD3 is a T cell surface receptor that is associated with alpha/beta T cell receptors (TCRs).  The CD3 complex consists of one gamma, one delta, two epsilon, and two zeta chains.  The CD3 subunits form heterodimers as gamma/epsilon, delta/epsilon, and zeta/zeta.  The gamma, delta, and epsilon chains each contain an extracellular Ig domain, whereas the extracellular domains of the zeta chains are very small and have unknown structure. The CD3 domain participates in intracellular signalling once the TCR has bound an MHC/antigen complex.
Probab=97.09  E-value=0.0018  Score=33.73  Aligned_cols=49  Identities=20%  Similarity=0.515  Sum_probs=33.7

Q ss_pred             CCcEEEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEe
Q psy15390         26 EFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATK   88 (142)
Q Consensus        26 g~~v~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~   88 (142)
                      ..+|.|.|..    ...+.|++ +......        . ..++.+-.+.....|.|.|.+.+
T Consensus         6 ~~~V~L~C~~----~tsi~W~k-G~~~~~~--------~-~~tlnLGs~~~DPRG~Y~C~~s~   54 (69)
T cd07691           6 EGKVFLKCNG----ATNITWKK-GKEILEV--------S-NTLLDLGSRINDPRGTYSCKESE   54 (69)
T ss_pred             CceEEEEecC----CCcEEEec-Ccccccc--------c-ccEEeccCcccCCCcceEecCcc
Confidence            4579999965    24699998 5443321        1 44677777778888889997755


No 272
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins. Ig5_Titin_like: domain similar to the M5, fifth immunoglobulin (Ig)-like domain from the human titin C terminus. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic; depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone, and appears to function similar to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching.
Probab=97.09  E-value=0.00074  Score=37.51  Aligned_cols=23  Identities=17%  Similarity=0.443  Sum_probs=20.7

Q ss_pred             ceEEEeecCCCCCeEEEEEEEec
Q psy15390         67 EQLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        67 ~~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      +.|.|.+++.+|+|.|.|.+.|.
T Consensus        59 ~~L~i~~~~~~D~G~Y~C~a~N~   81 (92)
T cd05747          59 STFEISKVQMSDEGNYTVVVENS   81 (92)
T ss_pred             eEEEECCCCcccCEeEEEEEEcC
Confidence            35899999999999999999985


No 273
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). Ig8_MLCK: the eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). MLCK is a key regulator of different forms of cell motility involving actin and myosin II.  Agonist stimulation of smooth muscle cells increases cytosolic Ca2+, which binds calmodulin.  This Ca2+-calmodulin complex in turn binds to and activates MLCK. Activated MLCK leads to the phosphorylation of the 20 kDa myosin regulatory light chain (RLC) of myosin II and the stimulation of actin-activated myosin MgATPase activity. MLCK is widely present in vertebrate tissues; it phosphorylates the 20 kDa RLC of both smooth and nonmuscle myosin II. Phosphorylation leads to the activation of the myosin motor domain and altered structural properties of myosin II. In smooth muscle MLCK it is involved in initiating contraction. In nonmuscle cells, MLCK may participate in cell division and cell motility; it has
Probab=97.09  E-value=0.00058  Score=38.52  Aligned_cols=23  Identities=22%  Similarity=0.205  Sum_probs=20.8

Q ss_pred             eEEEeecCCCCCeEEEEEEEecC
Q psy15390         68 QLNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        68 ~l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      .|.|.++...|+|.|+|.+.|..
T Consensus        57 ~L~I~~~~~~D~G~Ytc~a~N~~   79 (98)
T cd05762          57 KLTITEGQQEHCGCYTLEVENKL   79 (98)
T ss_pred             EEEECCCChhhCEEEEEEEEcCC
Confidence            48999999999999999999863


No 274
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins. Ig2_Follistatin_like: domain similar to the second immunoglobulin (Ig)-like domain found in a follistatin-like molecule encoded by the CNS-related Mahya gene. Mahya genes have been retained in certain Bilaterian branches during evolution.  They are conserved in Hymenoptera and Deuterostomes, but are absent from other metazoan species such as fruit fly and nematode. Mahya proteins are secretory, with a follistatin-like domain (Kazal-type serine/threonine protease inhibitor domain and EF-hand calcium-binding domain), two Ig-like domains, and a novel C-terminal domain. Mahya may be involved in learning and memory and in processing of sensory information in Hymenoptera and vertebrates. Follistatin is a secreted, multidomain protein that binds activins with high affinity and antagonizes their signaling.
Probab=97.08  E-value=0.00084  Score=35.80  Aligned_cols=22  Identities=36%  Similarity=0.726  Sum_probs=19.8

Q ss_pred             eEEEeecCCCCCeEEEEEEEec
Q psy15390         68 QLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        68 ~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      .|.|.++..+|.|.|+|.+.|.
T Consensus        40 ~l~I~~~~~~D~G~Y~C~a~N~   61 (76)
T cd05736          40 ELHISNVRYEDTGAYTCIAKNE   61 (76)
T ss_pred             EEEECcCCcccCEEEEEEEEcC
Confidence            3789999999999999999985


No 275
>PF07679 I-set:  Immunoglobulin I-set domain;  InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents I-set domains, which are found in several cell adhesion molecules, including vascular (VCAM), intercellular (ICAM), neural (NCAM) and mucosal addressin (MADCAM) cell adhesion molecules, as well as junction adhesion molecules (JAM). I-set domains are also present in several other diverse protein families, including several tyrosine-protein kinase receptors, the hemolymph protein hemolin, the muscle proteins titin, telokin, and twitchin, the neuronal adhesion molecule axonin-1 [], and the signalling molecule semaphorin 4D that is involved in axonal guidance, immune function and angiogenesis [].; PDB: 3MTR_A 2EDK_A 3DMK_B 1KOA_A 3NCM_A 2NCM_A 2V9Q_A 2CR3_A 3QQN_A 3QR2_A ....
Probab=97.06  E-value=0.00063  Score=37.39  Aligned_cols=22  Identities=32%  Similarity=0.788  Sum_probs=20.2

Q ss_pred             eEEEeecCCCCCeEEEEEEEec
Q psy15390         68 QLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        68 ~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      .|.|.++...|+|.|.|.+.|.
T Consensus        57 ~L~I~~v~~~D~G~Y~C~~~n~   78 (90)
T PF07679_consen   57 SLTIKNVTREDAGTYTCVASNS   78 (90)
T ss_dssp             EEEESSESGGGSEEEEEEEEET
T ss_pred             EEccCCCChhhCEEEEEEEEEC
Confidence            3899999999999999999885


No 276
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig1_IL1R_like: domain similar to the first immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta.
Probab=97.06  E-value=0.00068  Score=37.94  Aligned_cols=24  Identities=17%  Similarity=0.338  Sum_probs=21.6

Q ss_pred             cceEEEeecCCCCCeEEEEEEEec
Q psy15390         66 GEQLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        66 ~~~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      ++.|.|.++..+|+|.|+|.+.|.
T Consensus        59 ~~~L~I~~~~~~DsG~Y~C~~~N~   82 (94)
T cd05756          59 KDLLWFLPAALEDSGLYTCVVRNS   82 (94)
T ss_pred             CCeEEEccCCcccCeEEEEEEcCC
Confidence            457999999999999999999875


No 277
>PF07354 Sp38:  Zona-pellucida-binding protein (Sp38);  InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals. These are sperm proteins that bind to the 90 kDa family of zona pellucida glycoproteins in a calcium-dependent manner []. These represent some of the specific molecules that mediate the first steps of gamete interaction, allowing fertilisation to occur [].; GO: 0007339 binding of sperm to zona pellucida, 0005576 extracellular region
Probab=97.05  E-value=0.0015  Score=42.96  Aligned_cols=49  Identities=20%  Similarity=0.414  Sum_probs=39.3

Q ss_pred             CCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEe
Q psy15390         38 FPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATK   88 (142)
Q Consensus        38 ~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~   88 (142)
                      ...|.+.|..++|+.+...  .+..+...+.|.+.+....++|.|+|.+.-
T Consensus        10 ~iDP~y~W~GP~g~~l~gn--~~~nIT~TG~L~~~~F~esmSG~YTCtLsY   58 (271)
T PF07354_consen   10 LIDPTYLWTGPNGKPLSGN--SYVNITETGKLMFKNFQESMSGSYTCTLSY   58 (271)
T ss_pred             cCCCceEEECCCCcccCCC--CeEEEccCceEEeeccccccCCceEEEEEE
Confidence            3467889999888877643  344577788899999999999999998874


No 278
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. Ig2_CD4; second immunoglobulin (Ig) domain of CD4.  CD4 and CD8 are the two primary co-receptor proteins found on the surface of T cells, and the presence of either CD4 or CD8 determines the function of the T cell.  CD4 is found on helper T cells, where it is required for the binding of MHC (major histocompatibility complex) class II molecules, while CD8 is found on cytotoxic T cells, where it is required for the binding of MHC class I molecules.  CD4 contains four immunoglobulin domains, with the first three included in this hierarchy.  The fourth domain has a general Ig architecture, but has slight topological changes in the arrangement of beta strands relative to the other structures in this family and is not specifically included in the hierarchy.
Probab=97.05  E-value=0.015  Score=31.93  Aligned_cols=47  Identities=17%  Similarity=0.317  Sum_probs=32.4

Q ss_pred             EEEEEEecC--CccEEEEEE------EeccccceEEEccCCCCCCeEEEEEEecC
Q psy15390         82 YLCIATKIG--PLKIFWEII------FHMHYGEQLNITKISRTEMGAYLCIATNN  128 (142)
Q Consensus        82 y~C~~~~~~--~~~~~w~~~------~~~~~~~~l~i~~~~~~d~g~y~C~a~n~  128 (142)
                      .+|......  .+.+.|...      ....+...|.+.++...|+|+++|.+.-.
T Consensus        19 Ltl~~~s~s~p~~~i~w~~P~n~~~~~~~~~~ktL~~~qv~~qdSG~WtC~V~~~   73 (88)
T cd07694          19 LTLHGSSNSLPAFKVEWRGPGNKSKQILNQDKKTLNLVQLGPNDSGTWDCIVSVN   73 (88)
T ss_pred             EEEecCCCCCCCccEEEeCCCCccceeccCCccEEEeceeCcccCCEEEEEEEEC
Confidence            455554433  347888632      22335678999999999999999999744


No 279
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain. IgV_TCR_gamma: immunoglobulin (Ig) variable (V) domain of the gamma chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is
Probab=97.02  E-value=0.0064  Score=35.21  Aligned_cols=24  Identities=17%  Similarity=0.432  Sum_probs=20.4

Q ss_pred             cceEEEccCCCCCCeEEEEEEecC
Q psy15390        105 GEQLNITKISRTEMGAYLCIATNN  128 (142)
Q Consensus       105 ~~~l~i~~~~~~d~g~y~C~a~n~  128 (142)
                      ...|.|.+++.+|+|.|.|.+...
T Consensus        76 ~~~L~I~~~~~~Dsg~Y~C~~~~~   99 (116)
T cd04982          76 TSTLTIQNLEKEDSATYYCAYWES   99 (116)
T ss_pred             EEEEEEEECCHHHCEEEEEEEecC
Confidence            346889999999999999999743


No 280
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. Ig2_FGFR: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three IG-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin sulfate proteoglycans.
Probab=97.01  E-value=0.0011  Score=36.09  Aligned_cols=23  Identities=17%  Similarity=0.423  Sum_probs=20.7

Q ss_pred             ceEEEeecCCCCCeEEEEEEEec
Q psy15390         67 EQLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        67 ~~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      ..|.|.++..+|+|.|+|.+.|.
T Consensus        51 ~~l~i~~~~~~D~G~Y~C~a~N~   73 (85)
T cd05857          51 WSLIMESVVPSDKGNYTCVVENE   73 (85)
T ss_pred             eEEEEccCCcccCEEEEEEEEeC
Confidence            46889999999999999999985


No 281
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan. Ig_Aggrecan: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan. These aggregates contribute to the tissue's load bearing properties. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Aggrecan has a wide distribution in connective tissue and extracellular matrices. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Probab=97.01  E-value=0.0039  Score=36.11  Aligned_cols=64  Identities=19%  Similarity=0.385  Sum_probs=42.6

Q ss_pred             cCCcEEEEEEEecCC------------CCeeEEEecC-Cc-c--e---------ecCCcceEEee------ccceEEEee
Q psy15390         25 EEFNITLTCKAEGFP------------APEIKWRRED-NQ-P--I---------SINKRKKVHMH------YGEQLNITK   73 (142)
Q Consensus        25 ~g~~v~l~C~~~~~~------------~~~~~w~~~~-~~-~--~---------~~~~~~~~~~~------~~~~l~i~~   73 (142)
                      .|++|+|+|......            .+.+.|++.. |. .  +         ....+.|+...      .+.+|.|.+
T Consensus         1 ~G~~VtLpC~~~~~~~~~~~~~~~~~~~~~I~W~k~~~g~~~~ii~~~~~~~~~~~~f~~R~sl~~~~~~~~~asL~I~n   80 (112)
T cd05900           1 LGSSLLIPCYFQDPIAKDPGAPTVAPLSPRIKWSFISKEKESVLLVATEGKVRVNTEYLDRVSLPNYPAIPSDATLEITE   80 (112)
T ss_pred             CCCcEEEeeEEeCCcCccccccccCCCCCEEEEEEecCCCccEEEEEECCeEEECccccCeEEecccCCCCCCcEEEEee
Confidence            489999999987532            3589999842 11 1  1         01111233322      245799999


Q ss_pred             cCCCCCeEEEEEEEe
Q psy15390         74 ISRTEMGAYLCIATK   88 (142)
Q Consensus        74 v~~~d~G~y~C~~~~   88 (142)
                      ++.+|+|.|.|.+.+
T Consensus        81 l~~sDsG~Y~C~V~~   95 (112)
T cd05900          81 LRSNDSGTYRCEVMH   95 (112)
T ss_pred             cccccCEEEEEEEec
Confidence            999999999998874


No 282
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig4_Contactin-2-like: fourth Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=97.00  E-value=0.00079  Score=36.84  Aligned_cols=23  Identities=39%  Similarity=0.642  Sum_probs=19.9

Q ss_pred             EEEeecCCCCCeEEEEEEEecCC
Q psy15390         69 LNITKISRTEMGAYLCIATKIGP   91 (142)
Q Consensus        69 l~i~~v~~~d~G~y~C~~~~~~~   91 (142)
                      |.|.++..+|+|.|.|.+.|...
T Consensus        53 L~i~~~~~~D~G~Y~C~a~N~~G   75 (85)
T cd05728          53 LRITKLSLSDSGMYQCVAENKHG   75 (85)
T ss_pred             EEEeeCCHHHCEEEEEEEECCCC
Confidence            67889999999999999998543


No 283
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d4: the fourth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor fo
Probab=96.99  E-value=0.0011  Score=36.63  Aligned_cols=23  Identities=17%  Similarity=0.289  Sum_probs=21.0

Q ss_pred             eEEEeecCCCCCeEEEEEEEecC
Q psy15390         68 QLNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        68 ~l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      .|.|.+++.+|.|.|.|.+.|..
T Consensus        57 ~L~I~~v~~~D~g~Y~C~A~N~~   79 (90)
T cd04972          57 NLQLSNITSETQTTVTCTAENPV   79 (90)
T ss_pred             EEEEecCCcccCEEEEEEEECCC
Confidence            69999999999999999999864


No 284
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins. Ig_CSPGs_LP: immunoglobulin (Ig)-like domain similar to that found in chondroitin sulfate proteoglycans (CSPGs) and human cartilage link protein (LP).  Included in this group are the CSPGs aggrecan, versican, and neurocan. In CSPGs this Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggrecan and versican have a wide distribution in connective tissue and extracellular matrices. Neurocan is localized almost exclusively in nervous tissue.
Probab=96.98  E-value=0.00072  Score=38.57  Aligned_cols=65  Identities=28%  Similarity=0.451  Sum_probs=42.6

Q ss_pred             cCCcEEEEEEEecCC------CCeeEEEecC--C--c-ce-e-cC--------CcceEEe----eccceEEEeecCCCCC
Q psy15390         25 EEFNITLTCKAEGFP------APEIKWRRED--N--Q-PI-S-IN--------KRKKVHM----HYGEQLNITKISRTEM   79 (142)
Q Consensus        25 ~g~~v~l~C~~~~~~------~~~~~w~~~~--~--~-~~-~-~~--------~~~~~~~----~~~~~l~i~~v~~~d~   79 (142)
                      .|++|+|+|.....+      ...+.|++..  .  . .+ . .+        .+.+...    ..+.+|.|.+++.+|+
T Consensus         1 ~G~~V~L~C~~~~~~~~~~~~~~~i~W~k~~~~~~~~~~v~~~~~~~~~~~~~~~~r~~~~~~~~~~~sL~I~~v~~sD~   80 (106)
T cd05714           1 LGGNVTLPCRFHLEPALSAPHGPRIKWTKLESDGAKEVDVLVAIGGRVKVYGSGRVRVPLYPADPGDASLVITDLRLEDS   80 (106)
T ss_pred             CCCCEEEeEEeECCcccCCCCCcEEEEEEeCCCCCceEEEEEEcCCEEEEcCCCceEEEeeCCCCCcceEEECCCCHHHC
Confidence            489999999987653      4579999841  1  1 01 0 01        1112211    1234799999999999


Q ss_pred             eEEEEEEEec
Q psy15390         80 GAYLCIATKI   89 (142)
Q Consensus        80 G~y~C~~~~~   89 (142)
                      |.|.|.+.+.
T Consensus        81 G~Y~C~v~~~   90 (106)
T cd05714          81 GRYRCEVIDG   90 (106)
T ss_pred             EEEEEEEEcC
Confidence            9999998763


No 285
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig5_Contactin-1: fifth Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=96.98  E-value=0.00062  Score=36.20  Aligned_cols=22  Identities=32%  Similarity=0.637  Sum_probs=19.9

Q ss_pred             EEEeecCCCCCeEEEEEEEecC
Q psy15390         69 LNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        69 l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      |.|.+++.+|+|.|.|.+.|..
T Consensus        41 L~I~~v~~~D~G~Y~C~A~N~~   62 (73)
T cd05852          41 LEILNITKLDEGSYTCFAENNR   62 (73)
T ss_pred             EEECcCChhHCEEEEEEEECCC
Confidence            7899999999999999999853


No 286
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins. Ig1_PVR_like: domain similar to the first immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155). Poliovirus (PV) binds to its cellular receptor (PVR/CD155) to initiate infection. CD155 is a membrane-anchored, single-span glycoprotein; its extracellular region has three Ig-like domains. There are four different isotypes of CD155 (referred to as alpha, beta, gamma, and delta), that result from alternate splicing of the CD155 mRNA, and have identical extracellular domains. CD155-beta and - gamma, are secreted, CD155-alpha and delta are membrane-bound and function as PV receptors. The virus recognition site is contained in the amino-terminal domain, D1. Having the virus attachment site on the receptor distal from the plasma membrane, may be important for successful initiation of infection of cells by the virus. CD155 binds in the poliovirus "c
Probab=96.96  E-value=0.0014  Score=36.63  Aligned_cols=63  Identities=16%  Similarity=0.323  Sum_probs=41.1

