RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy15409
         (149 letters)



>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like
           Protein Serine/Threonine Kinases.  Serine/threonine
           kinases (STKs), Ste20-like kinase (SLK)-like subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The SLK-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of the subfamily include SLK, STK10
           (also called LOK for lymphocyte-oriented kinase), SmSLK
           (Schistosoma mansoni SLK), and related proteins. SLK
           promotes apoptosis through apoptosis signal-regulating
           kinase 1 (ASK1) and the mitogen-activated protein kinase
           (MAPK) p38. It also plays a role in mediating actin
           reorganization. STK10 is responsible in regulating the
           CD28 responsive element in T cells, as well as leukocyte
           function associated antigen (LFA-1)-mediated lymphocyte
           adhesion. SmSLK is capable of activating the MAPK Jun
           N-terminal kinase (JNK) pathway in human embryonic
           kidney (HEK) cells as well as in Xenopus oocytes. It may
           participate in regulating MAPK cascades during
           host-parasite interactions.
          Length = 280

 Score = 89.4 bits (222), Expect = 2e-22
 Identities = 32/38 (84%), Positives = 35/38 (92%)

Query: 2   TLQKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           TLQK +TFIGTPYWMAPEVV CETF+DNPYD+K DIWS
Sbjct: 156 TLQKRDTFIGTPYWMAPEVVACETFKDNPYDYKADIWS 193


>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein
           Serine/Threonine Kinase, STK10 or Lymphocyte-oriented
           kinase.  Serine/threonine kinases (STKs), STK10
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           STK10 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Other names for STK10 include
           lymphocyte-oriented kinase (LOK) and Xenopus polo-like
           kinase kinase 1 (xPlkk1). STK10 is highly expressed in
           lymphocytes and is responsible in regulating leukocyte
           function associated antigen (LFA-1)-mediated lymphocyte
           adhesion. It plays a role in regulating the CD28
           responsive element in T cells, and may also function as
           a regulator of polo-like kinase 1 (Plk1), a protein
           which is overexpressed in multiple tumor types.
          Length = 292

 Score = 78.5 bits (193), Expect = 3e-18
 Identities = 28/38 (73%), Positives = 34/38 (89%)

Query: 2   TLQKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           TLQ+ ++FIGTPYWMAPEVV+CET +D PYD+K DIWS
Sbjct: 163 TLQRRDSFIGTPYWMAPEVVMCETMKDTPYDYKADIWS 200


>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine
           Kinase, Ste20-like kinase.  Serine/threonine kinases
           (STKs), Ste20-like kinase (SLK) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The SLK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. SLK promotes
           apoptosis through apoptosis signal-regulating kinase 1
           (ASK1) and the mitogen-activated protein kinase (MAPK)
           p38. It acts as a MAPK kinase kinase (MAPKKK) by
           phosphorylating ASK1, resulting in the phosphorylation
           of p38. SLK also plays a role in mediating actin
           reorganization. It is part of a microtubule-associated
           complex that is targeted at adhesion sites, and is
           required in focal adhesion turnover and in regulating
           cell migration.
          Length = 282

 Score = 74.7 bits (183), Expect = 6e-17
 Identities = 26/38 (68%), Positives = 34/38 (89%)

Query: 2   TLQKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           T+Q+ ++FIGTPYWMAPEVV+CET +D PYD+K D+WS
Sbjct: 156 TIQRRDSFIGTPYWMAPEVVMCETSKDRPYDYKADVWS 193


