Diaphorina citri psyllid: psy15390

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140--
MSAYKSVPPNILDTESTPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDVE
cCEEECcccCECcccccccCEEEEccccEEEEEEEECccccEEEEEEccccccccccccEEEEEcccEEEEEEccccccEEEEEEEEccccccEEEEEEEEEEcccccEEEEEcccccEEEEEEEccccccCEEEEEEEEcc
MSAYKSVPPNILD*********VREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDVE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSAYKSVPPNILDTESTPSSVAVREEFNITLTCKAEGFPAPEIKWRREDNQPISINKRKKVHMHYGEQLNITKISRTEMGAYLCIATKIGPLKIFWEIIFHMHYGEQLNITKISRTEMGAYLCIATNNVPPSVSKRITVDVE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044421 [CC]extracellular region partprobableGO:0005575, GO:0005576
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0000794 [CC]condensed nuclear chromosomeprobableGO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0005694, GO:0000793, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0048731 [BP]system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0030017 [CC]sarcomereprobableGO:0005737, GO:0005575, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422, GO:0044449
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0030154 [BP]cell differentiationprobableGO:0032502, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DMK, chain A
Confidence level:very confident
Coverage over the Query: 6-135
View the alignment between query and template
View the model in PyMOL