Q ss_pred             CcEEEEEEEecCC---CCeeEEEecCCc---ce-----------ecCCcceEEee----ccceEEEeecCCCCCeEEEEE
Q psy15390         27 FNITLTCKAEGFP---APEIKWRREDNQ---PI-----------SINKRKKVHMH----YGEQLNITKISRTEMGAYLCI   85 (142)
Q Consensus        27 ~~v~l~C~~~~~~---~~~~~w~~~~~~---~~-----------~~~~~~~~~~~----~~~~l~i~~v~~~d~G~y~C~   85 (142)
                      ++++|.|.....+   ...+.|++....   .+           ......+....    .+.+|.|.+++.+|+|.|.|.
T Consensus         1 ~~v~L~C~~~~~~~~~~~~v~W~k~~~~~~~~i~~~~~~~~~~~~~~~~~R~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~   80 (98)
T cd05718           1 ESVTLECSFPVPGPVQITQVTWMKITGGSKQNIAVFHPQYGISIPPSYEGRVSFLNSSLEDATISISNLRLEDEGNYICE   80 (98)
T ss_pred             CCEEEEeEeeCCCCceEEEEEEeeECCCCCEEEEEEecCCCcccCcCcCceEEEeCCCCCceEEEEccCCcccCEEEEEE
Confidence            5789999987654   336899984321   00           01112232222    235799999999999999998


Q ss_pred             EEec
Q psy15390         86 ATKI   89 (142)
Q Consensus        86 ~~~~   89 (142)
                      +...
T Consensus        81 v~~~   84 (98)
T cd05718          81 FATF   84 (98)
T ss_pred             EEeC
Confidence            8653


No 287
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin. Ig3_Peroxidasin: the third immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells which have undergone programmed cell death, and protection of the organism against non-self.
Probab=96.95  E-value=0.00075  Score=35.85  Aligned_cols=21  Identities=33%  Similarity=0.700  Sum_probs=19.5

Q ss_pred             EEEeecCCCCCeEEEEEEEec
Q psy15390         69 LNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        69 l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      |.|.+++..|+|.|.|.+.|.
T Consensus        42 L~I~~v~~~D~G~Y~C~A~N~   62 (74)
T cd05745          42 LRISRVALHDQGQYECQAVNI   62 (74)
T ss_pred             EEEeeCCHHhCEEEEEEEEeC
Confidence            789999999999999999985


No 288
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain. IgV_TCR_delta: immunoglobulin (Ig) variable (V) domain of the delta chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is
Probab=96.94  E-value=0.014  Score=33.84  Aligned_cols=24  Identities=17%  Similarity=0.389  Sum_probs=20.8

Q ss_pred             cceEEEccCCCCCCeEEEEEEecC
Q psy15390        105 GEQLNITKISRTEMGAYLCIATNN  128 (142)
Q Consensus       105 ~~~l~i~~~~~~d~g~y~C~a~n~  128 (142)
                      ...|.|..+..+|+|.|.|.+...
T Consensus        71 ~~sL~I~~~~~~Dsg~Y~C~~~~~   94 (116)
T cd07706          71 SISLTISALQLEDSAKYFCALSTL   94 (116)
T ss_pred             EEEEEECCCCHHHCEEEEEEEECC
Confidence            346899999999999999999854


No 289
>KOG3515|consensus
Probab=96.91  E-value=0.0048  Score=46.50  Aligned_cols=121  Identities=16%  Similarity=0.229  Sum_probs=71.8

Q ss_pred             CceeEEecCCcEEEEEEEec-CCCCeeEEEecCCcceecCCcceEE-eecc----ceEEEeecCCCCCeEEEEEEEec--
Q psy15390         18 PSSVAVREEFNITLTCKAEG-FPAPEIKWRREDNQPISINKRKKVH-MHYG----EQLNITKISRTEMGAYLCIATKI--   89 (142)
Q Consensus        18 ~~~~~~~~g~~v~l~C~~~~-~~~~~~~w~~~~~~~~~~~~~~~~~-~~~~----~~l~i~~v~~~d~G~y~C~~~~~--   89 (142)
                      +....+..|+...+.|...+ .|...+.|++ +............. ....    ..+........|.|.|.|.+.+.  
T Consensus       307 t~~~~ls~g~s~r~~c~~sss~p~~~i~w~~-~~~~~~~~~~~~~~t~~~~~v~~~~~~~q~~~~~~~g~v~c~a~~~~~  385 (741)
T KOG3515|consen  307 TSDSGLSSGRSARSSCVSSSSKPPAHIAWYK-DTKMPKGSQKASSKTSNMGGVAVISHYAQPSSQQDGGQVTCPADNLEL  385 (741)
T ss_pred             CcccccccccccccceeccCCCCccceeeec-cCcccccccCcccCCCcccceeeEEeeecccchhcCceEEcccccccc
Confidence            33344667888888887644 6666899998 54443222111100 0001    12455566788999999998864  


Q ss_pred             --------------------------------------------CCccEEEEEEEec------------cccceEEEccC
Q psy15390         90 --------------------------------------------GPLKIFWEIIFHM------------HYGEQLNITKI  113 (142)
Q Consensus        90 --------------------------------------------~~~~~~w~~~~~~------------~~~~~l~i~~~  113 (142)
                                                                  ..+.++|..+...            .......+.++
T Consensus       386 ~~~sss~~~l~~l~~p~~L~~~~~~v~~~e~d~~~~~~~~~~~p~~~~~~w~~~~~~~~~~~g~~~~v~~~~~~~s~~~v  465 (741)
T KOG3515|consen  386 AHSSSSSFLLPVLPSPAFLVRHKTAVVAMEQDHQAAPLPVRGAPAERTFYWTFRLYKLSQVDGGVVRVGAGAGLGSGVNV  465 (741)
T ss_pred             ccccccceeccccCCchhhhhcccceeeccCccccccCcccCCCcccchhheecceecccccCceEEeecccccccccee
Confidence                                                        1235666532111            11222335568


Q ss_pred             CCCCCeEEEEEEecCCCCCeeeEEEEE
Q psy15390        114 SRTEMGAYLCIATNNVPPSVSKRITVD  140 (142)
Q Consensus       114 ~~~d~g~y~C~a~n~~~~~~s~~~~l~  140 (142)
                      ...|.|.|.|.|.|..|. ....+.+.
T Consensus       466 ~~~d~g~y~~tatns~gg-~~~~~~~~  491 (741)
T KOG3515|consen  466 SRSDGGSYGLTATNSPGG-AQAYLLLG  491 (741)
T ss_pred             eeccCCcceeeeccCCCc-eeeEEeec
Confidence            889999999999999886 44444433


No 290
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG). Ig_Aggrecan_like: immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG)s. Included in this group are the Ig domains of other CSPGs: versican, and neurocan. In CSPGs this Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggrecan and versican have a wide distribution in connective tissue and extracellular matrices. Neurocan is localized almost exclusively in nervous tissue. Aggregates having other CSPGs substi
Probab=96.90  E-value=0.0085  Score=34.53  Aligned_cols=65  Identities=20%  Similarity=0.411  Sum_probs=42.6

Q ss_pred             cCCcEEEEEEEecCC----------CCeeEEEecC-Ccce------------ecCCcceEEee------ccceEEEeecC
Q psy15390         25 EEFNITLTCKAEGFP----------APEIKWRRED-NQPI------------SINKRKKVHMH------YGEQLNITKIS   75 (142)
Q Consensus        25 ~g~~v~l~C~~~~~~----------~~~~~w~~~~-~~~~------------~~~~~~~~~~~------~~~~l~i~~v~   75 (142)
                      .|++++|+|.....+          ...+.|++.+ ++..            ....+.|....      ...+|.|.+++
T Consensus         1 ~G~~V~LpC~~~~~~~~~~~~~~~~~~~i~W~k~~~~~~~~v~~~~~~~~~~~~~f~gR~~~~~~~~~~~~asL~I~~l~   80 (110)
T cd05878           1 LSSSVLLPCYFTLPPALPPPSNAPESPRIKWTKLSGQKEVTVLVAQDGVVKVGQEYQGRVSLPNYPENRGDASLEISRLR   80 (110)
T ss_pred             CCCCEEEeeEeeCCccccccccCCCCCEEEEEEecCCCcEEEEEEECCEEEecccccCeEEeccCCCCCCcEEEEECCCC
Confidence            489999999987644          2468999842 2111            00111233221      22469999999


Q ss_pred             CCCCeEEEEEEEec
Q psy15390         76 RTEMGAYLCIATKI   89 (142)
Q Consensus        76 ~~d~G~y~C~~~~~   89 (142)
                      .+|+|.|.|.+...
T Consensus        81 ~sD~G~Y~C~v~~~   94 (110)
T cd05878          81 SSDSGVYRCEVMHG   94 (110)
T ss_pred             hhhCEEEEEEEEeC
Confidence            99999999988753


No 291
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM:  third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=96.90  E-value=0.00077  Score=35.53  Aligned_cols=23  Identities=22%  Similarity=0.559  Sum_probs=20.8

Q ss_pred             eEEEeecCCCCCeEEEEEEEecC
Q psy15390         68 QLNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        68 ~l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      .|.|.+++.+|+|.|.|.+.|..
T Consensus        37 ~L~I~~v~~~D~G~Y~C~a~N~~   59 (71)
T cd05876          37 TLQLDNVLESDDGEYVCTAENSE   59 (71)
T ss_pred             EEEEcccCHHhCEEEEEEEEcCC
Confidence            58999999999999999999853


No 292
>cd00096 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as, T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as, butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=96.87  E-value=0.0066  Score=30.66  Aligned_cols=48  Identities=25%  Similarity=0.461  Sum_probs=33.3

Q ss_pred             EEEEEEecCCccEEEEEEE----------------eccccceEEEccCCCCCCeEEEEEEecCC
Q psy15390         82 YLCIATKIGPLKIFWEIIF----------------HMHYGEQLNITKISRTEMGAYLCIATNNV  129 (142)
Q Consensus        82 y~C~~~~~~~~~~~w~~~~----------------~~~~~~~l~i~~~~~~d~g~y~C~a~n~~  129 (142)
                      ..|.+...+...+.|.+..                .......+.+..+...|.|.|.|.+.+..
T Consensus         3 l~C~~~~~~~~~~~W~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~g~y~C~~~~~~   66 (74)
T cd00096           3 LTCLASGPPPPTITWLKNGKPLPSSVLTRVRSSRGTSSGSSTLTISNVTLEDSGTYTCVASNSA   66 (74)
T ss_pred             EEEEecCCCCCcEEEEECCEECCCcccEEeccccCcceeEEEEEECccCcccCcEEEEEEecCc
Confidence            4566666666677775421                11224468888899999999999998765


No 293
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins. Ig1_ MRC-OX-2_like: domain similar to the first immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200). MRC OX-2 is a membrane glycoprotein expressed in a variety of lymphoid and non-lymphoid cells in rats. It has a similar broad distribution pattern in humans. MRC OX-2 may regulate myeloid cell activity. The protein has an extracellular portion containing two Ig-like domains, a transmembrane portion, and a cytoplasmic portion.
Probab=96.87  E-value=0.0014  Score=36.86  Aligned_cols=65  Identities=17%  Similarity=0.343  Sum_probs=41.0

Q ss_pred             CCcEEEEEEEecCCC-CeeEEEecCCc---cee-----c------CCcceEEe----eccceEEEeecCCCCCeEEEEEE
Q psy15390         26 EFNITLTCKAEGFPA-PEIKWRREDNQ---PIS-----I------NKRKKVHM----HYGEQLNITKISRTEMGAYLCIA   86 (142)
Q Consensus        26 g~~v~l~C~~~~~~~-~~~~w~~~~~~---~~~-----~------~~~~~~~~----~~~~~l~i~~v~~~d~G~y~C~~   86 (142)
                      |++++|+|....... ..+.|++..+.   .+.     .      ....+...    ..+.+|.|.+++.+|+|.|.|.+
T Consensus         1 G~~vtL~C~~~~~~~~~~v~W~k~~~~~~~~i~~~~~~~~~~~~~~~~~r~~~~~~~~~~~sL~I~nv~~~D~G~Y~C~~   80 (97)
T cd05846           1 GGNVTLSCNLTLPEEVLQVTWQKIQGSSPENIATYSEKYGVKIQPSYFRRRSITSLGLNSTSITIWNVTLEDEGCYKCIF   80 (97)
T ss_pred             CCcEEEEEEeCCCCeeEEEEEEEcCCCCceEEEEEcccCCcccCCCccCeEEEcCCCCCccEEEEeCCceeeeEEEEEEE
Confidence            789999998654332 36899984322   110     0      00112111    12346999999999999999988


Q ss_pred             EecC
Q psy15390         87 TKIG   90 (142)
Q Consensus        87 ~~~~   90 (142)
                      ...|
T Consensus        81 ~~~p   84 (97)
T cd05846          81 NTFP   84 (97)
T ss_pred             EeCC
Confidence            7544


No 294
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin. Ig8_hNephrin_like: domain similar to the eighth immunoglobulin-like domain in human nephrin. Nephrin is an integral component of the slit diaphragm, and is a central component of the glomerular ultrafilter. Nephrin plays a structural role, and has a role in signaling. Nephrin is a transmembrane protein having a short intracellular portion, and an extracellular portion comprised of eight Ig-like domains, and one fibronectin type III-like domain. The extracellular portions of nephrin, from neighboring foot processes of separate podocyte cells, may interact with each other, and in association with other components of the slit diaphragm, form a porous molecular sieve within the slit pore.  The intracellular portion of nephrin is associated with linker proteins, which connect nephrin to the actin cytoskeleton. The intracellular portion is tyrosine phosphorylated, and mediates signaling from the slit diaphragm into the p
Probab=96.84  E-value=0.0018  Score=37.24  Aligned_cols=25  Identities=20%  Similarity=0.301  Sum_probs=21.3

Q ss_pred             cceEEEeecC-CCCCeEEEEEEEecC
Q psy15390         66 GEQLNITKIS-RTEMGAYLCIATKIG   90 (142)
Q Consensus        66 ~~~l~i~~v~-~~d~G~y~C~~~~~~   90 (142)
                      .+.|.|.++. ..|.|.|.|.+.|.-
T Consensus        68 ~s~L~I~~v~~~~D~G~Y~C~A~N~~   93 (109)
T cd05773          68 TSILTIINVSAALDYALFTCTAHNSL   93 (109)
T ss_pred             eeEEEECcCCccCCCEEEEEEEEeCC
Confidence            3579999997 599999999999863


No 295
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig4_Neogenin: fourth immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=96.82  E-value=0.0014  Score=34.53  Aligned_cols=21  Identities=29%  Similarity=0.594  Sum_probs=17.9

Q ss_pred             EEEeecCCCCCeEEEEEEEec
Q psy15390         69 LNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        69 l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      |.|.+++.+|+|.|+|.+.|.
T Consensus        39 l~i~~v~~~D~G~Y~C~A~N~   59 (71)
T cd05723          39 LQVLGLVKSDEGFYQCIAEND   59 (71)
T ss_pred             EEEEcCCcccCEEEEEEEEcC
Confidence            445688999999999999985


No 296
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin. Ig5_Contactin_like: Fifth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=96.81  E-value=0.00095  Score=35.32  Aligned_cols=21  Identities=29%  Similarity=0.749  Sum_probs=19.6

Q ss_pred             EEEeecCCCCCeEEEEEEEec
Q psy15390         69 LNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        69 l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      |.|.+++.+|+|.|+|.+.|.
T Consensus        41 L~i~~v~~~D~G~Y~C~a~N~   61 (73)
T cd04969          41 LEILNVTKSDEGKYTCFAENF   61 (73)
T ss_pred             EEEccCChhHCEEEEEEEECC
Confidence            889999999999999999885


No 297
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM_like: domain similar to the third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM and human neurofascin.
Probab=96.77  E-value=0.00081  Score=35.22  Aligned_cols=23  Identities=30%  Similarity=0.530  Sum_probs=20.8

Q ss_pred             eEEEeecCCCCCeEEEEEEEecC
Q psy15390         68 QLNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        68 ~l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      .|.|.+++.+|+|.|+|.+.|..
T Consensus        37 ~L~i~~v~~~D~G~Y~C~a~N~~   59 (71)
T cd05731          37 TLKIDNVSEEDDGEYRCTASNSL   59 (71)
T ss_pred             EEEECCCCHHHCEEEEEEEEeCC
Confidence            58999999999999999999863


No 298
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin. Ig6_Contactin_like: Sixth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=96.76  E-value=0.00088  Score=36.59  Aligned_cols=26  Identities=23%  Similarity=0.359  Sum_probs=22.7

Q ss_pred             ccceEEEeecCCCCCeEEEEEEEecC
Q psy15390         65 YGEQLNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        65 ~~~~l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      ..+.|.|.+++..|+|.|+|.+.|..
T Consensus        45 ~~~~L~I~~v~~~D~G~Y~C~a~n~~   70 (85)
T cd04970          45 SNGDLMIRNAQLKHAGKYTCTAQTVV   70 (85)
T ss_pred             ccceEEEccCCHHhCeeeEEEEecCC
Confidence            34679999999999999999998853


No 299
>PF11465 Receptor_2B4:  Natural killer cell receptor 2B4;  InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells. It plays a role in activating NK-mediated cytotoxicity through its interaction with CD48 on target cells in a subset of CD8 T cells []. The structure of 2B4 consists of an immunoglobulin variable domain fold and contains two beta-sheets. One of the beta-sheets, the six-stranded sheet, contains structural features that may have a role in ligand recognition and receptor function []. This entry represents the 2B4 immunoglobulin domain.; GO: 0005488 binding; PDB: 2PTU_D 2PTT_B 1Z2K_A.
Probab=96.76  E-value=0.0069  Score=34.40  Aligned_cols=37  Identities=24%  Similarity=0.234  Sum_probs=26.1

Q ss_pred             cceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        105 GEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       105 ~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      +..|.|+.++..|+|.|.-++.+..|......+++.|
T Consensus        70 nlaLlIkaAq~qDSG~Y~LEvT~~sG~V~~~~FqVsV  106 (108)
T PF11465_consen   70 NLALLIKAAQPQDSGLYCLEVTNESGKVCTKNFQVSV  106 (108)
T ss_dssp             TTEEEESS-SGGG-EEEEEEEEETTSCEEEEEEEEEE
T ss_pred             CceEEEeecCcccCceEEEEEEcCCCcEEEEEEEEEe
Confidence            5568899999999999999999888864444555544


No 300
>cd07704 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3), nectin-4 (poliovirus receptor related protein 4) and similar proteins. Ig2_Nectin-3-4_like: domain similar to the second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and nectin-4 (poliovirus receptor related protein 4). Nectin-3 and nectin-4 belong to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through 4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion.  Nectin-2 and nectin-3 localize at Sertoli-spermatid junctions where they form heterophilic trans-interactions between the cells that are essential for the formation and maintenance of the junctions and for spermatid development.  Nect
Probab=96.73  E-value=0.014  Score=32.87  Aligned_cols=30  Identities=33%  Similarity=0.615  Sum_probs=23.8

Q ss_pred             CceeEEecCCcEEE-EEEE-ecCCCCeeEEEe
Q psy15390         18 PSSVAVREEFNITL-TCKA-EGFPAPEIKWRR   47 (142)
Q Consensus        18 ~~~~~~~~g~~v~l-~C~~-~~~~~~~~~w~~   47 (142)
                      ...+.+.+|+.+.+ .|.+ .+.|++.|.|+.
T Consensus         8 ~~~~~~~~g~~~~vA~C~sa~gkPaa~IsW~~   39 (97)
T cd07704           8 GPSLLIDGGNGTTLAACCAAEGRPAADVTWET   39 (97)
T ss_pred             CCeeEeecCcceeEEEEEccCCccCCEeEEeC
Confidence            34556788999999 8886 457888999997