>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III
           myosin-like Protein Serine/Threonine Kinases.
           Serine/threonine kinases (STKs), Class III myosin-like
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           class III myosin-like subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Class III myosins are motor
           proteins with an N-terminal kinase catalytic domain and
           a C-terminal actin-binding motor domain. Class III
           myosins are present in the photoreceptors of
           invertebrates and vertebrates and in the auditory hair
           cells of mammals. The kinase domain of myosin III can
           phosphorylate several cytoskeletal proteins,
           conventional myosin regulatory light chains, and can
           autophosphorylate the C-terminal motor domain. Myosin
           III may play an important role in maintaining the
           structural integrity of photoreceptor cell microvilli.
           It may also function as a cargo carrier during
           light-dependent translocation, in photoreceptor cells,
           of proteins such as transducin and arrestin. The
           Drosophila class III myosin, called NinaC (Neither
           inactivation nor afterpotential protein C), is critical
           in normal adaptation and termination of photoresponse.
           Vertebrates contain two isoforms of class III myosin,
           IIIA and IIIB. This subfamily also includes mammalian
           NIK-like embryo-specific kinase (NESK), Traf2- and
           Nck-interacting kinase (TNIK), mitogen-activated protein
           kinase (MAPK) kinase kinase kinase 4 (MAPKKKK4 or
           MAP4K4) and MAPKKKK6 (or MAP4K6). MAP4Ks are involved in
           some MAPK signaling pathways by activating a MAPK kinase
           kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is
           activated either by a small GTP-binding protein or by an
           adaptor protein, which transmits the signal either
           directly to a MAP3K to start the triple kinase core
           cascade or indirectly through a mediator kinase, a
           MAP4K. MAPK signaling cascades are important in
           mediating cellular responses to extracellular signals.
          Length = 275

 Score = 68.8 bits (169), Expect = 8e-15
 Identities = 23/38 (60%), Positives = 28/38 (73%)

Query: 2   TLQKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           TL + NTFIGTPYWMAPEV+ C+   D  YD + D+WS
Sbjct: 166 TLGRRNTFIGTPYWMAPEVIACDEQPDASYDARSDVWS 203


>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated
           protein kinase kinase kinase kinase-like Protein
           Serine/Threonine Kinases.  Serine/threonine kinases
           (STKs), mitogen-activated protein kinase (MAPK) kinase
           kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAP4K3-like
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily includes MAP4K3, MAP4K1,
           MAP4K2, MAP4K5, and related proteins. Vertebrate members
           contain an N-terminal catalytic domain and a C-terminal
           citron homology (CNH) regulatory domain, similar to
           MAP4K4/6. MAP4Ks are involved in some MAPK signaling
           pathways that are important in mediating cellular
           responses to extracellular signals by activating a MAPK
           kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK
           cascade is activated either by a small GTP-binding
           protein or by an adaptor protein, which transmits the
           signal either directly to a MAP3K to start the triple
           kinase core cascade or indirectly through a mediator
           kinase, a MAP4K. MAP4K1, also called haematopoietic
           progenitor kinase 1 (HPK1), is a hematopoietic-specific
           STK involved in many cellular signaling cascades
           including MAPK, antigen receptor, apoptosis, growth
           factor, and cytokine signaling. It participates in the
           regulation of T cell receptor signaling and T
           cell-mediated immune responses. MAP4K2 was referred to
           as germinal center (GC) kinase because of its preferred
           location in GC B cells. MAP4K3 plays a role in the
           nutrient-responsive pathway of mTOR (mammalian target of
           rapamycin) signaling. It is required in the activation
           of S6 kinase by amino acids and for the phosphorylation
           of the mTOR-regulated inhibitor of eukaryotic initiation
           factor 4E. MAP4K5, also called germinal center
           kinase-related enzyme (GCKR), has been shown to activate
           the MAPK c-Jun N-terminal kinase (JNK).
          Length = 262

 Score = 65.4 bits (160), Expect = 1e-13
 Identities = 22/38 (57%), Positives = 25/38 (65%), Gaps = 2/38 (5%)

Query: 2   TLQKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           T+ K  +FIGTPYWMAPEV   E  R   YD K DIW+
Sbjct: 154 TIAKRKSFIGTPYWMAPEVAAVE--RKGGYDGKCDIWA 189