No 301
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP). Ig_LP_like: immunoglobulin (Ig)-like domain similar to that that found in human cartilage link protein (LP). In cartilage, chondroitin-keratan sulfate proteoglycan (CSPG), aggrecan, forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Probab=96.71  E-value=0.0017  Score=36.97  Aligned_cols=64  Identities=23%  Similarity=0.463  Sum_probs=41.8

Q ss_pred             cCCcEEEEEEEecCC------CCeeEEEecCCc--c-----eec--------CCcceEEeec----cceEEEeecCCCCC
Q psy15390         25 EEFNITLTCKAEGFP------APEIKWRREDNQ--P-----ISI--------NKRKKVHMHY----GEQLNITKISRTEM   79 (142)
Q Consensus        25 ~g~~v~l~C~~~~~~------~~~~~w~~~~~~--~-----~~~--------~~~~~~~~~~----~~~l~i~~v~~~d~   79 (142)
                      .|++++|+|.....|      ...+.|++....  .     ...        ....+.....    ..+|.|.+++.+|+
T Consensus         1 ~G~~vtL~C~~~~~~~~~~~~~~~v~W~k~~~~~~~~~~~~~~~~~~~~~~~~~~~R~~~~~~~~~~~sL~I~~v~~~Ds   80 (106)
T cd05877           1 RGGNVTLPCRYHYEPELSAPRKIRVKWTKLESDYLKEEDVLVAIGTRHKSYGSYQGRVFLRRAHDLDASLVITDLRLEDY   80 (106)
T ss_pred             CCCcEEEEeEeECCCcCCCCccceEEEEEecCCCCeeEEEEEEcCcEEEeccCccCcEEecCCCCCcEEEEEccCChHHC
Confidence            489999999987653      346999984211  0     010        0112322221    23699999999999


Q ss_pred             eEEEEEEEe
Q psy15390         80 GAYLCIATK   88 (142)
Q Consensus        80 G~y~C~~~~   88 (142)
                      |.|.|.+.+
T Consensus        81 G~Y~C~v~~   89 (106)
T cd05877          81 GRYRCEVID   89 (106)
T ss_pred             EEEEEEEEe
Confidence            999999865


No 302
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig4_Robo: domain similar to the fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagoni
Probab=96.70  E-value=0.0016  Score=35.97  Aligned_cols=28  Identities=25%  Similarity=0.589  Sum_probs=23.6

Q ss_pred             eccceEEEeecCCCCCeEEEEEEEecCC
Q psy15390         64 HYGEQLNITKISRTEMGAYLCIATKIGP   91 (142)
Q Consensus        64 ~~~~~l~i~~v~~~d~G~y~C~~~~~~~   91 (142)
                      ..++.|.|.+++.+|+|.|+|.+.|...
T Consensus        44 ~~~~~L~I~~v~~~D~G~Y~C~a~N~~G   71 (90)
T cd05726          44 SQTGDLTITNVQRSDVGYYICQTLNVAG   71 (90)
T ss_pred             CCCCeEEEeeCChhhCEEEEEEEEcCCC
Confidence            3455799999999999999999998533


No 303
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins. Ig4_SCFR_like; fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). In addition to SCFR this group also includes the fourth Ig domain of platelet-derived growth factor receptors (PDGFR), alpha and beta, the fourth Ig domain of macrophage colony stimulating factor (M-CSF), and the Ig domain of the receptor tyrosine kinase KIT. SCFR and the PDGFR alpha and beta have similar organization: an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR, this fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth SCFR_Ig-like domain abolishes
Probab=96.69  E-value=0.0014  Score=37.24  Aligned_cols=24  Identities=21%  Similarity=0.490  Sum_probs=21.9

Q ss_pred             cceEEEeecCCCCCeEEEEEEEec
Q psy15390         66 GEQLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        66 ~~~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      .+.|.|.+++.+|+|.|+|.+.|.
T Consensus        64 ~~~L~i~~v~~~D~G~Ytc~A~N~   87 (101)
T cd04975          64 VSELKLVRLKESEAGTYTFLASNS   87 (101)
T ss_pred             EEEEEEeecCHhhCeeEEEEEECC
Confidence            456999999999999999999986


No 304
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM). Ig7_DSCAM: the seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion.
Probab=96.68  E-value=0.002  Score=34.60  Aligned_cols=26  Identities=23%  Similarity=0.349  Sum_probs=22.9

Q ss_pred             ccceEEEeecCCCCCeEEEEEEEecC
Q psy15390         65 YGEQLNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        65 ~~~~l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      .+++|.|.++..+|+|.|.|.+.|.-
T Consensus        42 ~~~~L~I~~v~~~D~G~Y~C~a~N~~   67 (79)
T cd05734          42 SNGSLLIKHVLEEDSGYYLCKVSNDV   67 (79)
T ss_pred             cCCeEEECcCCcccCEEEEEEEEeCC
Confidence            45679999999999999999999863


No 305
>KOG1480|consensus
Probab=96.67  E-value=0.0021  Score=48.13  Aligned_cols=79  Identities=27%  Similarity=0.432  Sum_probs=54.9

Q ss_pred             CCceeEEecCCcEEEEEEE-ecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEecCCccEE
Q psy15390         17 TPSSVAVREEFNITLTCKA-EGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIF   95 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~-~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~~~~~~~   95 (142)
                      .+.-..+..+..+.+.|.. .+.|...+.|++ ++..+....  .........+.+..+...|.|+|+|++.|.-..+.+
T Consensus       135 ~p~~q~V~~~s~~~l~cr~pe~~paae~~w~k-~e~~~~pd~--n~~~~~d~~li~~~arlsd~~nytc~a~ni~~~r~~  211 (909)
T KOG1480|consen  135 SPVGQEVQEETTLQLPCRPPEGDPKAEVEWLK-NEVVIDPDA--NVIRASDHNLIISQARLSDSGNYTCEATNIVAKRKS  211 (909)
T ss_pred             ChhhheecccccccccccCcccchhhhhhccc-cCCCCCccc--cchhhhcCCccccchhhhhcccceeeeehhhccccc
Confidence            3444456677778888775 456777899999 777665522  222334456899999999999999999987555555


Q ss_pred             EEE
Q psy15390         96 WEI   98 (142)
Q Consensus        96 w~~   98 (142)
                      |..
T Consensus       212 ~~~  214 (909)
T KOG1480|consen  212 DPA  214 (909)
T ss_pred             cce
Confidence            543


No 306
>cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH2: The second immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=96.67  E-value=0.012  Score=33.31  Aligned_cols=30  Identities=17%  Similarity=0.354  Sum_probs=22.2

Q ss_pred             EEecCCcEEEEEEEecCC---CCeeEEEecCCcc
Q psy15390         22 AVREEFNITLTCKAEGFP---APEIKWRREDNQP   52 (142)
Q Consensus        22 ~~~~g~~v~l~C~~~~~~---~~~~~w~~~~~~~   52 (142)
                      .+..+..++|.|.+.+.-   ...+.|.+ +|+.
T Consensus        15 ~l~~~~~atLtClV~~f~~P~~i~V~W~~-~g~~   47 (99)
T cd04986          15 DLLLGSSASLTCTLSGLRDPEGAVFTWTP-SGGK   47 (99)
T ss_pred             HhCcCCccEEEEEEeccCCCCCeEEEEEE-CCcc
Confidence            344688899999999844   23689998 6654


No 307
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig2_Robo: domain similar to the second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antago
Probab=96.66  E-value=0.0024  Score=34.76  Aligned_cols=23  Identities=30%  Similarity=0.602  Sum_probs=20.3

Q ss_pred             EEEeecCCCCCeEEEEEEEecCC
Q psy15390         69 LNITKISRTEMGAYLCIATKIGP   91 (142)
Q Consensus        69 l~i~~v~~~d~G~y~C~~~~~~~   91 (142)
                      |.|.+++.+|+|.|+|.+.|...
T Consensus        53 L~I~~~~~~D~G~Y~C~a~N~~G   75 (86)
T cd05724          53 LLIAEARKSDEGTYKCVATNMVG   75 (86)
T ss_pred             EEEeECCcccCEEEEEEEEeccC
Confidence            78999999999999999998633


No 308
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig4_L1-CAM_like:  fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=96.66  E-value=0.0016  Score=34.74  Aligned_cols=23  Identities=22%  Similarity=0.401  Sum_probs=20.3

Q ss_pred             eEEEeecCCCCCeEEEEEEEecC
Q psy15390         68 QLNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        68 ~l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      .|.|.+++.+|+|.|.|.+.|..
T Consensus        42 ~L~I~~~~~~D~G~Y~C~a~N~~   64 (76)
T cd05867          42 ALILTDVQPSDTAVYQCEARNRH   64 (76)
T ss_pred             EEEECCCChhhCEEEEEEEECCC
Confidence            37899999999999999999853


No 309
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of  the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. Ig2_RPTP_IIa_LAR_like: domain similar to the second immunoglobulin (Ig)-like domain found in the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. LAR belongs to the RPTP type IIa subfamily. Members of this subfamily are cell adhesion molecule-like proteins involved in central nervous system (CNS) development. They have large extracellular portions, comprised of multiple Ig-like domains and two to nine fibronectin type III (FNIII) domains, and a cytoplasmic portion having two tandem phosphatase domains.
Probab=96.64  E-value=0.0018  Score=34.42  Aligned_cols=23  Identities=30%  Similarity=0.580  Sum_probs=20.4

Q ss_pred             EEEeecCCCCCeEEEEEEEecCC
Q psy15390         69 LNITKISRTEMGAYLCIATKIGP   91 (142)
Q Consensus        69 l~i~~v~~~d~G~y~C~~~~~~~   91 (142)
                      |.|.+++..|+|.|+|.+.|...
T Consensus        40 L~i~~~~~~D~G~Y~C~a~N~~G   62 (74)
T cd05738          40 LQIENSEESDQGKYECVATNSAG   62 (74)
T ss_pred             EEECCCChhhCEEEEEEEECCCC
Confidence            78889999999999999998654


No 310
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. Ig6_L1-CAM_like: domain similar to the sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM).  L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains NrCAM [Ng(neuronglia)CAM-related cell adhesion molecule], which is primarily expressed in the nervous system, and human neurofascin.
Probab=96.54  E-value=0.0045  Score=33.13  Aligned_cols=23  Identities=26%  Similarity=0.368  Sum_probs=16.5

Q ss_pred             EEEeecC----CCCCeEEEEEEEecCC
Q psy15390         69 LNITKIS----RTEMGAYLCIATKIGP   91 (142)
Q Consensus        69 l~i~~v~----~~d~G~y~C~~~~~~~   91 (142)
                      |.|.++.    .+|+|.|.|.+.|.-.
T Consensus        41 L~i~~~~~~~~~~d~G~Y~C~A~N~~G   67 (77)
T cd05733          41 LVIDNMNGGRAEDYEGEYQCYASNELG   67 (77)
T ss_pred             EEEeccCCCCCcCCCEEEEEEEEcCCC
Confidence            4455553    3789999999998643


No 311
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). Ig4_L1-NrCAM_like: fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). These proteins belong to the L1 subfamily of cell adhesion molecules (CAMs) and are comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. These molecules are primarily expressed in the nervous system. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=96.51  E-value=0.0021  Score=34.15  Aligned_cols=24  Identities=17%  Similarity=0.451  Sum_probs=21.2

Q ss_pred             ceEEEeecCCCCCeEEEEEEEecC
Q psy15390         67 EQLNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        67 ~~l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      +.|.|.+++..|+|.|+|.+.|..
T Consensus        41 ~~L~i~~v~~~D~G~Y~C~A~N~~   64 (76)
T cd04978          41 GTLILSNVQPNDTAVYQCNASNVH   64 (76)
T ss_pred             CEEEECCCChhhCEEEEEEEEccC
Confidence            358999999999999999999853


No 312
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily. Ig_2: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=96.42  E-value=0.0032  Score=33.30  Aligned_cols=22  Identities=27%  Similarity=0.596  Sum_probs=18.8

Q ss_pred             EEEeecCCCCCeEEEEEEEecC
Q psy15390         69 LNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        69 l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      |.|.++..+|+|.|.|.+.|..
T Consensus        42 L~i~~~~~~D~G~Y~C~a~N~~   63 (74)
T cd05764          42 LDILITTVKDTGSFTCIASNAA   63 (74)
T ss_pred             EEEEECChhhCEEEEEEEECCC
Confidence            5677889999999999999853


No 313
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). Ig4_ NrCAM: fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six IG-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=96.35  E-value=0.0029  Score=33.79  Aligned_cols=22  Identities=18%  Similarity=0.327  Sum_probs=19.0

Q ss_pred             EEEeecCCCCCeEEEEEEEecC
Q psy15390         69 LNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        69 l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      |.|.+++..|.|.|+|.+.|..
T Consensus        43 l~i~~v~~~D~G~Y~C~A~N~~   64 (76)
T cd05868          43 IIFSKVQERSSAVYQCNASNEY   64 (76)
T ss_pred             EEECCCCHhhCEEEEEEEEcCC
Confidence            5678899999999999999853


No 314
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). Ig_pIgR: Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). pIgR delivers dimeric IgA and pentameric IgM to mucosal secretions. Polymeric immunoglobulin (pIgs) are the first defense against pathogens and toxins. IgA and IgM can form polymers via an 18-residue extension at their c-termini referred to as the tailpiece. pIgR transports pIgs across mucosal epithelia into mucosal secretions. Human pIgR is a glycosylated type I transmembrane protein, comprised of a 620 residue extracellular region, a 23 residue transmembrane region, and a 103 residue cytoplasmic tail. The extracellular region contains five domains that share sequence similarity with Ig variable (v) regions.
Probab=96.35  E-value=0.0062  Score=34.14  Aligned_cols=22  Identities=14%  Similarity=0.528  Sum_probs=15.0

Q ss_pred             eEEEccCCCCCCeEEEEEEecC
Q psy15390        107 QLNITKISRTEMGAYLCIATNN  128 (142)
Q Consensus       107 ~l~i~~~~~~d~g~y~C~a~n~  128 (142)
                      .|.|.+++.+|+|.|.|.+...
T Consensus        65 ~L~I~~v~~~DsG~Y~C~~~~~   86 (98)
T cd05716          65 TVTLNQLRKEDAGWYWCGVGDD   86 (98)
T ss_pred             EEEEcCCCHHHCEEEEEEcccC
Confidence            4666777777777777766654


No 315
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). Ig2_FGFRL1-like: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). FGFRL1 is comprised of a signal peptide, three extracellular Ig-like modules, a transmembrane segment, and a short intracellular domain. FGFRL1 is expressed preferentially in skeletal tissues. Similar to FGF receptors, the expressed protein interacts specifically with heparin and with FGF2.  FGFRL1 does not have a protein tyrosine kinase domain at its C terminus; neither does its cytoplasmic domain appear to interact with a signaling partner. It has been suggested that FGFRL1 may not have any direct signaling function, but instead acts as a decoy receptor trapping FGFs and preventing them from binding other receptors.
Probab=96.34  E-value=0.003  Score=33.91  Aligned_cols=23  Identities=17%  Similarity=0.498  Sum_probs=20.5

Q ss_pred             eEEEeecCCCCCeEEEEEEEecC
Q psy15390         68 QLNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        68 ~l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      .|.|.+++.+|+|.|+|.+.|..
T Consensus        49 ~L~i~~v~~~D~G~Y~C~a~N~~   71 (82)
T cd05856          49 TLSLKNLKPEDSGKYTCHVSNRA   71 (82)
T ss_pred             EEEEccCChhhCEEEEEEEEcCC
Confidence            48899999999999999998853


No 316
>PF07686 V-set:  Immunoglobulin V-set domain;  InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents the V-set domains, which are Ig-like domains resembling the antibody variable domain. V-set domains are found in diverse protein families, including immunoglobulin light and heavy chains; in several T-cell receptors such as CD2 (Cluster of Differentiation 2), CD4, CD80, and CD86; in myelin membrane adhesion molecules; in junction adhesion molecules (JAM); in tyrosine-protein kinase receptors; and in the programmed cell death protein 1 (PD1).; PDB: 1PY9_A 2NXY_D 1U9K_B 3RNK_A 3BP6_A 3BIK_B 3SBW_A 1NPU_A 3BP5_A 3RNQ_A ....
Probab=96.30  E-value=0.0035  Score=35.73  Aligned_cols=23  Identities=22%  Similarity=0.538  Sum_probs=19.4

Q ss_pred             ceEEEeecCCCCCeEEEEEEEec
Q psy15390         67 EQLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        67 ~~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      .+|.|.+++..|+|.|.|.+...
T Consensus        79 ~sL~i~~l~~~DsG~Y~C~v~~~  101 (114)
T PF07686_consen   79 FSLTIKNLQPSDSGTYFCQVSTS  101 (114)
T ss_dssp             EEEEESSESGGGEEEEEEEEEES
T ss_pred             EEEEECCCCcCcCEEEEEEEEEC
Confidence            36999999999999999987754


No 317
>cd00098 IgC Immunoglobulin Constant domain. IgC: Immunoglobulin constant domain (IgC). Members of the IgC family are components of immunoglobulin, T-cell receptors, CD1 cell surface glycoproteins, secretory glycoproteins A/C, and Major Histocompatibility Complex (MHC) class I/II molecules. In immunoglobulins, each chain is composed of one variable domain (IgV) and one or more IgC domains. These names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. The IgV domain is responsible for antigen binding, and the IgC domain is involved in oligomerization and molecular interactions.
Probab=96.25  E-value=0.026  Score=31.24  Aligned_cols=54  Identities=17%  Similarity=0.252  Sum_probs=34.2

Q ss_pred             CCCeEEEEEEEec-C-CccEEEEEEEec------------cccc------eEEEccCCCCCCeEEEEEEecCCC
Q psy15390         77 TEMGAYLCIATKI-G-PLKIFWEIIFHM------------HYGE------QLNITKISRTEMGAYLCIATNNVP  130 (142)
Q Consensus        77 ~d~G~y~C~~~~~-~-~~~~~w~~~~~~------------~~~~------~l~i~~~~~~d~g~y~C~a~n~~~  130 (142)
                      .+.-...|.+.+. + .+.+.|.+....            ..++      .|.+......|.+.|+|.|.+...
T Consensus        13 ~~~~~L~C~a~g~~P~~~~i~W~~~g~~~~~~~~~~~~~~~~~gt~~~~s~l~v~~~~~~~~~~y~C~v~h~~~   86 (95)
T cd00098          13 GGSVTLTCLATGFYPPDITVTWLKNGKELTSGVTTTPPVPNSDGTYSVSSQLTVSPSDWNSGDTYTCVVTHESL   86 (95)
T ss_pred             CCCeEEEEEEeeEECCCcEEEEEECCEECCCceeccccccCCCCCEEEEEEEEECHHHhCCCCCEEEEEEeCCC
Confidence            4456789999886 4 478999753211            1111      234444444589999999998654


No 318
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). Ig5_KIRREL3: the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1). These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development. Neph1 and 2 may mediate axonal guidance and synapse formation in certain areas of the CNS. In the kidney, they participate in the formation of the slit diaphragm.
Probab=96.18  E-value=0.0072  Score=34.13  Aligned_cols=23  Identities=26%  Similarity=0.393  Sum_probs=20.0