>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine
           Kinase, p21-activated kinase.  Serine/threonine kinases
           (STKs), p21-activated kinase (PAK) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PAK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PAKs are Rho
           family GTPase-regulated kinases that serve as important
           mediators in the function of Cdc42 (cell division cycle
           42) and Rac. PAKs are implicated in the regulation of
           many cellular processes including growth factor
           receptor-mediated proliferation, cell polarity, cell
           motility, cell death and survival, and actin
           cytoskeleton organization. PAK deregulation is
           associated with tumor development. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           Group I PAKs contain a PBD (p21-binding domain)
           overlapping with an AID (autoinhibitory domain), a
           C-terminal catalytic domain, SH3 binding sites and a
           non-classical SH3 binding site for PIX (PAK-interacting
           exchange factor). Group II PAKs contain a PBD and a
           catalytic domain, but lack other motifs found in group I
           PAKs. Since group II PAKs do not contain an obvious AID,
           they may be regulated differently from group I PAKs.
           Group I PAKs interact with the SH3 containing proteins
           Nck, Grb2 and PIX; no such binding has been demonstrated
           for group II PAKs.
          Length = 286

 Score = 62.2 bits (152), Expect = 2e-12
 Identities = 19/36 (52%), Positives = 23/36 (63%), Gaps = 5/36 (13%)

Query: 4   QKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
            K N+ +GTPYWMAPEV+     +   Y  KVDIWS
Sbjct: 171 SKRNSVVGTPYWMAPEVI-----KRKDYGPKVDIWS 201


>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like
           protein kinase 3-like Protein Serine/Threonine Kinases. 
           Serine/threonine kinases (STKs), mammalian Ste20-like
           protein kinase 3 (MST3)-like subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MST3-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of MST3, MST4,
           STK25, Schizosaccharomyces pombe Nak1 and Sid1,
           Saccharomyces cerevisiae sporulation-specific protein 1
           (SPS1), and related proteins. Nak1 is required by
           fission yeast for polarizing the tips of actin
           cytoskeleton and is involved in cell growth, cell
           separation, cell morphology and cell-cycle progression.
           Sid1 is a component in the septation initiation network
           (SIN) signaling pathway, and plays a role in
           cytokinesis. SPS1 plays a role in regulating proteins
           required for spore wall formation. MST4 plays a role in
           mitogen-activated protein kinase (MAPK) signaling during
           cytoskeletal rearrangement, morphogenesis, and
           apoptosis. MST3 phosphorylates the STK NDR and may play
           a role in cell cycle progression and cell morphology.
           STK25 may play a role in the regulation of cell
           migration and polarization.
          Length = 274

 Score = 61.5 bits (150), Expect = 3e-12
 Identities = 21/39 (53%), Positives = 25/39 (64%), Gaps = 5/39 (12%)

Query: 1   MTLQKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
            T+ K NTF+GTP+WMAPEV+         YD K DIWS
Sbjct: 150 STMSKRNTFVGTPFWMAPEVIKQSG-----YDEKADIWS 183


>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein
           Serine/Threonine Kinases, Mitogen-Activated Protein
           Kinase Kinase Kinase Kinase 4 and 6.  Serine/threonine
           kinases (STKs), mitogen-activated protein kinase (MAPK)
           kinase kinase kinase 4 (MAPKKKK4 or MAP4K4) and MAPKKKK6
           (or MAP4K6) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The MAP4K4/MAP4K6 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Members of this subfamily
           contain an N-terminal catalytic domain and a C-terminal
           citron homology (CNH) regulatory domain. MAP4Ks (or
           MAPKKKKs) are involved in MAPK signaling pathways that
           are important in mediating cellular responses to
           extracellular signals by activating a MAPK kinase kinase
           (MAPKKK or MAP3K or MKKK). Each MAPK cascade is
           activated either by a small GTP-binding protein or by an
           adaptor protein, which transmits the signal either
           directly to a MAP3K to start the triple kinase core
           cascade or indirectly through a mediator kinase, a
           MAP4K. MAP4K4 is also called Nck Interacting kinase
           (NIK). It facilitates the activation of the MAPKs,
           extracellular signal-regulated kinase (ERK) 1, ERK2, and
           c-Jun N-terminal kinase (JNK), by phosphorylating and
           activating MEKK1. MAP4K4 plays a role in tumor necrosis
           factor (TNF) alpha-induced insulin resistance. MAP4K4
           silencing in skeletal muscle cells from type II diabetic
           patients restores insulin-mediated glucose uptake.
           MAP4K4, through JNK, also plays a broad role in cell
           motility, which impacts inflammation, homeostasis, as
           well as the invasion and spread of cancer. MAP4K4 is
           found to be highly expressed in most tumor cell lines
           relative to normal tissue. MAP4K6 (also called MINK for
           Misshapen/NIKs-related kinase) is activated after Ras
           induction and mediates activation of p38 MAPK. MAP4K6
           plays a role in cell cycle arrest, cytoskeleton
           organization, cell adhesion, and cell motility.
          Length = 282

 Score = 61.2 bits (148), Expect = 5e-12
 Identities = 23/38 (60%), Positives = 29/38 (76%)

Query: 2   TLQKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           T+ + NTFIGTPYWMAPEV+ C+   D  YD++ DIWS
Sbjct: 174 TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDIWS 211


>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases.
           Protein Kinases (PKs), STE family, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The STE family is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases (STKs), protein
           tyrosine kinases (PTKs), RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase (PI3K). This family is composed of STKs, and
           some dual-specificity PKs that phosphorylate both
           threonine and tyrosine residues of target proteins. Most
           members are kinases involved in mitogen-activated
           protein kinase (MAPK) signaling cascades, acting as MAPK
           kinases (MAPKKs), MAPK kinase kinases (MAPKKKs), or MAPK
           kinase kinase kinases (MAP4Ks). The MAPK signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising of the MAPK, which is
           phosphorylated and activated by a MAPKK, which itself is
           phosphorylated and activated by a MAPKKK. Each MAPK
           cascade is activated either by a small GTP-binding
           protein or by an adaptor protein, which transmits the
           signal either directly to a MAPKKK to start the triple
           kinase core cascade or indirectly through a mediator
           kinase, a MAP4K. Other STE family members include
           p21-activated kinases (PAKs) and class III myosins,
           among others. PAKs are Rho family GTPase-regulated
           kinases that serve as important mediators in the
           function of Cdc42 (cell division cycle 42) and Rac.
           Class III myosins are motor proteins containing an
           N-terminal kinase catalytic domain and a C-terminal
           actin-binding domain, which can phosphorylate several
           cytoskeletal proteins, conventional myosin regulatory
           light chains, as well as autophosphorylate the
           C-terminal motor domain. They play an important role in
           maintaining the structural integrity of photoreceptor
           cell microvilli.
          Length = 253

 Score = 60.3 bits (147), Expect = 1e-11
 Identities = 20/36 (55%), Positives = 25/36 (69%), Gaps = 5/36 (13%)

Query: 4   QKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           +  NT +GTPYWMAPEV+  +     PYD+K DIWS
Sbjct: 152 KARNTMVGTPYWMAPEVINGK-----PYDYKADIWS 182


>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein
           Serine/Threonine Kinase, Traf2- and Nck-interacting
           kinase.  Serine/threonine kinases (STKs), Traf2- and
           Nck-interacting kinase (TNIK) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The TNIK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Members of this
           subfamily contain an N-terminal catalytic domain and a
           C-terminal citron homology (CNH) regulatory domain,
           similar to mitogen-activated protein kinase (MAPK),
           kinase kinase kinase 4 (MAP4K4), and MAP4K6. MAP4Ks
           participate in some MAPK signaling pathways by
           activating a MAPK kinase kinase (MAPKKK or MAP3K or
           MKKK). TNIK is an effector of Rap2, a small GTP-binding
           protein from the Ras family. TNIK specifically activates
           the c-Jun N-terminal kinase (JNK) pathway and plays a
           role in regulating the actin cytoskeleton.
          Length = 272

 Score = 60.5 bits (146), Expect = 1e-11
 Identities = 24/38 (63%), Positives = 29/38 (76%)

Query: 2   TLQKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           T+ + NTFIGTPYWMAPEV+ C+   D  YDFK D+WS
Sbjct: 164 TVGRRNTFIGTPYWMAPEVIACDENPDATYDFKSDLWS 201


>gnl|CDD|214598 smart00282, LamG, Laminin G domain. 
          Length = 132

 Score = 57.7 bits (140), Expect = 1e-11
 Identities = 28/96 (29%), Positives = 42/96 (43%), Gaps = 8/96 (8%)