Q ss_pred             ceEEEeecCCCC-CeEEEEEEEec
Q psy15390         67 EQLNITKISRTE-MGAYLCIATKI   89 (142)
Q Consensus        67 ~~l~i~~v~~~d-~G~y~C~~~~~   89 (142)
                      +.|.|.++...| .|.|.|.+.|+
T Consensus        64 S~L~I~~~~~~d~~g~Y~C~a~N~   87 (98)
T cd05898          64 STLTINNIMEADFQTHYNCTAWNS   87 (98)
T ss_pred             EEEEECCCccccCCcEEEEEEEeC
Confidence            469999998877 68999999985


No 319
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig2_FcgammaR_like: domain similar to the second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=96.15  E-value=0.0043  Score=33.80  Aligned_cols=21  Identities=24%  Similarity=0.452  Sum_probs=19.0

Q ss_pred             EEEeecCCCCCeEEEEEEEec
Q psy15390         69 LNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        69 l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      |.|.+++.+|+|.|+|.+.+.
T Consensus        50 l~I~~~~~~dsG~Y~C~~~~~   70 (83)
T cd05753          50 LSIPQATLSDSGSYHCSGIIG   70 (83)
T ss_pred             EEECccCHHHCEEEEEEEEeC
Confidence            778899999999999999875


No 320
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). Ig_M-protein_C: the C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). M-protein is a structural protein localized to the M-band, a transverse structure in the center of the sarcomere, and is a candidate for M-band bridges. M-protein is modular consisting mainly of repetitive IG-like and fibronectin type III (FnIII) domains, and has a muscle-type specific expression pattern. M-protein is present in fast fibers.
Probab=96.11  E-value=0.0051  Score=34.19  Aligned_cols=23  Identities=17%  Similarity=0.294  Sum_probs=20.9

Q ss_pred             ceEEEeecCCCCCeEEEEEEEec
Q psy15390         67 EQLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        67 ~~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      .+|.|.+++.+|+|.|+|.+.|.
T Consensus        58 ~~L~I~~~~~~D~G~Y~C~a~N~   80 (92)
T cd05891          58 ASLTIKGVTSEDSGKYSINVKNK   80 (92)
T ss_pred             EEEEECCCChhhCEEEEEEEEeC
Confidence            36999999999999999999985


No 321
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). Ig6_NrCAM: sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=96.06  E-value=0.011  Score=31.60  Aligned_cols=24  Identities=33%  Similarity=0.531  Sum_probs=16.4

Q ss_pred             CCCeEEEEEEecCCCCCeeeEEEE
Q psy15390        116 TEMGAYLCIATNNVPPSVSKRITV  139 (142)
Q Consensus       116 ~d~g~y~C~a~n~~~~~~s~~~~l  139 (142)
                      .|.|.|+|.|.|..|...+..+.|
T Consensus        53 ~d~G~Y~C~A~N~~G~~~s~~~~~   76 (77)
T cd05874          53 AYEGVYQCTARNERGAAVSNNIVI   76 (77)
T ss_pred             CCCEEEEEEEEcCCCeEEeeEEEE
Confidence            477888888888888654544443


No 322
>smart00409 IG Immunoglobulin.
Probab=96.05  E-value=0.011  Score=31.28  Aligned_cols=24  Identities=29%  Similarity=0.620  Sum_probs=21.0

Q ss_pred             cceEEEeecCCCCCeEEEEEEEec
Q psy15390         66 GEQLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        66 ~~~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      ...|.|.++...|+|.|.|.+.+.
T Consensus        50 ~~~l~i~~~~~~d~G~Y~C~v~~~   73 (86)
T smart00409       50 NSTLTISNVTPEDSGTYTCAATNS   73 (86)
T ss_pred             eeEEEEEeeccccCeEEEEEEEcC
Confidence            446999999999999999998854


No 323
>smart00410 IG_like Immunoglobulin like. IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
Probab=96.05  E-value=0.011  Score=31.28  Aligned_cols=24  Identities=29%  Similarity=0.620  Sum_probs=21.0

Q ss_pred             cceEEEeecCCCCCeEEEEEEEec
Q psy15390         66 GEQLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        66 ~~~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      ...|.|.++...|+|.|.|.+.+.
T Consensus        50 ~~~l~i~~~~~~d~G~Y~C~v~~~   73 (86)
T smart00410       50 NSTLTISNVTPEDSGTYTCAATNS   73 (86)
T ss_pred             eeEEEEEeeccccCeEEEEEEEcC
Confidence            446999999999999999998854


No 324
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin. Ig_Semaphorin_C; Immunoglobulin (Ig)-like domain in semaphorins. Semaphorins are transmembrane protein that have important roles in a variety of tissues. Functionally, semaphorins were initially characterized for their importance in the development of the nervous system and in axonal guidance. Later they have been found to be important for the formation and functioning of the cardiovascular, endocrine, gastrointestinal, hepatic, immune, musculoskeletal, renal, reproductive, and respiratory systems. Semaphorins function through binding to their receptors and transmembrane semaphorins also serves as receptors themselves. Although molecular mechanism of semaphorins is poorly understood, the Ig-like domains may involve in ligand binding or dimerization.
Probab=95.89  E-value=0.0058  Score=33.61  Aligned_cols=21  Identities=29%  Similarity=0.553  Sum_probs=19.2

Q ss_pred             EEEeecCCCCCeEEEEEEEec
Q psy15390         69 LNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        69 l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      |.|.+++.+|+|.|.|.+.+.
T Consensus        53 L~I~~~~~~D~G~Y~C~a~~~   73 (89)
T cd04979          53 LLIRSVSPADAGVYTCQSVEH   73 (89)
T ss_pred             EEEccCCHHHCEEEEEEEecC
Confidence            789999999999999999865


No 325
>PF05790 C2-set:  Immunoglobulin C2-set domain;  InterPro: IPR008424 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents C2-set domains, which are Ig-like domains resembling the antibody constant domain. C2-set domains are found primarily in the mammalian T-cell surface antigens CD2 (Cluster of Differentiation 2), CD4 and CD80, as well as in vascular (VCAM) and intercellular (ICAM) cell adhesion molecules. CD2 mediates T-cell adhesion via its ectodomain, and signal transduction utilising its 117-amino acid cytoplasmic tail []. CD2 displays structural and functional similarities with African swine fever virus (ASFV) LMW8-DR, a protein that is involved in cell-cell adhesion and immune response modulation, suggesting a possible role in the pathogenesis of ASFV infection []. CD4 is the primary receptor for HIV-1. CD4 has four immunoglobulin-like domains in its extracellular region that share the same structure, but can differ in sequence. Certain extracellular domains may be involved in dimerisation [].; GO: 0007155 cell adhesion, 0016021 integral to membrane; PDB: 1CID_A 1CDU_A 1WIQ_B 2NY4_B 2NY2_B 1WIP_B 1WIO_A 3S4S_G 1CDY_A 3S5L_G ....
Probab=95.87  E-value=0.12  Score=28.03  Aligned_cols=36  Identities=17%  Similarity=0.323  Sum_probs=23.5

Q ss_pred             cceEEEccCCCCCCeEEEEEE-ecCCCCCeeeEEEEEE
Q psy15390        105 GEQLNITKISRTEMGAYLCIA-TNNVPPSVSKRITVDV  141 (142)
Q Consensus       105 ~~~l~i~~~~~~d~g~y~C~a-~n~~~~~~s~~~~l~V  141 (142)
                      ...........+|+|.++|.| .+... .......|.|
T Consensus        42 ~~~~~~~~~~~~d~G~w~C~a~~~~~k-~~~s~~~i~v   78 (80)
T PF05790_consen   42 KKLVSTFTPTTEDSGTWVCTASDNEPK-ERESKIEILV   78 (80)
T ss_dssp             SSEEEEESBTCGGSEEEEEEEEECTTE-EEEEEEEEEE
T ss_pred             ceEEEEecCCCCCCEEEEEEEcCCceE-EEEEEEEEEc
Confidence            344566788889999999999 54443 2344444443


No 326
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). Ig6_hNeurofascin_like:  the sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). NF belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and a cytoplasmic domain. NF has many alternatively spliced isoforms having different temporal expression patterns during development. NF participates in axon subcellular targeting and synapse formation, however little is known of the functions of the different isoforms.
Probab=95.84  E-value=0.018  Score=30.84  Aligned_cols=23  Identities=26%  Similarity=0.238  Sum_probs=16.4

Q ss_pred             EEEeecC----CCCCeEEEEEEEecCC
Q psy15390         69 LNITKIS----RTEMGAYLCIATKIGP   91 (142)
Q Consensus        69 l~i~~v~----~~d~G~y~C~~~~~~~   91 (142)
                      |.|.++.    ..|+|.|.|.+.|...
T Consensus        41 L~i~~~~~~~~~~d~G~Y~C~A~N~~G   67 (77)
T cd05875          41 LVIDFSGGGRPEDYEGEYQCFARNNLG   67 (77)
T ss_pred             EEEeccCCCCCCCCCEEEEEEEEeccc
Confidence            5566553    2468999999998644


No 327
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. IgV_L_kappa: Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=95.83  E-value=0.0065  Score=34.60  Aligned_cols=21  Identities=19%  Similarity=0.506  Sum_probs=17.3

Q ss_pred             eEEEeecCCCCCeEEEEEEEe
Q psy15390         68 QLNITKISRTEMGAYLCIATK   88 (142)
Q Consensus        68 ~l~i~~v~~~d~G~y~C~~~~   88 (142)
                      .|.|.+++.+|+|.|.|.+.+
T Consensus        72 ~L~I~~~~~~Dsg~Y~Ca~~~   92 (106)
T cd04980          72 TLTISRVEPEDAAVYYCQQYG   92 (106)
T ss_pred             EEEECCCChHHCEEEEEEEeC
Confidence            588889999999999997654


No 328
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Ig_Siglec_N: immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Siglec refers to a structurally related protein family that specifically recognizes sialic acid in oligosaccharide chains of glycoproteins and glycolipids. Siglecs are type I transmembrane proteins, organized as an extracellular module composed of Ig-like domains (an N-terminal variable set of Ig-like carbohydrate recognition domains, and 1 to 16 constant Ig-like domains), followed by transmembrane and short cytoplasmic domains. Human siglecs are classified into two subgroups, one subgroup is comprised of sialoadhesin (Siglec-1), CD22 (Siglec-2), and MAG, the other subgroup is comprised of CD33-related Siglecs which include CD33 (Siglec-3) and human Siglecs 5-11.
Probab=95.78  E-value=0.013  Score=34.20  Aligned_cols=22  Identities=18%  Similarity=0.209  Sum_probs=16.2

Q ss_pred             ceEEEccCCCCCCeEEEEEEec
Q psy15390        106 EQLNITKISRTEMGAYLCIATN  127 (142)
Q Consensus       106 ~~l~i~~~~~~d~g~y~C~a~n  127 (142)
                      .+|.|.+++.+|+|.|.|.+..
T Consensus        80 ~sL~I~~l~~~Dsg~Y~C~~~~  101 (119)
T cd05712          80 CSLLISDAQPEDSGKYFFRVEL  101 (119)
T ss_pred             EEEEEccCChhhCeEEEEEEEc
Confidence            3577778888888888887754


No 329
>PF06328 Lep_receptor_Ig:  Ig-like C2-type domain;  InterPro: IPR010457 This entry represents a ligand-binding domain that displays similarity to C2-set immunoglobulin domains (antibody constant domain 2) []. The two cysteine residues form a disulphide bridge.; PDB: 3L5H_A 1P9M_A 1I1R_A 2D9Q_B.
Probab=95.74  E-value=0.14  Score=28.33  Aligned_cols=65  Identities=18%  Similarity=0.343  Sum_probs=38.2

Q ss_pred             CceeEEecCCcEEEEEEEecC-----CCCeeEEEecCCcceecCCcceEEeecc-ceEEEeecCCCCCeEEEEE
Q psy15390         18 PSSVAVREEFNITLTCKAEGF-----PAPEIKWRREDNQPISINKRKKVHMHYG-EQLNITKISRTEMGAYLCI   85 (142)
Q Consensus        18 ~~~~~~~~g~~v~l~C~~~~~-----~~~~~~w~~~~~~~~~~~~~~~~~~~~~-~~l~i~~v~~~d~G~y~C~   85 (142)
                      ++...+..|++++..|.....     ....+.|+. ++..++... .+ ...+. +..++.+.+...+-.|-|.
T Consensus        10 p~~pvv~lGS~vtasC~l~~~c~~~~~a~~I~Wkl-n~~~iP~~q-y~-~in~~~SsVT~~~~~~~~~~L~cC~   80 (89)
T PF06328_consen   10 PPSPVVSLGSNVTASCVLKQNCSHSVNASQIVWKL-NGEKIPGSQ-YR-VINDTVSSVTLPNLNPTGATLFCCK   80 (89)
T ss_dssp             CSSSEEETTS-EEEEEEE-CCCHCT-STTCEEEEC-SSCESTCGC-EE-EESTTEEEEEESS--SSEEEEEEEE
T ss_pred             cCCCEEeCCCCEEEEEEEECCCCCCcccceEEEEE-CCEECChhH-cc-eeCCeEEEEEEccCCCCCceEEEEE
Confidence            445567889999999998652     445788988 777554332 22 12222 4567777766666566665


No 330
>smart00406 IGv Immunoglobulin V-Type.
Probab=95.68  E-value=0.006  Score=32.52  Aligned_cols=59  Identities=25%  Similarity=0.594  Sum_probs=36.1

Q ss_pred             cEEEEEEEecCCCC--eeEEEecCC-cc---eec-----------CCcceEEeec-----cceEEEeecCCCCCeEEEEE
Q psy15390         28 NITLTCKAEGFPAP--EIKWRREDN-QP---ISI-----------NKRKKVHMHY-----GEQLNITKISRTEMGAYLCI   85 (142)
Q Consensus        28 ~v~l~C~~~~~~~~--~~~w~~~~~-~~---~~~-----------~~~~~~~~~~-----~~~l~i~~v~~~d~G~y~C~   85 (142)
                      ++.|.|........  .+.|++... ..   +..           ....++....     ...|.|.+++.+|+|.|.|.
T Consensus         1 ~v~l~C~~~~~~~~~~~v~W~~~~~~~~~~~l~~~~~~~~~~~~~~~~~R~~~~~~~~~~~~~L~i~~~~~~D~G~Y~C~   80 (81)
T smart00406        1 SVTLSCKASGFTFSSYYVSWVRQPPGKGLEWLGYIGSSGSTYYQQSYKGRVTISKDTSKNDVSLTISNLRVEDTGTYYCA   80 (81)
T ss_pred             CEEEEEEEeccccceeEEEEEEeCCCCCeEEEEEEcCCCcEEECcccCCcEEEEecCcCCEEEEEEcCCCHHHCEEEEEc
Confidence            47899988765543  688988421 11   110           1112222221     13699999999999999996


Q ss_pred             E
Q psy15390         86 A   86 (142)
Q Consensus        86 ~   86 (142)
                      +
T Consensus        81 v   81 (81)
T smart00406       81 V   81 (81)
T ss_pred             C
Confidence            3


No 331
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5. Ig1_Contactin-5: First Ig domain of the neural cell adhesion molecule contactin-5. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains, anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. In rats, a lack of contactin-5 (NB-2) results in an impairment of the neuronal activity in the auditory system. Contactin-5 is expressed specifically in the postnatal nervous system, peaking at about 3 weeks postnatal. Contactin-5 is highly expressed in the adult human brain in the occipital lobe and in the amygdala; lower levels of expression have been detected in the corpus callosum, caudate nucleus, and spinal cord.
Probab=95.66  E-value=0.013  Score=32.69  Aligned_cols=23  Identities=35%  Similarity=0.447  Sum_probs=17.6

Q ss_pred             EEEeecC-CCCCeEEEEEEEecCC
Q psy15390         69 LNITKIS-RTEMGAYLCIATKIGP   91 (142)
Q Consensus        69 l~i~~v~-~~d~G~y~C~~~~~~~   91 (142)
                      |.|.++. ..|+|.|.|.+.|...
T Consensus        60 L~i~~~~~~~D~G~Y~C~A~N~~G   83 (94)
T cd05848          60 LIISNPSEVKDSGRYQCLATNSIG   83 (94)
T ss_pred             EEEccCCccCcCEEEEEEEEcCCC
Confidence            4566664 6899999999998643


No 332
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). Ig4_SCFR: The fourth Immunoglobulin (Ig)-like domain in stem cell factor receptor (SCFR). SCFR is organized as an extracellular component having five IG-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR. This fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth domain abolishes the ligand-induced dimerization of SCFR and completely inhibits signal transduction.
Probab=95.54  E-value=0.018  Score=32.62  Aligned_cols=25  Identities=28%  Similarity=0.539  Sum_probs=22.2

Q ss_pred             ccceEEEeecCCCCCeEEEEEEEec
Q psy15390         65 YGEQLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        65 ~~~~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      ..+.|.+.+++.+|.|.|+|.+.|.
T Consensus        63 Y~S~L~L~Rlk~~E~G~YTf~a~N~   87 (101)
T cd05860          63 YVSELHLTRLKGTEGGTYTFLVSNS   87 (101)
T ss_pred             EEEEEEEeecChhhCcEEEEEEECC
Confidence            3457999999999999999999985


No 333
>PF08204 V-set_CD47:  CD47 immunoglobulin-like domain;  InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ].; PDB: 2VSC_B 2JJS_D 2JJT_C.
Probab=95.52  E-value=0.0072  Score=35.81  Aligned_cols=31  Identities=16%  Similarity=0.333  Sum_probs=17.8

Q ss_pred             EEecCCcEEEEEEEecCC-----CCeeEEEecCCcce
Q psy15390         22 AVREEFNITLTCKAEGFP-----APEIKWRREDNQPI   53 (142)
Q Consensus        22 ~~~~g~~v~l~C~~~~~~-----~~~~~w~~~~~~~~   53 (142)
                      ...-.++|.|+|.+....     ...+.|.. ++..+
T Consensus        23 ~t~CN~tV~IPC~v~n~~~~ni~~m~VkWk~-~~~~I   58 (130)
T PF08204_consen   23 YTVCNDTVVIPCFVNNLEANNISEMYVKWKF-KNKDI   58 (130)
T ss_dssp             E-TT-SEEEE--BBSS---SSGGGEEEEEEE-TTEEE
T ss_pred             EEecCCCEEEEeEeccccccccceEEEEEEE-CCeEE
Confidence            344599999999986522     22588998 66654


No 334
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins. Ig2_FGFR_like: domain similar to the second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three Ig-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin 
Probab=95.51  E-value=0.019  Score=30.85  Aligned_cols=23  Identities=22%  Similarity=0.445  Sum_probs=20.6

Q ss_pred             ceEEEeecCCCCCeEEEEEEEec
Q psy15390         67 EQLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        67 ~~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      ..|.|.+++.+|.|.|.|.+.|.
T Consensus        51 ~~l~i~~~~~~d~g~Y~C~~~n~   73 (85)
T cd05729          51 WTLILESVVPSDSGKYTCIVENK   73 (85)
T ss_pred             EEEEEeECCcccCEEEEEEEEEC
Confidence            36899999999999999999875


No 335
>PHA02633 hypothetical protein; Provisional
Probab=95.50  E-value=0.021  Score=29.14  Aligned_cols=25  Identities=20%  Similarity=0.473  Sum_probs=20.5

Q ss_pred             ccceEEEeecCCCCCeEEEEEEEec
Q psy15390         65 YGEQLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        65 ~~~~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      .+..|-|-++..+|+|.|.|...|.
T Consensus        16 ~~~nLwilpa~~sDSGiYiC~~rn~   40 (63)
T PHA02633         16 NCNNMLILNPTQSDSGIYMCITKNE   40 (63)
T ss_pred             ccccEEEeccccccCcEEEEEEcCC
Confidence            3446888999999999999988653


No 336
>PHA02987 Ig domain OX-2-like protein; Provisional
Probab=95.48  E-value=0.018  Score=36.17  Aligned_cols=24  Identities=25%  Similarity=0.528  Sum_probs=21.1

Q ss_pred             cceEEEeecCCCCCeEEEEEEEec
Q psy15390         66 GEQLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        66 ~~~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      ...+.|.+++.+|+|.|.|...-.
T Consensus        84 ~StItIknVt~sDeGcY~C~F~tf  107 (189)
T PHA02987         84 ESTILIKNVSLKDNGCYTCIFNTL  107 (189)
T ss_pred             cceEEEEeCChhhCeEEEEEEEec
Confidence            357999999999999999988754


No 337
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins. Ig1_Robo: domain similar to the first immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit res
Probab=95.38  E-value=0.019  Score=31.89  Aligned_cols=21  Identities=24%  Similarity=0.487  Sum_probs=16.4

Q ss_pred             EeecCCCCCeEEEEEEEecCC
Q psy15390         71 ITKISRTEMGAYLCIATKIGP   91 (142)
Q Consensus        71 i~~v~~~d~G~y~C~~~~~~~   91 (142)
                      +.++..+|+|.|+|.+.|...
T Consensus        68 ~~~~~~~D~G~Y~C~a~N~~G   88 (100)
T cd07693          68 HGRKGRSDEGVYVCVAHNSLG   88 (100)
T ss_pred             ccCCCcCcCEEEEEEEEcccc
Confidence            344578999999999998643


No 338
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1. Ig1_Contactin-1: First Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may, through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=95.36  E-value=0.021  Score=31.83  Aligned_cols=22  Identities=32%  Similarity=0.588  Sum_probs=17.4

Q ss_pred             EEEeecC-CCCCeEEEEEEEecC
Q psy15390         69 LNITKIS-RTEMGAYLCIATKIG   90 (142)
Q Consensus        69 l~i~~v~-~~d~G~y~C~~~~~~   90 (142)
                      |.|.++. ..|+|.|.|.+.|..
T Consensus        59 L~I~~~~~~~D~G~Y~C~A~N~~   81 (93)
T cd05849          59 LVINNPDKYKDAGRYVCIVSNIY   81 (93)
T ss_pred             EEECcCCcCCCCEEEEEEEEeCc
Confidence            4566664 589999999999863


No 339
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain. Ig_CD8_alpha: immunoglobulin (Ig)-like domain in CD8 alpha. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alphaalpha or alphabeta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a v-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain. The Ig domain of CD8 alpha binds to antibodies.
Probab=95.10  E-value=0.018  Score=32.75  Aligned_cols=20  Identities=20%  Similarity=0.567  Sum_probs=12.8

Q ss_pred             eEEEccCCCCCCeEEEEEEe
Q psy15390        107 QLNITKISRTEMGAYLCIAT  126 (142)
Q Consensus       107 ~l~i~~~~~~d~g~y~C~a~  126 (142)
                      .|.|..++.+|+|+|.|.+.
T Consensus        70 ~L~I~~~~~sDsgtY~Ca~~   89 (104)
T cd05720          70 VLTLKNFQKENEGYYFCSVA   89 (104)
T ss_pred             EEEECCCCHHHCEEEEEEEc
Confidence            36666666666666666654


No 340
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2. Ig1_Contactin-2: First Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=95.03  E-value=0.029  Score=31.24  Aligned_cols=23  Identities=26%  Similarity=0.446  Sum_probs=17.4

Q ss_pred             EEEeecC-CCCCeEEEEEEEecCC
Q psy15390         69 LNITKIS-RTEMGAYLCIATKIGP   91 (142)
Q Consensus        69 l~i~~v~-~~d~G~y~C~~~~~~~   91 (142)
                      |.|.++. ..|+|.|.|.+.|...
T Consensus        60 L~I~~~~~~~D~G~Y~C~A~N~~G   83 (94)
T cd05850          60 LVINNPQKARDAGSYQCLAINRCG   83 (94)
T ss_pred             EEEccCCccCcCEEEEEEEEcCcC
Confidence            4565544 5899999999998644


No 341
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain. IgV_CD8_beta: immunoglobulin (Ig)-like domain in CD8 beta. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alpha/alpha or alpha/beta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a V-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain.
Probab=95.01  E-value=0.018  Score=32.88  Aligned_cols=20  Identities=25%  Similarity=0.816  Sum_probs=17.0

Q ss_pred             eEEEeecCCCCCeEEEEEEE
Q psy15390         68 QLNITKISRTEMGAYLCIAT   87 (142)
Q Consensus        68 ~l~i~~v~~~d~G~y~C~~~   87 (142)
                      .|.|.+++.+|+|.|.|...
T Consensus        73 ~L~I~~~~~~Dsg~YyCa~~   92 (107)
T cd07700          73 RLHINRVKPEDSGTYFCMTV   92 (107)
T ss_pred             EEEECCCCHHHCEEEEEeEc
Confidence            58999999999999999754


No 342
>PF13895 Ig_2:  Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A ....
Probab=94.65  E-value=0.029  Score=29.64  Aligned_cols=30  Identities=30%  Similarity=0.530  Sum_probs=17.9

Q ss_pred             cCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        112 KISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       112 ~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      .+..+|+|.|+|.|.+..+...+..+.|.|
T Consensus        51 ~~~~~~~g~y~C~~~~~~~~~~s~~~~v~V   80 (80)
T PF13895_consen   51 NVSPEDSGNYTCRASNGSGSNTSTSVNVTV   80 (80)
T ss_dssp             SEEGGGTEEEEEEEEETTEEEEEEEEEEEE
T ss_pred             eeccccCEEEEEEEEeCCCCeEeeeEEeeC
Confidence            344556667777776655444566666654


No 343
>PHA03376 BARF1; Provisional
Probab=94.58  E-value=0.1  Score=33.09  Aligned_cols=26  Identities=23%  Similarity=0.230  Sum_probs=21.9

Q ss_pred             cccceEEEccCCCCCCeEEEEEEecC
Q psy15390        103 HYGEQLNITKISRTEMGAYLCIATNN  128 (142)
Q Consensus       103 ~~~~~l~i~~~~~~d~g~y~C~a~n~  128 (142)
                      .++-+|.|.+++.+|.|+|+|...-.
T Consensus        84 ~gnvsLvI~~l~lSDdGtY~C~fQkg  109 (221)
T PHA03376         84 ANTFFLVVTAANISHDGNYLCRMKLG  109 (221)
T ss_pred             CCeEEEEEEeeeecCCceEEEEEEcC
Confidence            35567889999999999999999754


No 344
>KOG4597|consensus
Probab=94.37  E-value=0.14  Score=36.91  Aligned_cols=28  Identities=14%  Similarity=0.098  Sum_probs=23.7

Q ss_pred             eeEEecCCcEEEEEEEecCCCCeeEEEe
Q psy15390         20 SVAVREEFNITLTCKAEGFPAPEIKWRR   47 (142)
Q Consensus        20 ~~~~~~g~~v~l~C~~~~~~~~~~~w~~   47 (142)
                      ...+.++++..++|-..|.+.+.|.|-+
T Consensus       205 ~w~vg~wetcS~tCg~~G~q~r~V~c~q  232 (560)
T KOG4597|consen  205 EWFVGDWETCSSTCGVQGRQYRVVTCEQ  232 (560)
T ss_pred             hhhcccchhhcccccccCCcCceeeeeh
Confidence            3457789999999999999999999965


No 345
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain. IgV_H: Immunoglobulin (Ig) heavy chain (H), variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin: IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which can associate with any of the heavy chains. This family includes alpha, gamma, delta, epsilon, and mu heavy chains.
Probab=94.36  E-value=0.065  Score=31.21  Aligned_cols=17  Identities=18%  Similarity=0.640  Sum_probs=8.6

Q ss_pred             EEEeecCCCCCeEEEEE
Q psy15390         69 LNITKISRTEMGAYLCI   85 (142)
Q Consensus        69 l~i~~v~~~d~G~y~C~   85 (142)
                      |.|.+++.+|+|.|.|.
T Consensus        78 L~I~~~~~~Dsa~YyCa   94 (117)
T cd04981          78 LQLNSLTPEDTAVYYCA   94 (117)
T ss_pred             EEECCCCHHHCEEEEEE
Confidence            45555555555555553


No 346
>PHA02914 Immunoglobulin-like domain protein; Provisional
Probab=94.32  E-value=0.58  Score=33.20  Aligned_cols=70  Identities=16%  Similarity=0.140  Sum_probs=45.1

Q ss_pred             ceeEEecCCcEEEEEEEecC---CCCeeEEEecCCcceec-----------------CCcceE-------EeeccceEEE
Q psy15390         19 SSVAVREEFNITLTCKAEGF---PAPEIKWRREDNQPISI-----------------NKRKKV-------HMHYGEQLNI   71 (142)
Q Consensus        19 ~~~~~~~g~~v~l~C~~~~~---~~~~~~w~~~~~~~~~~-----------------~~~~~~-------~~~~~~~l~i   71 (142)
                      ....+..|..|.+.|..+--   ......|+. .|-+..+                 +....+       .....++|+|
T Consensus       272 ~~~~~~~g~~v~~~c~~s~~~~e~i~~~~w~~-t~~~~~~~~g~~~~~~~v~~~~~~~~~~~i~~~~~~s~dlk~STLTI  350 (500)
T PHA02914        272 DEVMLEVGKRVDIECFFSMCGNENISNAKWID-TGFEIGPLIGTVKSKDIVEGDFAEDDDFMISAHANYSDDLKNSTLTI  350 (500)
T ss_pred             ceeEeccCcEEEEEEEEeecCCcccccceEEe-cCCcccceeEEEEecceeecccccCCceEEEEecccccchhhceEEe
Confidence            45566679999999998652   234578987 3332210                 000000       0122467999


Q ss_pred             eecCCCCCeEEEEEEEec
Q psy15390         72 TKISRTEMGAYLCIATKI   89 (142)
Q Consensus        72 ~~v~~~d~G~y~C~~~~~   89 (142)
                      .++.....|.|.|++...
T Consensus       351 kka~I~N~GCY~~~a~~g  368 (500)
T PHA02914        351 KKAHINNAGCYEAQAFMG  368 (500)
T ss_pred             eeEEEEcCCceEEEEecC
Confidence            999999999999999753


No 347
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of  intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins. Ig2_ ICAM-1_like: domain similar to the second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54). During the inflammation process, these molecules recruit leukocytes onto the vascular endothelium before extravasation to the injured tissues. ICAM-1 may be involved in organ targeted tumor metastasis. The interaction of ICAM-1 with leukocyte function-associated antigen-1 (LFA-1) plays a part in leukocyte-endothelial cell recognition. This group also contains ICAM-2, which also interacts with LFA-1. Transmigration of immature dendritic cells across resting endothelium is dependent on the interaction of ICAM-2 with, yet unidentified, ligand(s) on the dendritic cells. ICAM-1 has five Ig-like domains and ICAM-2 has two. ICAM-1 may also act as host receptor for viruses and parasites.
Probab=94.30  E-value=0.41  Score=27.17  Aligned_cols=56  Identities=13%  Similarity=0.231  Sum_probs=34.4

Q ss_pred             CCCCCeEEEEEEEecCCc-c--EEEEEEE--------e------ccccceEEEccCCCCCCe-EEEEEEecCCCC
Q psy15390         75 SRTEMGAYLCIATKIGPL-K--IFWEIIF--------H------MHYGEQLNITKISRTEMG-AYLCIATNNVPP  131 (142)
Q Consensus        75 ~~~d~G~y~C~~~~~~~~-~--~~w~~~~--------~------~~~~~~l~i~~~~~~d~g-~y~C~a~n~~~~  131 (142)
                      ...+.-..+|.+.+..++ .  +.|.+-.        .      ......+.+ .+..+|.| .|+|+|.+...+
T Consensus        14 ~eG~~~tL~C~v~g~~P~a~L~i~W~rG~~~l~~~~~~~~~~~~~~~~stlt~-~~~r~D~g~~~sC~A~l~l~~   87 (100)
T cd05755          14 PVGKNYTLQCDVPGVAPRQNLTVVLLRGNETLSRQPFGDNTKSPVNAPATITI-TVDREDHGANFSCETELDLRP   87 (100)
T ss_pred             cCCCcEEEEEEEcCcCCCCcEEEEEeeCCEEcccceeccccCCCceeEEEEEE-ecchhhCCcEEEEEEEeccCc
Confidence            345555678998875443 3  6886411        1      011223444 45667777 999999988765


No 348
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs). Ig2_Tyro3_like: the second immunoglobulin (Ig)-like domain in the Axl/Tyro3 family of receptor tyrosine kinases (RTKs). This family includes Axl (also known as Ark, Ufo, and Tyro7), Tyro3 (also known as Sky, Rse, Brt, Dtk, and Tif), and Mer (also known as Nyk, c-Eyk, and Tyro12). Axl/Tyro3 family receptors have an extracellular portion with two Ig-like domains followed by two fibronectin-types III (FNIII) domains, a membrane-spanning single helix, and a cytoplasmic tyrosine kinase domain. Axl, Tyro3 and Mer are widely expressed in adult tissues, though they show higher expression in the brain, in the lymphatic and vascular systems, and in the testis. Axl, Tyro3, and Mer bind the vitamin K dependent protein Gas6 with high affinity, and in doing so activate their tyrosine kinase activity. Axl/Gas6 signaling may play a part in cell adhesion processes, prevention of apoptosis, and c
Probab=94.20  E-value=0.08  Score=28.69  Aligned_cols=15  Identities=20%  Similarity=0.328  Sum_probs=12.1

Q ss_pred             CCCeEEEEEEEecCC
Q psy15390         77 TEMGAYLCIATKIGP   91 (142)
Q Consensus        77 ~d~G~y~C~~~~~~~   91 (142)
                      .|.|.|.|.+.|.-.
T Consensus        57 ~d~g~Y~C~A~N~~G   71 (81)
T cd05749          57 NETSKFSCEAHNAKG   71 (81)
T ss_pred             cCCeEEEEEEEeccC
Confidence            478999999998633


No 349
>PHA03042 CD47-like protein; Provisional
Probab=93.63  E-value=0.34  Score=32.45  Aligned_cols=59  Identities=20%  Similarity=0.367  Sum_probs=35.9

Q ss_pred             EecCCcEEEEEEEecC-----CCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEe
Q psy15390         23 VREEFNITLTCKAEGF-----PAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATK   88 (142)
Q Consensus        23 ~~~g~~v~l~C~~~~~-----~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~   88 (142)
                      ..-.+++.++|.....     ..-.+.|.. ++...-....     ....+|.+. -+..-.|+|+|.+.+
T Consensus        28 T~CN~TV~IpC~v~n~~~~ni~~~~V~Wkf-~~~~If~~n~-----tn~aSL~~~-f~~~l~GNYTCEv~~   91 (286)
T PHA03042         28 TTCNKTIVIVCNLNLLIYYNISNIHINWKF-NNKVIFKKNN-----TNTSSLKFN-FSKNLSGNYTCEAIN   91 (286)
T ss_pred             EecCceEEEEeecCChhhcCccceEEEEEe-CCeeEEEecC-----CcceEEEEe-ccccCCCceeEEEee
Confidence            4458999999998763     233589998 6665422110     011234433 344558999998875


No 350
>PHA02865 MHC-like TNF binding protein; Provisional
Probab=93.17  E-value=0.83  Score=31.76  Aligned_cols=21  Identities=29%  Similarity=0.524  Sum_probs=16.5

Q ss_pred             cEEEEEEEecCCCC--eeEEEecC
Q psy15390         28 NITLTCKAEGFPAP--EIKWRRED   49 (142)
Q Consensus        28 ~v~l~C~~~~~~~~--~~~w~~~~   49 (142)
                      .++|.|.+.|.-+.  .+.|.+ +
T Consensus       216 ~~tL~C~A~GFYP~~I~v~W~k-d  238 (338)
T PHA02865        216 NTTLFCTFDSHYPSSVAAKWYN-S  238 (338)
T ss_pred             CceEEEEEEeEeCCccEEEEEe-c
Confidence            58999999995443  578999 6


No 351
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig1_Neogenin: first immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=93.15  E-value=0.097  Score=29.03  Aligned_cols=15  Identities=27%  Similarity=0.643  Sum_probs=13.9

Q ss_pred             CCCCCeEEEEEEEec
Q psy15390         75 SRTEMGAYLCIATKI   89 (142)
Q Consensus        75 ~~~d~G~y~C~~~~~   89 (142)
                      ...|.|.|.|.+.|.
T Consensus        67 ~~~D~G~Y~C~a~N~   81 (95)
T cd05722          67 NKPDEGFYQCVAQND   81 (95)
T ss_pred             CCCcCEEEEEEEECC
Confidence            789999999999987


No 352
>PF07354 Sp38:  Zona-pellucida-binding protein (Sp38);  InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals. These are sperm proteins that bind to the 90 kDa family of zona pellucida glycoproteins in a calcium-dependent manner []. These represent some of the specific molecules that mediate the first steps of gamete interaction, allowing fertilisation to occur [].; GO: 0007339 binding of sperm to zona pellucida, 0005576 extracellular region
Probab=92.75  E-value=0.24  Score=32.95  Aligned_cols=30  Identities=13%  Similarity=0.299  Sum_probs=24.1

Q ss_pred             EeccccceEEEccCCCCCCeEEEEEEecCC
Q psy15390        100 FHMHYGEQLNITKISRTEMGAYLCIATNNV  129 (142)
Q Consensus       100 ~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~  129 (142)
                      ..+...+.|.+.+-..+++|.|+|..+-..
T Consensus        31 ~nIT~TG~L~~~~F~esmSG~YTCtLsYk~   60 (271)
T PF07354_consen   31 VNITETGKLMFKNFQESMSGSYTCTLSYKP   60 (271)
T ss_pred             EEEccCceEEeeccccccCCceEEEEEEEe
Confidence            345567789999999999999999887543


No 353
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4  (Necl-4, also known as cell adhesion molecule 4 (CADM4)). Ig2_Necl-4: second immunoglobulin (Ig)-like domain of nectin-like molecule-4  (Necl-4, also known as cell adhesion molecule 4 (CADM4)). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1-Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Ig domains are likely to participate in ligand binding and recognition. Necl-4 is expressed on Schwann cells, and plays a key part in initiating peripheral nervous system (PNS) myelination.  In injured peripheral nerve cells, the mRNA signal for both Necl-4 and Necl-5 was observed to be elevated.  Necl-4 participates in cell-cell adhesion and is proposed to play a role in tumor suppression.
Probab=92.37  E-value=0.21  Score=27.09  Aligned_cols=27  Identities=7%  Similarity=0.090  Sum_probs=22.0