Query: 51  RDKAKFKELDRPVRLEASTSYEIISDGKYHTVEMLAIGKTFTLRVDHGNSRSITNEGSTE 110
           R   ++     P RL +      ++DG++H V +   G++ TL VD GN  S  + G   
Sbjct: 35  RLVLRYDLGSGPARLTSDP--TPLNDGQWHRVAVERNGRSVTLSVDGGNRVSGESPGGLT 92

Query: 111 HLRLHSPMYVGGVPLDPVGMEAFTHWHLRNLTSFNG 146
            L L  P+Y+GG+P      E      L     F G
Sbjct: 93  ILNLDGPLYLGGLP------EDLKLPPLPVTPGFRG 122


>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein
           Serine/Threonine Kinases, Mammalian Ste20-like protein
           kinase 1 and 2.  Serine/threonine kinases (STKs),
           mammalian Ste20-like protein kinase 1 (MST1) and MST2
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MST1/2 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of MST1, MST2, and
           related proteins including Drosophila Hippo and
           Dictyostelium discoideum Krs1 (kinase responsive to
           stress 1). MST1/2 and Hippo are involved in a conserved
           pathway that governs cell contact inhibition, organ size
           control, and tumor development. MST1 activates the
           mitogen-activated protein kinases (MAPKs) p38 and c-Jun
           N-terminal kinase (JNK) through MKK7 (a MAPK kinase) and
           MEKK1 (a MAPK kinase kinase) by acting as a MAPK kinase
           kinase kinase (MAPKKKK). Activation of JNK by MST1 leads
           to caspase activation and apoptosis. MST1 has also been
           implicated in cell proliferation and differentiation.
           Krs1 may regulate cell growth arrest and apoptosis in
           response to cellular stress.
          Length = 256

 Score = 58.4 bits (142), Expect = 4e-11
 Identities = 20/39 (51%), Positives = 25/39 (64%), Gaps = 5/39 (12%)

Query: 2   TLQKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWSY 40
           T+ K NT IGTP+WMAPEV+      +  Y+ K DIWS 
Sbjct: 152 TMAKRNTVIGTPFWMAPEVIQ-----EIGYNNKADIWSL 185


>gnl|CDD|216930 pfam02210, Laminin_G_2, Laminin G domain.  This family includes the
           Thrombospondin N-terminal-like domain, a Laminin G
           subfamily.
          Length = 124

 Score = 54.4 bits (131), Expect = 2e-10
 Identities = 25/78 (32%), Positives = 38/78 (48%), Gaps = 6/78 (7%)

Query: 69  TSYEIISDGKYHTVEMLAIGKTFTLRVDHGNSRSITNEGSTEHLRLHSPMYVGGVPLDPV 128
            S + ++DG++H V +   G++ TL VD G   S    GS+  L L+ P+Y+GG+P D  
Sbjct: 46  LSGKKLNDGQWHRVSVSRDGRSLTLSVDGGTVVSEALPGSSSILNLNGPLYLGGLPEDSG 105

Query: 129 GMEAFTHWHLRNLTSFNG 146
                    L     F G
Sbjct: 106 L------SLLPVTEGFVG 117


>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein
           Serine/Threonine Kinases, Oxidative stress response
           kinase and Ste20-related proline alanine-rich kinase.
           Serine/threonine kinases (STKs), oxidative stress
           response kinase (OSR1) and Ste20-related proline
           alanine-rich kinase (SPAK) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The OSR1 and SPAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. SPAK is also referred to as STK39 or PASK
           (proline-alanine-rich STE20-related kinase). OSR1 and
           SPAK regulate the activity of cation-chloride
           cotransporters through direct interaction and
           phosphorylation. They are also implicated in
           cytoskeletal rearrangement, cell differentiation,
           transformation and proliferation. OSR1 and SPAK contain
           a conserved C-terminal (CCT) domain, which recognizes a
           unique motif ([RK]FX[VI]) present in their activating
           kinases (WNK1/WNK4) and their substrates.
          Length = 267