Q ss_pred             ccceEEEeecCCCCCeEEEEEEEecCC
Q psy15390         65 YGEQLNITKISRTEMGAYLCIATKIGP   91 (142)
Q Consensus        65 ~~~~l~i~~v~~~d~G~y~C~~~~~~~   91 (142)
                      ..+.|.+......|.+.|.|.+.|...
T Consensus        41 ~~s~L~~~~~~~Ddg~~~~C~A~n~a~   67 (80)
T cd05885          41 VSNTIRFPVDRKDDGAILSCEASHPAL   67 (80)
T ss_pred             EEEEEEEEeeeccCCcEEEEEEEChhh
Confidence            345688888889999999999998643


No 354
>PHA03240 envelope glycoprotein M; Provisional
Probab=92.03  E-value=0.62  Score=30.05  Aligned_cols=66  Identities=14%  Similarity=0.176  Sum_probs=38.2

Q ss_pred             ceeEEecCCcEEEEEEEecCCCCeeEEEe-------cCCcce----ec-----CC---------cceEEe-eccceEEEe
Q psy15390         19 SSVAVREEFNITLTCKAEGFPAPEIKWRR-------EDNQPI----SI-----NK---------RKKVHM-HYGEQLNIT   72 (142)
Q Consensus        19 ~~~~~~~g~~v~l~C~~~~~~~~~~~w~~-------~~~~~~----~~-----~~---------~~~~~~-~~~~~l~i~   72 (142)
                      ..+.+.+|.+|+|.-.-.-.+.-.+.||+       .+|...    ..     +.         ..++.. =.+++|.|.
T Consensus        31 ievt~r~G~nVTLga~~~lhpgq~v~Wy~~~c~~~~G~G~~~~plC~Ytppk~~r~ktl~~t~~nt~i~y~C~NstL~i~  110 (258)
T PHA03240         31 EEHTTREGDPLLLGGGHGLGAGQKAHWYKHKCDGITGNGDKLHPICTYDPPKNGKGKTLDESAENSFILYECHNSTLIIA  110 (258)
T ss_pred             eecccccCCceeeCCcccCCCCCEEEEEeeecccccCCCCCCceeEEecCCccccccccccccCCCceEEEeccceEEEE
Confidence            34567889999996432213444789998       222211    00     00         011111 135679999


Q ss_pred             ecCCCCCeEEEE
Q psy15390         73 KISRTEMGAYLC   84 (142)
Q Consensus        73 ~v~~~d~G~y~C   84 (142)
                      +++.+|+|+|--
T Consensus       111 ~vn~sd~~nYcr  122 (258)
T PHA03240        111 HLNLSDAGEYCR  122 (258)
T ss_pred             EEeecCcchhhh
Confidence            999999999843


No 355
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). Ig2_KIRREL3-like: domain similar to the second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=91.37  E-value=0.24  Score=26.55  Aligned_cols=24  Identities=21%  Similarity=0.254  Sum_probs=18.8

Q ss_pred             ceEEEeecCCCCCeEEEEEEEecC
Q psy15390         67 EQLNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        67 ~~l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      +.|.+......|.|.|+|.+.|..
T Consensus        46 s~L~i~~~~~~~~~~y~C~a~n~~   69 (82)
T cd05759          46 STLPITPSDHDTGRTFTCRARNEA   69 (82)
T ss_pred             EEEEEeCceecCCCEEEEEEcCcc
Confidence            357777777778889999998753


No 356
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. Ig_CD3_gamma_delta; immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. CD3 is a T cell surface receptor that is associated with alpha/beta T cell receptors (TCRs).  The CD3 complex consists of one gamma, one delta, two epsilon, and two zeta chains.  The CD3 subunits form heterodimers as gamma/epsilon, delta/epsilon, and zeta/zeta.  The gamma, delta, and epsilon chains each contain an extracellular Ig domain, whereas the extracellular domains of the zeta chains are very small and have unknown structure. The CD3 domain participates in intracellular signalling once the TCR has bound an MHC/antigen complex.
Probab=90.97  E-value=0.92  Score=23.80  Aligned_cols=36  Identities=17%  Similarity=0.289  Sum_probs=25.3

Q ss_pred             ccEEEEEEEec--cccceEEEccCCCCCCeEEEEEEec
Q psy15390         92 LKIFWEIIFHM--HYGEQLNITKISRTEMGAYLCIATN  127 (142)
Q Consensus        92 ~~~~w~~~~~~--~~~~~l~i~~~~~~d~g~y~C~a~n  127 (142)
                      ..|.|.+-...  .....+.+-.....-.|.|.|.+.+
T Consensus        17 tsi~W~kG~~~~~~~~~tlnLGs~~~DPRG~Y~C~~s~   54 (69)
T cd07691          17 TNITWKKGKEILEVSNTLLDLGSRINDPRGTYSCKESE   54 (69)
T ss_pred             CcEEEecCcccccccccEEeccCcccCCCcceEecCcc
Confidence            45888762111  1245677877788889999999987


No 357
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain. IgC_MHC_I_alpha3;  Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class I alpha chain. Class I MHC proteins bind antigenic peptide fragments and present them to CD8+ T lymphocytes.  Class I molecules consist of a transmembrane alpha chain and a small chain called the beta2 microglobulin. The alpha chain contains three extracellular domains, two of which fold together to form the peptide-binding cleft (alpha1 and alpha2), and one which has an Ig fold (alpha3).  Peptide binding to class I molecules occurs in the endoplasmic reticulum (ER) and involves both chaperones and dedicated factors to assist in peptide loading.  Class I MHC molecules are expressed on most nucleated cells.
Probab=90.63  E-value=1.8  Score=23.90  Aligned_cols=53  Identities=11%  Similarity=0.122  Sum_probs=32.9

Q ss_pred             CCCeEEEEEEEecC--CccEEEEEEEe-c-----------cccceEE---EccCCCCCCeEEEEEEecCC
Q psy15390         77 TEMGAYLCIATKIG--PLKIFWEIIFH-M-----------HYGEQLN---ITKISRTEMGAYLCIATNNV  129 (142)
Q Consensus        77 ~d~G~y~C~~~~~~--~~~~~w~~~~~-~-----------~~~~~l~---i~~~~~~d~g~y~C~a~n~~  129 (142)
                      .+.....|.+.+.-  ...+.|.+... .           ..++.+.   ...+..++.+.|+|.+.+..
T Consensus        14 ~~~~~L~C~a~gF~P~~i~v~W~~~g~~~~~~~~~~~~~~~~d~ty~~~s~l~v~~~~~~~ytC~V~H~~   83 (93)
T cd07698          14 DGSLTLSCHATGFYPRDIEVTWLRDGEDSVDDVESGEILPNGDGTYQLWVTLEVPPEDKARYSCRVEHSG   83 (93)
T ss_pred             CCcEEEEEEEEEEeCCCcEEEEEECCEECcccccccceEECCCCeEEEEEEEEECCCCCCEEEEEEEeCC
Confidence            34568999999853  34889976431 1           1122222   23445567789999998764


No 358
>PHA03052 Hypothetical protein; Provisional
Probab=90.39  E-value=1.6  Score=22.80  Aligned_cols=35  Identities=23%  Similarity=0.440  Sum_probs=25.6

Q ss_pred             CceeEEecCCcEEEEEEEecCC---CCeeEEEecCCcce
Q psy15390         18 PSSVAVREEFNITLTCKAEGFP---APEIKWRREDNQPI   53 (142)
Q Consensus        18 ~~~~~~~~g~~v~l~C~~~~~~---~~~~~w~~~~~~~~   53 (142)
                      |..+.+..|.++++.|++.-.+   .+.+.|.. ++...
T Consensus         4 P~~i~~slGs~ltI~Ckv~lg~g~~~a~V~W~~-N~~~~   41 (69)
T PHA03052          4 PEGIVTSLGSNLTITCKVSLRPPTTDADVFWIS-NGMYY   41 (69)
T ss_pred             CccEEEEccCCceEeEEEEecCCCcceEEEEEe-CCcEE
Confidence            4667788899999999985432   34577776 77766


No 359
>PHA03189 UL14 tegument protein; Provisional
Probab=90.04  E-value=4.7  Score=27.75  Aligned_cols=21  Identities=19%  Similarity=0.312  Sum_probs=15.9

Q ss_pred             CceeEEecCCcEEEEEEEecC
Q psy15390         18 PSSVAVREEFNITLTCKAEGF   38 (142)
Q Consensus        18 ~~~~~~~~g~~v~l~C~~~~~   38 (142)
                      +.+..+..|+.++++|.+-..
T Consensus        59 pAP~l~pyGdrvtVpC~fp~H   79 (348)
T PHA03189         59 PAPLLVPYGDRVTVPCTFPTH   79 (348)
T ss_pred             CCccccCCCceeeeeeeecCC
Confidence            445567789999999997543


No 360
>PHA03270 envelope glycoprotein C; Provisional
Probab=87.34  E-value=9.2  Score=27.75  Aligned_cols=34  Identities=21%  Similarity=0.303  Sum_probs=25.8

Q ss_pred             eeEEecCCcEEEEEEEecCCCC---eeEEEecCCccee
Q psy15390         20 SVAVREEFNITLTCKAEGFPAP---EIKWRREDNQPIS   54 (142)
Q Consensus        20 ~~~~~~g~~v~l~C~~~~~~~~---~~~w~~~~~~~~~   54 (142)
                      ...+.+|+...-.|.+...-++   .+.|++ |+..+.
T Consensus       228 ~~PvL~Ge~Y~AtC~va~YYPp~Sv~lrWf~-ng~~V~  264 (466)
T PHA03270        228 PHAVLEGEPFGATCVAANYYPGDRAAFRWFE-GGDEVF  264 (466)
T ss_pred             CCccccCCCceEEEEeeeecCCCceEEEEEe-CCcccc
Confidence            3356789999999999874333   689999 887764


No 361
>PF05790 C2-set:  Immunoglobulin C2-set domain;  InterPro: IPR008424 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents C2-set domains, which are Ig-like domains resembling the antibody constant domain. C2-set domains are found primarily in the mammalian T-cell surface antigens CD2 (Cluster of Differentiation 2), CD4 and CD80, as well as in vascular (VCAM) and intercellular (ICAM) cell adhesion molecules. CD2 mediates T-cell adhesion via its ectodomain, and signal transduction utilising its 117-amino acid cytoplasmic tail []. CD2 displays structural and functional similarities with African swine fever virus (ASFV) LMW8-DR, a protein that is involved in cell-cell adhesion and immune response modulation, suggesting a possible role in the pathogenesis of ASFV infection []. CD4 is the primary receptor for HIV-1. CD4 has four immunoglobulin-like domains in its extracellular region that share the same structure, but can differ in sequence. Certain extracellular domains may be involved in dimerisation [].; GO: 0007155 cell adhesion, 0016021 integral to membrane; PDB: 1CID_A 1CDU_A 1WIQ_B 2NY4_B 2NY2_B 1WIP_B 1WIO_A 3S4S_G 1CDY_A 3S5L_G ....
Probab=86.51  E-value=3.6  Score=22.27  Aligned_cols=22  Identities=14%  Similarity=0.400  Sum_probs=18.1

Q ss_pred             cceEEEeecCCCCCeEEEEEEE
Q psy15390         66 GEQLNITKISRTEMGAYLCIAT   87 (142)
Q Consensus        66 ~~~l~i~~v~~~d~G~y~C~~~   87 (142)
                      ............|+|.+.|.+.
T Consensus        42 ~~~~~~~~~~~~d~G~w~C~a~   63 (80)
T PF05790_consen   42 KKLVSTFTPTTEDSGTWVCTAS   63 (80)
T ss_dssp             SSEEEEESBTCGGSEEEEEEEE
T ss_pred             ceEEEEecCCCCCCEEEEEEEc
Confidence            3456778888999999999994


No 362
>PHA02982 hypothetical protein; Provisional
Probab=84.64  E-value=8.8  Score=25.06  Aligned_cols=31  Identities=13%  Similarity=0.253  Sum_probs=25.3

Q ss_pred             eccccceEEEccCCCCCCeEEEEEEecCCCC
Q psy15390        101 HMHYGEQLNITKISRTEMGAYLCIATNNVPP  131 (142)
Q Consensus       101 ~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~  131 (142)
                      .....++|.|+++..++.|=|+|.|....+.
T Consensus        95 v~g~~STLTIkk~~i~N~GCYtc~~ks~~~k  125 (251)
T PHA02982         95 VSGNSSTFTMKKPDPQNLGCFTCEAKDAEGK  125 (251)
T ss_pred             EeccceeEEeccCCcccCCceEEEEecCCCc
Confidence            3345678999999999999999999875543


No 363
>PF11465 Receptor_2B4:  Natural killer cell receptor 2B4;  InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells. It plays a role in activating NK-mediated cytotoxicity through its interaction with CD48 on target cells in a subset of CD8 T cells []. The structure of 2B4 consists of an immunoglobulin variable domain fold and contains two beta-sheets. One of the beta-sheets, the six-stranded sheet, contains structural features that may have a role in ligand recognition and receptor function []. This entry represents the 2B4 immunoglobulin domain.; GO: 0005488 binding; PDB: 2PTU_D 2PTT_B 1Z2K_A.
Probab=84.55  E-value=1.7  Score=24.96  Aligned_cols=26  Identities=19%  Similarity=0.102  Sum_probs=20.1

Q ss_pred             ccceEEEeecCCCCCeEEEEEEEecC
Q psy15390         65 YGEQLNITKISRTEMGAYLCIATKIG   90 (142)
Q Consensus        65 ~~~~l~i~~v~~~d~G~y~C~~~~~~   90 (142)
                      .+.+|.|..++..|+|.|.-.+.+..
T Consensus        69 enlaLlIkaAq~qDSG~Y~LEvT~~s   94 (108)
T PF11465_consen   69 ENLALLIKAAQPQDSGLYCLEVTNES   94 (108)
T ss_dssp             TTTEEEESS-SGGG-EEEEEEEEETT
T ss_pred             cCceEEEeecCcccCceEEEEEEcCC
Confidence            44689999999999999999888743


No 364
>PHA03042 CD47-like protein; Provisional
Probab=83.18  E-value=12  Score=25.44  Aligned_cols=50  Identities=20%  Similarity=0.350  Sum_probs=27.5

Q ss_pred             eEEEEEEEec-----CCccEEEEEEE------eccccceEEEccCCCCCCeEEEEEEecCCC
Q psy15390         80 GAYLCIATKI-----GPLKIFWEIIF------HMHYGEQLNITKISRTEMGAYLCIATNNVP  130 (142)
Q Consensus        80 G~y~C~~~~~-----~~~~~~w~~~~------~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~  130 (142)
                      -...|.+.+.     ....+.|....      ...+..+|.. +-...-.|+|||+|.+...
T Consensus        34 V~IpC~v~n~~~~ni~~~~V~Wkf~~~~If~~n~tn~aSL~~-~f~~~l~GNYTCEv~~l~n   94 (286)
T PHA03042         34 IVIVCNLNLLIYYNISNIHINWKFNNKVIFKKNNTNTSSLKF-NFSKNLSGNYTCEAINKFN   94 (286)
T ss_pred             EEEEeecCChhhcCccceEEEEEeCCeeEEEecCCcceEEEE-eccccCCCceeEEEeeccc
Confidence            3445666553     34457886421      1122334544 3334458999999987543


No 365
>PHA03282 envelope glycoprotein E; Provisional
Probab=81.46  E-value=4.7  Score=29.46  Aligned_cols=49  Identities=12%  Similarity=0.185  Sum_probs=32.5

Q ss_pred             ccEEEEEEEeccccceEEEccCCCCCCeEEEEEEecCCCC-CeeeEEEEEE
Q psy15390         92 LKIFWEIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPP-SVSKRITVDV  141 (142)
Q Consensus        92 ~~~~w~~~~~~~~~~~l~i~~~~~~d~g~y~C~a~n~~~~-~~s~~~~l~V  141 (142)
                      ++.-|...+... +.++.|..+..+|+|.|+..+...... .....+.|.|
T Consensus       111 ~e~~~~~rvs~~-n~tl~l~~a~~~DsG~Y~L~~~~~~~~~~~~~~v~l~V  160 (540)
T PHA03282        111 PEFAWPPRVAVV-NGTLVLREARETDSGMYVLSVSRAPNSTAARAVVFLVV  160 (540)
T ss_pred             cccccCcceeEe-cceEEEeeccccCCceEEEEecCCCCchhheEEEEEEe
Confidence            456775555554 455999999999999999997543332 2334455555


No 366
>PHA02914 Immunoglobulin-like domain protein; Provisional
Probab=79.16  E-value=6  Score=28.40  Aligned_cols=24  Identities=21%  Similarity=0.220  Sum_probs=16.5

Q ss_pred             eEEEeecCCCCCeEEEEEEEecCC
Q psy15390         68 QLNITKISRTEMGAYLCIATKIGP   91 (142)
Q Consensus        68 ~l~i~~v~~~d~G~y~C~~~~~~~   91 (142)
                      .+.+.|+...|.|.|.|.....+.
T Consensus        82 sf~~~Nvs~sdEGrYrCIFYLn~~  105 (500)
T PHA02914         82 SFIEENIGEHEDGDFKCIFYLGDN  105 (500)
T ss_pred             EEEecCcccccCCcEEEEEEeCCc
Confidence            467777778888888886554443


No 367
>PHA03271 envelope glycoprotein C; Provisional
Probab=78.99  E-value=15  Score=26.68  Aligned_cols=34  Identities=21%  Similarity=0.381  Sum_probs=25.6

Q ss_pred             eEEecCCcEEEEEEEecCCCC---eeEEEecCCcceec
Q psy15390         21 VAVREEFNITLTCKAEGFPAP---EIKWRREDNQPISI   55 (142)
Q Consensus        21 ~~~~~g~~v~l~C~~~~~~~~---~~~w~~~~~~~~~~   55 (142)
                      ..+.+|+...-.|.+...-++   .+.|+. +|.....
T Consensus       255 ~PVL~Ge~YkAtC~vAnYYPP~SvrlrWf~-nG~~V~~  291 (490)
T PHA03271        255 PPVLSGENYKASCIVRHFYPPGSVYVSWRQ-NGNIATP  291 (490)
T ss_pred             CccccCCCceEEEEeeeecCCCceEEEEEe-CCccccC
Confidence            346689999999999874333   689999 7877643


No 368
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4). IgV_CTLA-4: domain similar to the variable(v)-type immunoglobulin (Ig) domain found in cytotoxic T lymphocyte-associated antigen 4 (CTLA-4).  CTLA-4 is involved in the regulation of T cell response, acting as an inhibitor of intracellular signalling.  CTLA-4 is similar to CD28, a T cell co-receptor protein that recognizes the B7 proteins (CD80 and CD86). CD28 binding of the B7 proteins occurs after the presentation of antigen to the T cell receptor (TCR) via the peptide-MHC complex on the surface of an antigen presenting cell (APC).  CTLA-4 also binds the B7 molecules with a higher affinity than does CD28.  The B7/CTLA-4 interaction generates inhibitory signals down-regulating the response, and may prevent T cell activation by weak TCR signals. CD28 and CTLA-4 then elicit opposing signals in the regulation of T cell responsiveness and homeostasis. T cell activation leads to increased 
Probab=77.36  E-value=3.5  Score=24.07  Aligned_cols=20  Identities=10%  Similarity=0.468  Sum_probs=11.6

Q ss_pred             eEEEccCCCCCCeEEEEEEe
Q psy15390        107 QLNITKISRTEMGAYLCIAT  126 (142)
Q Consensus       107 ~l~i~~~~~~d~g~y~C~a~  126 (142)
                      .|.+.+++.+|++.|.|..+
T Consensus        75 ~L~l~~L~a~DTa~Y~Ca~e   94 (115)
T cd05721          75 NFTLQNLRANQTDIYFCKIE   94 (115)
T ss_pred             EEEEcCCCHHHCeEEEEEee
Confidence            35555666666666666444


No 369
>PF02440 Adeno_E3_CR1:  Adenovirus E3 region protein CR1;  InterPro: IPR003471 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host []. This region called CR1 (conserved region 1) [] is found three times in Human adenovirus 19 (a subgroup D virus) 49 Kd protein in the E3 region. CR1 is also found in the 20.1 Kd protein of subgroup B adenoviruses. The function of this 80 amino acid region is unknown. This region is probably a divergent immunoglobulin domain.
Probab=75.75  E-value=9.2  Score=19.73  Aligned_cols=21  Identities=33%  Similarity=0.594  Sum_probs=14.4

Q ss_pred             EecCCcEEEEEEEecCCCCeeEEEe
Q psy15390         23 VREEFNITLTCKAEGFPAPEIKWRR   47 (142)
Q Consensus        23 ~~~g~~v~l~C~~~~~~~~~~~w~~   47 (142)
                      +..|++++|.    |.+...+.||+
T Consensus         2 v~~G~N~TL~----Gp~~~~V~Wy~   22 (63)
T PF02440_consen    2 VTVGSNVTLV----GPPDGPVTWYK   22 (63)
T ss_pred             EeEcCcEEEe----CCCCCceEEEE
Confidence            4468888874    44555799984


No 370
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain. IgC_MHC_II_beta: Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class II beta chain.  MHC class II molecules play a key role in the initiation of the antigen-specific immune reponse. In both humans and in mice these molecules have been shown to be expressed constitutively on the cell surface of professional antigen-presenting cells (APCs), for example on B-lymphocytes, monocytes, and macrophages. The expression of these molecules has been shown to be induced in nonprofessional APCs such as keratinocyctes, and they are expressed on the surface of activated human T cells and on T cells from other species. The MHC II molecules present antigenic peptides to CD4(+) T-lymphocytes. These peptides derive mostly from protelytic processing via the endocytic pathway, of antigens internalized by the APC. These peptides bind to the MHC class II molecules in the endosome be
Probab=73.04  E-value=14  Score=20.52  Aligned_cols=53  Identities=9%  Similarity=0.149  Sum_probs=30.2

Q ss_pred             CCCeEEEEEEEec--CCccEEEEEEEec------------cccceEEE---ccCCCCCCeEEEEEEecCC
Q psy15390         77 TEMGAYLCIATKI--GPLKIFWEIIFHM------------HYGEQLNI---TKISRTEMGAYLCIATNNV  129 (142)
Q Consensus        77 ~d~G~y~C~~~~~--~~~~~~w~~~~~~------------~~~~~l~i---~~~~~~d~g~y~C~a~n~~  129 (142)
                      .......|.+.+.  +...+.|.+....            ..++.+.+   ..+..++...|+|.+....
T Consensus        14 ~~~~~L~C~~~gFyP~~i~v~W~~~g~~~~~~~~~~~~~~~~dgTy~~~s~L~~~~~~~~~ysC~V~H~~   83 (94)
T cd05766          14 SHPHLLVCHVWGFYPPEITVKWFKNGQEETEGVVSTELIPNGDWTYQILVMLETTPSRGDTYTCVVEHSS   83 (94)
T ss_pred             CCCeEEEEEEeeecCCCCEEEEEECCeecCCCceecceEECCCCcEEEEEEEEEcCCCCCEEEEEEEeCC
Confidence            4556789998874  3446788754211            11122222   1233445569999998654


No 371
>cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain. IgC_TCR_gamma;  immunoglobulin (Ig) constant (C) domain of the gamma chain of gamma-delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha-beta TCRs but a small subset contain gamma-delta TCRs. Alpha-beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma-delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma-delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds.
Probab=72.29  E-value=15  Score=20.60  Aligned_cols=23  Identities=22%  Similarity=0.632  Sum_probs=16.3

Q ss_pred             CCCeEEEEEEEec--CCccEEEEEE
Q psy15390         77 TEMGAYLCIATKI--GPLKIFWEII   99 (142)
Q Consensus        77 ~d~G~y~C~~~~~--~~~~~~w~~~   99 (142)
                      .+.+.+.|.+.+.  +...+.|.+.
T Consensus        16 ~~~~tL~C~a~gFyP~~I~v~W~kn   40 (96)
T cd07697          16 QGQGIYLCLLENFFPDVIQVHWREG   40 (96)
T ss_pred             CCCEEEEEEEEEEeCCCeEEEEEEC
Confidence            4556889999874  4566789754


No 372
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin. IgC_beta2m: Immunoglobulin-like domain in beta2-Microglobulin (beta2m). Beta2m is the non-covalently bound light chain of the human class I major histocompatibility complex (MHC-I). Beta2m is structured as a beta-sandwich domain composed of two facing beta-sheets (four stranded and three stranded), that is typical of the C-type immunoglobulin superfamily. This structure is stabilized by an intramolecular disulfide bridge connecting two Cys residues in the facing beta -sheets. In vivo, MHC-I continuously exposes beta2m on the cell surface, where it may be released to plasmatic fluids, transported to the kidneys, degraded and then excreted.
Probab=71.33  E-value=16  Score=20.39  Aligned_cols=48  Identities=17%  Similarity=0.134  Sum_probs=29.1

Q ss_pred             EEEEEEEec--CCccEEEEEEEec-----------cccceEEE---ccCCCCCCeEEEEEEecC
Q psy15390         81 AYLCIATKI--GPLKIFWEIIFHM-----------HYGEQLNI---TKISRTEMGAYLCIATNN  128 (142)
Q Consensus        81 ~y~C~~~~~--~~~~~~w~~~~~~-----------~~~~~l~i---~~~~~~d~g~y~C~a~n~  128 (142)
                      ...|.+.+.  +...+.|.++...           ..++.+.+   ..+..++...|+|.+...
T Consensus        19 ~L~C~a~gFyP~~i~v~W~~dg~~~~~~~~~~~~p~~d~tyq~~s~l~~~~~~~~~ysC~V~H~   82 (93)
T cd05770          19 VLNCYVTGFHPPDIEIRLLKNGVKIPKVEQSDLSFSKDWTFYLLKSTEFTPTKGDEYACRVRHN   82 (93)
T ss_pred             EEEEEEEEEeCCCCEEEEEECCEECCCcEECcEEECCCCCEEEEEEEEECCCCCCeEEEEEEEC
Confidence            578998874  5567789764322           12233332   123455666899999864


No 373
>PHA03269 envelope glycoprotein C; Provisional
Probab=70.88  E-value=41  Score=25.11  Aligned_cols=35  Identities=20%  Similarity=0.283  Sum_probs=26.1

Q ss_pred             eeEEecCCcEEEEEEEecCCCC---eeEEEecCCcceec
Q psy15390         20 SVAVREEFNITLTCKAEGFPAP---EIKWRREDNQPISI   55 (142)
Q Consensus        20 ~~~~~~g~~v~l~C~~~~~~~~---~~~w~~~~~~~~~~   55 (142)
                      ...+.+|+...-.|.+...-++   .+.|++ |+..+..
T Consensus       336 p~PVL~Ge~YkAtC~vA~YYPp~SvrlrWf~-ng~~V~~  373 (566)
T PHA03269        336 GDPVLLGNPYAAYCKVNKYYPPHSVIVKWTS-NFGNIGK  373 (566)
T ss_pred             CCccccCCCceEEEEeeeecCCCceEEEEEe-CCcccCc
Confidence            3456789999999999874333   689999 7777653


No 374
>PHA03286 envelope glycoprotein E; Provisional
Probab=70.59  E-value=13  Score=27.12  Aligned_cols=38  Identities=26%  Similarity=0.360  Sum_probs=29.4

Q ss_pred             ccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        104 YGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       104 ~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      ..+.|.|.+++.+++|.|+-...|..+......+.|.|
T Consensus       125 ~~~~L~I~nAt~qnaGiYtly~rnd~~~~~~~vflVtV  162 (492)
T PHA03286        125 RGKELTILNASSQNAGIYIRYSRNGTRTAVMDVLVVWV  162 (492)
T ss_pred             CCCceEEeeccccccceEEEEEcCCCCcEEEEEEEEEE
Confidence            34679999999999999999999887664444444555


No 375
>PHA03283 envelope glycoprotein E; Provisional
Probab=66.64  E-value=28  Score=26.09  Aligned_cols=39  Identities=15%  Similarity=0.099  Sum_probs=29.4

Q ss_pred             cccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEEC
Q psy15390        103 HYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDVE  142 (142)
Q Consensus       103 ~~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V~  142 (142)
                      .+.+.+.|.+++.+++|.|+-...+..+. ....+.|.||
T Consensus       131 ~~~~~l~I~~at~~~aGVYtly~r~d~~~-~~~vflvtVk  169 (542)
T PHA03283        131 PERSVLQIQRATPNIAGVYTLHVSSDGMM-KHSVFFVTVK  169 (542)
T ss_pred             CCCCeeEEEecccccCeEEEEEecCCCce-EEEEEEEEec
Confidence            34678999999999999999999987663 3334446654


No 376
>PF06832 BiPBP_C:  Penicillin-Binding Protein C-terminus Family;  InterPro: IPR009647 This conserved region of approximately 90 residues is found in a sub-group of bacterial Penicillin-Binding Proteins (PBPs). A variable length loop region separates this region from the transpeptidase unit (IPR001460 from INTERPRO). It is predicted to be a beta fold.
Probab=66.45  E-value=19  Score=19.59  Aligned_cols=45  Identities=22%  Similarity=0.293  Sum_probs=26.4

Q ss_pred             CCCeeeecCCCCceeEEecC--CcEEEEEEEecCCCCeeEEEecCCccee
Q psy15390          7 VPPNILDTESTPSSVAVREE--FNITLTCKAEGFPAPEIKWRREDNQPIS   54 (142)
Q Consensus         7 ~~p~~~~~~~~~~~~~~~~g--~~v~l~C~~~~~~~~~~~w~~~~~~~~~   54 (142)
                      .++.+..|. ....+.+..+  +...|.+++.+. ...+.|+. ||+.+.
T Consensus         9 ~~l~I~~P~-~g~~~~~~~~~~~~~~l~l~a~~~-~~~~~W~v-dg~~~g   55 (89)
T PF06832_consen    9 SPLRITSPP-DGAVLALDPGIPERQPLVLKAAGG-RGPVYWFV-DGEPLG   55 (89)
T ss_pred             CCCEEEecC-CCCEEEeCCCCCccceEEEEEeCC-CCcEEEEE-CCEEcc
Confidence            466666642 2223333332  255666666665 44899999 998873


No 377
>PF02480 Herpes_gE:  Alphaherpesvirus glycoprotein E;  InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein. gE is involved in virus spread but is not essential for propagation [].; GO: 0016020 membrane; PDB: 2GJ7_F 2GIY_B.
Probab=64.24  E-value=2.2  Score=31.01  Aligned_cols=37  Identities=19%  Similarity=0.203  Sum_probs=0.0

Q ss_pred             cceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEE
Q psy15390        105 GEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDV  141 (142)
Q Consensus       105 ~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V  141 (142)
                      .+.|.|.+++.+|+|.|+-...|..+......+.|.|
T Consensus        88 ~~~l~i~~a~~~~~GvY~l~~~~~~~~~~~~~~~v~v  124 (439)
T PF02480_consen   88 KGGLSILNATEQDSGVYTLYVRNDSGWAHQSVVFVTV  124 (439)
T ss_dssp             -------------------------------------
T ss_pred             CCceEEeccccccCeeEEEEecCCCCceEEEEEEEEE
Confidence            3458888888888888888887766553333344444


No 378
>PF11049 KSHV_K1:  Glycoprotein K1 of Kaposi's sarcoma-associated herpes virus;  InterPro: IPR021022  This is a highly glycosylated cytoplasmic and membrane protein similar to the immunoglobulin receptor family that is expressed as an inducible early-lytic-cycle gene product in primary effusion lymphoma cell-lines. This domain would appear to be the cytoplasmic region of the protein []. 
Probab=63.94  E-value=19  Score=18.73  Aligned_cols=44  Identities=18%  Similarity=0.397  Sum_probs=23.9

Q ss_pred             EEEEEEecCCCCeeEEEecCCcceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEe
Q psy15390         30 TLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATK   88 (142)
Q Consensus        30 ~l~C~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~   88 (142)
                      +|.|.....  .-+.||.++.+.+.         ....++.+.+    -.++|.|..+.
T Consensus         2 tltC~s~~s--LPiswYcN~TRLlR---------lt~~Tlt~~~----ltcNFtCV~qS   45 (71)
T PF11049_consen    2 TLTCPSNAS--LPISWYCNGTRLLR---------LTQQTLTVVT----LTCNFTCVGQS   45 (71)
T ss_pred             ceecCCCCC--CcccEEECCceeee---------ecCCeEeeee----eeEEeeecCCC
Confidence            467765432  34789994444432         2223444433    34778886543


No 379
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain. IgC_MHC_II_alpha: Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class II alpha chain.  MHC class II molecules play a key role in the initiation of the antigen-specific immune reponse. In both humans and in mice these molecules have been shown to be expressed constitutively on the cell surface of professional antigen-presenting cells (APCs), for example on B-lymphocytes, monocytes, and macrophages. The expression of these molecules has been shown to be induced in nonprofessional APCs such as keratinocyctes, and they are expressed on the surface of activated human T cells and on T cells from other species. The MHC II molecules present antigenic peptides to CD4(+) T-lymphocytes. These peptides derive mostly from protelytic processing via the endocytic pathway, of antigens internalized by the APC. These peptides bind to the MHC class II molecules in the endosom
Probab=63.47  E-value=24  Score=19.64  Aligned_cols=51  Identities=14%  Similarity=0.184  Sum_probs=28.7

Q ss_pred             CeEEEEEEEec--CCccEEEEEEEec------------cccceEEE---ccCCCCCCeEEEEEEecCC
Q psy15390         79 MGAYLCIATKI--GPLKIFWEIIFHM------------HYGEQLNI---TKISRTEMGAYLCIATNNV  129 (142)
Q Consensus        79 ~G~y~C~~~~~--~~~~~~w~~~~~~------------~~~~~l~i---~~~~~~d~g~y~C~a~n~~  129 (142)
                      .....|.+.+.  ....+.|.++...            ..++.+.+   ..+..++...|+|.+....
T Consensus        17 ~~tL~C~a~gFyP~~I~v~W~~~g~~~~~~~~~~~~~~~~Dgty~~~s~L~v~~~~~~~ytC~V~H~~   84 (94)
T cd05767          17 PNTLICFVDNFFPPVLNVTWLKNGVPVTDGVSETRYYPRQDLSFQKFSYLNFTPEEGDIYSCIVEHWG   84 (94)
T ss_pred             CeEEEEEEEEEECCcCEEEEEECCeEccCceEEeeeEeCCCCcEEEEEEEEEECCCCCeEEEEEEeCC
Confidence            34689988874  4567788753211            11222221   1223345569999998653


No 380
>PF15096 G6B:  G6B family
Probab=62.63  E-value=15  Score=23.49  Aligned_cols=15  Identities=20%  Similarity=0.669  Sum_probs=11.6

Q ss_pred             cCCCCCeEEEEEEEe
Q psy15390         74 ISRTEMGAYLCIATK   88 (142)
Q Consensus        74 v~~~d~G~y~C~~~~   88 (142)
                      +...|+|.|+|..-.
T Consensus        81 Ls~GDSGTFfCkGr~   95 (224)
T PF15096_consen   81 LSAGDSGTFFCKGRQ   95 (224)
T ss_pred             hhcCCccceEecCcc
Confidence            367899999998543


No 381
>cd05890 Ig2_Nectin-1_like Second immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins. Ig2_Nectin-1_like: domain similar to the second immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111). Nectin-1 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through 4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. Nectins also heterophilically trans-interact with other CAMs such as nectin-like molecules (necls); nectin-1 for example, has been shown to trans-interact with necl-1. Nectins also interact with various other proteins, including the actin filament (F-actin)-binding protein, afadin. Mutation in the human nectin-1 gene is associ
Probab=58.79  E-value=32  Score=19.50  Aligned_cols=18  Identities=33%  Similarity=0.807  Sum_probs=13.7

Q ss_pred             EEEEE-EecCCCCeeEEEe
Q psy15390         30 TLTCK-AEGFPAPEIKWRR   47 (142)
Q Consensus        30 ~l~C~-~~~~~~~~~~w~~   47 (142)
                      .=.|. +.|.|++.|.|..
T Consensus        24 VA~CiSa~GrPpa~ItW~t   42 (98)
T cd05890          24 VATCVSANGKPPSVVRWDT   42 (98)
T ss_pred             EEEEEcCCCcCCcEeEEEc
Confidence            33688 5678888999976


No 382
>PHA03273 envelope glycoprotein C; Provisional
Probab=58.19  E-value=75  Score=23.62  Aligned_cols=34  Identities=9%  Similarity=0.309  Sum_probs=26.1

Q ss_pred             eeEEecCCcEEEEEEEecCCCC---eeEEEecCCccee
Q psy15390         20 SVAVREEFNITLTCKAEGFPAP---EIKWRREDNQPIS   54 (142)
Q Consensus        20 ~~~~~~g~~v~l~C~~~~~~~~---~~~w~~~~~~~~~   54 (142)
                      ...+.+|+...-.|.+...-++   .+.|++ ++..+.
T Consensus       244 ~~PvL~Ge~y~A~C~aa~YYPp~Sv~~rWf~-dg~~V~  280 (486)
T PHA03273        244 VHPSLKGENYRAVCVVASYFPHSSVKLRWYK-NAKEVD  280 (486)
T ss_pred             CCccccCCCceEEEEeeeecCCCceEEEEEe-CCeecc
Confidence            3456789999999999874333   689999 888776


No 383
>KOG3611|consensus
Probab=51.51  E-value=25  Score=27.72  Aligned_cols=61  Identities=18%  Similarity=0.348  Sum_probs=35.6

Q ss_pred             cEEEEEEEecCCCCeeEEEec-CC--cceecCCcceEEeeccceEEEeecCCCCCeEEEEEEEec
Q psy15390         28 NITLTCKAEGFPAPEIKWRRE-DN--QPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKI   89 (142)
Q Consensus        28 ~v~l~C~~~~~~~~~~~w~~~-~~--~~~~~~~~~~~~~~~~~~l~i~~v~~~d~G~y~C~~~~~   89 (142)
                      ...|.|...+... .+.|+.. .+  ................+.+.+..++..|.|.|.|.+...
T Consensus       571 ~~~l~c~~~~~~a-~~~w~~~~~~~~~~~~~~~~~~~~~~~~G~lll~~~q~~~~G~y~c~~~e~  634 (737)
T KOG3611|consen  571 SEVLRCVPSSNQA-PVVWYHQSTKDGRKEEVRQRDVVSRTDEGGLVLLSVQKLDGGTYPCYADES  634 (737)
T ss_pred             cceeecccccccc-ceeeEeeccCccccceeccCcceeecccCceeEEEEeeccCcccccccccC
Confidence            4677887655444 3778742 22  111111111212223455888899999999999988754


No 384
>PHA03281 envelope glycoprotein E; Provisional
Probab=49.93  E-value=60  Score=24.67  Aligned_cols=39  Identities=10%  Similarity=0.142  Sum_probs=27.7

Q ss_pred             ccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEEEEC
Q psy15390        104 YGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDVE  142 (142)
Q Consensus       104 ~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l~V~  142 (142)
                      ..+.|.|.+++.+++|.|+-...+..|...-..+.|.||
T Consensus       296 ~~~vL~I~nAT~~naGVYtly~rg~~G~s~~svfLVtVk  334 (642)
T PHA03281        296 EPGVLKFEHMEAHHAGVYIWNLQGSDGENMYATFLVKLK  334 (642)
T ss_pred             cCCeeEEEecccccceeEEEEecCCCCcceeEEEEEEec
Confidence            356799999999999999998886655432223445553


No 385
>PHA03286 envelope glycoprotein E; Provisional
Probab=45.99  E-value=72  Score=23.64  Aligned_cols=31  Identities=19%  Similarity=0.358  Sum_probs=23.5

Q ss_pred             eEEEccCCCCCCeEEEEEEecCCCCCeeeEEE
Q psy15390        107 QLNITKISRTEMGAYLCIATNNVPPSVSKRIT  138 (142)
Q Consensus       107 ~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~  138 (142)
                      .|.+.++..+++|.|.|.+.-...+ ..|...
T Consensus       308 nL~f~nA~~s~SGLYVfVl~yNGH~-eAWtYt  338 (492)
T PHA03286        308 SFRLANAQPTDAGLYVVVALYNGRP-LAWTYV  338 (492)
T ss_pred             ceeecCCCcccCceEEEEEEECCcc-eeeeEE
Confidence            5888999999999999999744333 356554


No 386
>PHA02935 Hypothetical protein; Provisional
Probab=43.13  E-value=41  Score=21.88  Aligned_cols=18  Identities=28%  Similarity=0.575  Sum_probs=12.3

Q ss_pred             EEEeecCCCCCeEEEEEE
Q psy15390         69 LNITKISRTEMGAYLCIA   86 (142)
Q Consensus        69 l~i~~v~~~d~G~y~C~~   86 (142)
                      |.|..++-+|+|.|.-..
T Consensus       104 lnisslryedsgsykgvs  121 (349)
T PHA02935        104 LNISSLRYEDSGSYKGVS  121 (349)
T ss_pred             eeccceeeccCCcccCch
Confidence            566667778888876543


No 387
>PF03921 ICAM_N:  Intercellular adhesion molecule (ICAM), N-terminal domain;  InterPro: IPR013768 Intercellular adhesion molecules (ICAMs) and vascular cell adhesion molecule-1 (VCAM-1) are part of the immunoglobulin superfamily. They are important in inflammation, immune responses and in intracellular signalling events []. The ICAM family consists of five members, designated ICAM-1 to ICAM-5. They are known to bind to leucocyte integrins CD11/CD18 during inflammation and in immune responses. In addition, ICAMs may exist in soluble forms in human plasma, due to activation and proteolysis mechanisms at cell surfaces. ICAM-1 (CD54) contains five Ig-like domains. It is expressed on leucocytes, endothelial and epithelial cells, and is upregulated in response to bacterial invasion. The protein is a ligand for lymphocyte-function associated (LFA) antigens and also a receptor for CD11a,b/CD18, fibrinogen, human rhinovirus and Plasmodium falciparum-infected erythrocytes. ICAM-1 binding sites for CD11a/CD18 and its other binding partners are located in the first domain and are overlapping. ICAM-1 domain 2 seems to play an important role in maintaining the conformation of domain 1 and particularly the structural integrity of the LFA-1 ligand-binding site []. The 3-dimensional atomic structure of the tandem N-terminal Ig-like domains (D1 and D2) of ICAM-1 has been determined to 2.2A resolution and fitted into a cryoelectron microscopy reconstruction of a rhinovirus-ICAM-1 complex []. Extensive charge interactions between ICAM-1 and human rhinovirusesare largely conserved in major and minor receptor groups of rhinoviruses. The interaction of ICAMs with LFA-1 is mediated by a divalent cation bound to the insertion (I)-domain on the alpha chain of LFA-1 and the carboxyl group of a conserved glutamic acid residue on ICAMs. ICAM-2 (CD102) has two Ig-like domains. It is expressed on endothelial cells, leucocytes and platelets, and binds to CD11a'b/CD18. The protein is refractory to proinflammatory cytokines, and plays an important role in the adhesion of leucocytes to the uninduced endothelium []. ICAM-3 (CD50) contains five Ig-like domains and binds to leucocyte integrins CD11a'd/CD18. The protein plays an important role in the immune response and perhaps in signal transduction []. ICAM-4 (LW blood group Ag) is red blood cell (RBC) specific and binds to CD11a'b/CD18. It is associated with the RBC Rh antigens and could be important in retaining immature red cells in the bone marrow, or in the uptake of senescent cells into the spleen []. ICAM-5 (telencephalin) has nine Ig-like domains and is confined to the telencephalon of the brain. The role of this CD11a/CD18 binding molecule is not yet known []. VCAM-1 was first described as a cytokine-inducible endothelial adhesion molecule. It can bind to leucocyte integrin VL-4 (very late antigen-4) to recruit leucocytes to sites of inflammation []. The predominant form of VCAM-1 in vivo has an N-terminal extracellular region comprising seven Ig-like domains []. A conserved integrin-binding motif has been identified in domains 1 and 4, variants of which are present in the N-terminal domain of all members of the integrin-binding subgroup of the immunoglobulin superfamily. The structure of a VLA-4-binding fragment comprising the first two domains of VCAM-1 has been determined to 1.8A resolution. The integrin-binding motif is exposed and forms the N-terminal region of the loop between beta-strands C and D of domain 1 []. VCAM-1 domains 1 and 2 are structurally similar to ICAM-1 and ICAM-2 []. This entry represents the N-terminal domain of ICAM proteins such as ICAM-2, ICAM-3 and ICAM-4.; PDB: 3BN3_B 1T0P_B 1ZXQ_A 3TCX_A 1MQ8_A 1Z7Z_I 1IC1_A 1IAM_A.
Probab=40.62  E-value=67  Score=17.95  Aligned_cols=30  Identities=20%  Similarity=0.410  Sum_probs=21.3

Q ss_pred             CCceeEEecCCcEEEEEEEecCCCC-eeEEEe
Q psy15390         17 TPSSVAVREEFNITLTCKAEGFPAP-EIKWRR   47 (142)
Q Consensus        17 ~~~~~~~~~g~~v~l~C~~~~~~~~-~~~w~~   47 (142)
                      .|+...+..|+++.+.|..+ -+.+ .+.|..
T Consensus         9 ~P~~~vV~~G~Sv~VNCSts-C~~p~~~GLET   39 (91)
T PF03921_consen    9 SPEEPVVPPGGSVWVNCSTS-CPQPEKIGLET   39 (91)
T ss_dssp             ESSEEEEETTEEEEEEEEES-SSS-SEEEEES
T ss_pred             ECCccEECCCCCEEEEEcCC-CCCCCcceEEE
Confidence            56777889999999999874 3433 455544


No 388
>PF01688 Herpes_gI:  Alphaherpesvirus glycoprotein I;  InterPro: IPR002874 This family consists of glycoprotein I from various members of the alphaherpesvirinae. These include Human herpesvirus 1 (HHV-1), Human herpesvirus 3 (HHV-3) and Suid herpesvirus 1 (Pseudorabies virus). Glycoprotein I (gI) is important during natural infection, mutants lacking gI produce smaller lesions at the site of infection and show reduced neuronal spread []. gI forms a heterodimeric complex with gE; this complex displays Fc receptor activity (binds to the Fc region of immunoglobulin) []. Glycoproteins are also important in the production of virus-neutralizing antibodies and cell mediated immunity []. The alphaherpesviridae have a dsDNA genome and have no RNA stage during viral replication.; GO: 0033643 host cell part
Probab=35.76  E-value=1.1e+02  Score=19.15  Aligned_cols=25  Identities=20%  Similarity=0.158  Sum_probs=20.4

Q ss_pred             cceEEEccCCCCCCeEEEEEEecCC
Q psy15390        105 GEQLNITKISRTEMGAYLCIATNNV  129 (142)
Q Consensus       105 ~~~l~i~~~~~~d~g~y~C~a~n~~  129 (142)
                      .--|.|.+.+.+|+|.|.-++.=..
T Consensus       123 ~~lL~i~~p~~~dsG~Y~lRV~l~~  147 (161)
T PF01688_consen  123 GVLLRIRNPRPEDSGIYYLRVWLDG  147 (161)
T ss_pred             ceEEEeCCCCcccceEEEEEEEECC
Confidence            3358899999999999999998443


No 389
>PHA03282 envelope glycoprotein E; Provisional
Probab=35.48  E-value=1.1e+02  Score=22.94  Aligned_cols=32  Identities=19%  Similarity=0.224  Sum_probs=23.5

Q ss_pred             ceEEEccCCCCCCeEEEEEEecCCCCCeeeEEE
Q psy15390        106 EQLNITKISRTEMGAYLCIATNNVPPSVSKRIT  138 (142)
Q Consensus       106 ~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~  138 (142)
                      -.|.+.++..+++|.|.|++.-.-.. ..|...
T Consensus       333 VdL~F~nAp~saSGLYVfVl~yNGHV-eAW~Yt  364 (540)
T PHA03282        333 VNLQLRDASEASGGLYVCVVYVNGHV-HAWGHV  364 (540)
T ss_pred             cceEecCCCcccCceEEEEEEECCee-eeeEEE
Confidence            36888999999999999999743322 355443


No 390
>PF10572 UPF0556:  Uncharacterised protein family UPF0556;  InterPro: IPR018887  This family of proteins has no known function. 
Probab=34.88  E-value=1.2e+02  Score=18.99  Aligned_cols=12  Identities=33%  Similarity=0.628  Sum_probs=5.5

Q ss_pred             CCeEEEEEEecC
Q psy15390        117 EMGAYLCIATNN  128 (142)
Q Consensus       117 d~g~y~C~a~n~  128 (142)
                      |.+.|+|.+..+
T Consensus        71 d~~~~sC~I~RP   82 (158)
T PF10572_consen   71 DNGHYSCIIWRP   82 (158)
T ss_pred             CCCceEEEEECC
Confidence            334455554433


No 391
>PF12988 DUF3872:  Domain of unknown function, B. Theta Gene description (DUF3872);  InterPro: IPR024355 This entry represents proteins of unknown function found primarily in Bacteroides species. The Bacteroides thetaiotaomicron gene coding for this protein is located in a conjugate transposon and appears to be upregulated in the presence of host or other bacterial species compared to growth in pure culture [, ].; PDB: 2L3B_A 2L7Q_A.
Probab=30.71  E-value=92  Score=18.91  Aligned_cols=30  Identities=10%  Similarity=0.286  Sum_probs=17.0

Q ss_pred             EEecCCcEEEEEEEecCC-----CCeeEEEecCCc
Q psy15390         22 AVREEFNITLTCKAEGFP-----APEIKWRREDNQ   51 (142)
Q Consensus        22 ~~~~g~~v~l~C~~~~~~-----~~~~~w~~~~~~   51 (142)
                      .+..|+++.++|......     ...+.++..+|+
T Consensus        43 ~I~~GeTvEIR~~l~reG~y~~t~Y~iRYFQ~dGk   77 (137)
T PF12988_consen   43 KIKKGETVEIRCELKREGNYADTRYTIRYFQPDGK   77 (137)
T ss_dssp             S--TTEEEEEEEEEEESS--SS---EEEEE-SSS-
T ss_pred             ccCCCCEEEEEEEEecCceecccEEEEEEEeecCC
Confidence            467899999999986522     224566654443


No 392
>PF11327 DUF3129:  Protein of unknown function (DUF3129);  InterPro: IPR021476  This eukaryotic family of proteins has no known function. 
Probab=28.37  E-value=1.3e+02  Score=19.34  Aligned_cols=26  Identities=15%  Similarity=0.401  Sum_probs=18.6

Q ss_pred             eEEEeecCCCCCeEEEEEEEecCCcc
Q psy15390         68 QLNITKISRTEMGAYLCIATKIGPLK   93 (142)
Q Consensus        68 ~l~i~~v~~~d~G~y~C~~~~~~~~~   93 (142)
                      .+.++.|+..-+|.|+|.+...+.-.
T Consensus        94 ~mt~hQVN~DGaGP~~C~iD~tg~g~  119 (184)
T PF11327_consen   94 SMTIHQVNADGAGPFTCDIDETGTGT  119 (184)
T ss_pred             EEEEEEecCCCCcCeEEEECCCCCcc
Confidence            46778888877888888776555443


No 393
>PF02480 Herpes_gE:  Alphaherpesvirus glycoprotein E;  InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein. gE is involved in virus spread but is not essential for propagation [].; GO: 0016020 membrane; PDB: 2GJ7_F 2GIY_B.
Probab=27.92  E-value=83  Score=23.26  Aligned_cols=35  Identities=20%  Similarity=0.231  Sum_probs=22.4

Q ss_pred             ccceEEEccCCCCCCeEEEEEEecCCCCCeeeEEEE
Q psy15390        104 YGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITV  139 (142)
Q Consensus       104 ~~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~l  139 (142)
                      +.-.|.+.++..+++|.|.|.+.-.-.. ..|...+
T Consensus       267 ~~~~l~f~~a~~~~sGLYv~V~~~nghv-~aW~yt~  301 (439)
T PF02480_consen  267 NGVDLQFTNAPESASGLYVFVVYYNGHV-EAWTYTL  301 (439)
T ss_dssp             TSSSEEESS--GGG-EEEEEEEEETTEE-EEEEEEE
T ss_pred             CCcceEecCCCcccCceEEEEEEECCee-eeeEEEE
Confidence            3456889999999999999999744322 4565543


No 394
>COG5475 Uncharacterized small protein [Function unknown]
Probab=26.89  E-value=96  Score=15.59  Aligned_cols=13  Identities=23%  Similarity=0.317  Sum_probs=8.2

Q ss_pred             eEEEEEEecCCCC
Q psy15390        119 GAYLCIATNNVPP  131 (142)
Q Consensus       119 g~y~C~a~n~~~~  131 (142)
                      |.|.|+=.+..|.
T Consensus        29 Gmy~C~Wf~g~g~   41 (60)
T COG5475          29 GMYECRWFDGYGV   41 (60)
T ss_pred             CeEEEEEecCCCc
Confidence            6666666665554


No 395
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=23.51  E-value=43  Score=14.99  Aligned_cols=10  Identities=30%  Similarity=0.640  Sum_probs=6.7

Q ss_pred             CCCCeEEEEE
Q psy15390        115 RTEMGAYLCI  124 (142)
Q Consensus       115 ~~d~g~y~C~  124 (142)
                      ..+.|.|.|.
T Consensus        20 ~~~dG~~yC~   29 (36)
T PF11781_consen   20 YSDDGFYYCD   29 (36)
T ss_pred             EccCCEEEhh
Confidence            3467888884


No 396
>KOG3743|consensus
Probab=22.28  E-value=1.1e+02  Score=23.31  Aligned_cols=29  Identities=17%  Similarity=0.355  Sum_probs=20.0

Q ss_pred             ceeEEecCCcEEEEEEEecCCCCeeEEEe
Q psy15390         19 SSVAVREEFNITLTCKAEGFPAPEIKWRR   47 (142)
Q Consensus        19 ~~~~~~~g~~v~l~C~~~~~~~~~~~w~~   47 (142)
                      +.-.+.-|..|.|-|.+.|...|.+...+
T Consensus       376 r~g~i~ygsvV~LV~~vTG~~lppLIIRK  404 (622)
T KOG3743|consen  376 RDGYIKYGSVVKLVCSVTGITLPPLIIRK  404 (622)
T ss_pred             CCcceeeccEEEEEeecccccCCcceeee
Confidence            34456779999999999996555443333


No 397
>PRK15372 pathogenicity island 2 effector protein SseI; Provisional
Probab=22.26  E-value=66  Score=21.77  Aligned_cols=12  Identities=17%  Similarity=0.545  Sum_probs=5.8

Q ss_pred             cCCCCCCeEEEE
Q psy15390        112 KISRTEMGAYLC  123 (142)
Q Consensus       112 ~~~~~d~g~y~C  123 (142)
                      +++..|+|+|+-
T Consensus        79 Svt~dda~~YTV   90 (292)
T PRK15372         79 SVTLDDVGNYTV   90 (292)
T ss_pred             EEEEcCCCceEE
Confidence            444455555543


No 398
>PHA03290 envelope glycoprotein I; Provisional
Probab=22.21  E-value=1.4e+02  Score=21.29  Aligned_cols=25  Identities=20%  Similarity=0.247  Sum_probs=20.5

Q ss_pred             ccceEEEccCCCCCCeEEEEEEecC
Q psy15390        104 YGEQLNITKISRTEMGAYLCIATNN  128 (142)
Q Consensus       104 ~~~~l~i~~~~~~d~g~y~C~a~n~  128 (142)
                      ..--|.|.+...+|+|.|.-++.=.
T Consensus       127 ~~vLL~I~~P~~~DSGiY~LRV~Ld  151 (357)
T PHA03290        127 AEIIFKINKPGIEDAGIYLLLVQLD  151 (357)
T ss_pred             cceEEEeCCCCcccCeeEEEEEEeC
Confidence            3446789999999999999998743


No 399
>PHA03283 envelope glycoprotein E; Provisional
Probab=20.71  E-value=3.2e+02  Score=20.96  Aligned_cols=33  Identities=18%  Similarity=0.181  Sum_probs=23.9

Q ss_pred             cceEEEccCCCCCCeEEEEEEecCCCCCeeeEEE
Q psy15390        105 GEQLNITKISRTEMGAYLCIATNNVPPSVSKRIT  138 (142)
Q Consensus       105 ~~~l~i~~~~~~d~g~y~C~a~n~~~~~~s~~~~  138 (142)
                      +-.|.+.++..+++|.|.|.+.-.-.. ..|...
T Consensus       314 ~v~L~f~nap~~~SGLYVfVv~yNgHv-eAW~Yt  346 (542)
T PHA03283        314 RVDLLFKNAPASASGLYVFVLLYNGHP-EAWTYT  346 (542)
T ss_pred             CcceEeccCCcccCceEEEEEEECCee-eeeEEE
Confidence            446888999999999999999743332 355544


No 400
>PHA03292 envelope glycoprotein I; Provisional
Probab=20.19  E-value=3.5e+02  Score=19.79  Aligned_cols=26  Identities=27%  Similarity=0.257  Sum_probs=20.9

Q ss_pred             ccceEEEccCCCCCCeEEEEEEecCC
Q psy15390        104 YGEQLNITKISRTEMGAYLCIATNNV  129 (142)
Q Consensus       104 ~~~~l~i~~~~~~d~g~y~C~a~n~~  129 (142)
                      ...-|.|.+...+|+|.|.-++.=..
T Consensus       126 ~~vLL~I~~P~~~DSGiY~LRV~Ldg  151 (413)
T PHA03292        126 TNVLLNITGPQPADSGAYILRVKLDH  151 (413)
T ss_pred             cceEEEeCCCCcccceeEEEEEEeCC
Confidence            34568889999999999999987443


Done!