 Score = 55.8 bits (135), Expect = 5e-10
 Identities = 20/40 (50%), Positives = 26/40 (65%), Gaps = 4/40 (10%)

Query: 1   MTLQKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWSY 40
            T +   TF+GTP WMAPEV+     + + YDFK DIWS+
Sbjct: 158 RTRKVRKTFVGTPCWMAPEVME----QVHGYDFKADIWSF 193


>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic
           domain.  Phosphotransferases. Serine or
           threonine-specific kinase subfamily.
          Length = 254

 Score = 55.2 bits (134), Expect = 6e-10
 Identities = 18/36 (50%), Positives = 23/36 (63%), Gaps = 5/36 (13%)

Query: 4   QKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           +K  TF+GTP +MAPEV+L +      Y   VDIWS
Sbjct: 151 EKLTTFVGTPEYMAPEVLLGK-----GYGKAVDIWS 181


>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine
           Kinase, Never In Mitosis gene A-related kinase.
           Serine/Threonine Kinases (STKs), Never In Mitosis gene A
           (NIMA)-related kinase (Nek) family, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. The Nek family is
           composed of 11 different mammalian members (Nek1-11)
           with similarity to the catalytic domain of Aspergillus
           nidulans NIMA kinase, the founding member of the Nek
           family which was identified in a screen for cell cycle
           mutants that were prevented from entering mitosis. Neks
           contain a conserved N-terminal catalytic domain and a
           more divergent C-terminal regulatory region of various
           sizes and structures. They are involved in the
           regulation of downstream processes following the
           activation of Cdc2, and many of their functions are cell
           cycle-related. They play critical roles in microtubule
           dynamics during ciliogenesis and mitosis.
          Length = 258

 Score = 55.2 bits (134), Expect = 7e-10
 Identities = 15/38 (39%), Positives = 25/38 (65%), Gaps = 5/38 (13%)

Query: 2   TLQKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           T+    T +GTPY+++PE+      ++ PY++K DIWS
Sbjct: 156 TVDLAKTVVGTPYYLSPEL-----CQNKPYNYKSDIWS 188


>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein
           Serine/Threonine Kinase, Mitogen-Activated Protein
           Kinase Kinase Kinase.  Serine/threonine kinases (STKs),
           mitogen-activated protein kinase (MAPK) kinase kinase
           (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MAPKKK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MAPKKKs (MKKKs or MAP3Ks) are also called
           MAP/ERK kinase kinases (MEKKs) in some cases. They
           phosphorylate and activate MAPK kinases (MAPKKs or MKKs
           or MAP2Ks), which in turn phosphorylate and activate
           MAPKs during signaling cascades that are important in
           mediating cellular responses to extracellular signals.
           This subfamily is composed of the Apoptosis
           Signal-regulating Kinases ASK1 (or MAPKKK5) and ASK2 (or
           MAPKKK6), MEKK1, MEKK2, MEKK3, MEKK4, as well as plant
           and fungal MAPKKKs. Also included in this subfamily are
           the cell division control proteins Schizosaccharomyces
           pombe Cdc7 and Saccharomyces cerevisiae Cdc15.
          Length = 260

 Score = 54.5 bits (132), Expect = 1e-09
 Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 5/33 (15%)

Query: 7   NTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
            +  GTPYWMAPEV+     R   Y    DIWS
Sbjct: 161 GSVRGTPYWMAPEVI-----RGEEYGRAADIWS 188


>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like
           Protein Serine/Threonine Kinases.  Serine/threonine
           kinases (STKs), Nak1 subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The Nak1 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. This subfamily is composed of
           Schizosaccharomyces pombe Nak1, Saccharomyces cerevisiae
           Kic1p (kinase that interacts with Cdc31p) and related
           proteins. Nak1 (also known as N-rich kinase 1), is
           required by fission yeast for polarizing the tips of
           actin cytoskeleton and is involved in cell growth, cell
           separation, cell morphology and cell-cycle progression.
           Kic1p is required by budding yeast for cell integrity
           and morphogenesis. Kic1p interacts with Cdc31p, the
           yeast homologue of centrin, and phosphorylates
           substrates in a Cdc31p-dependent manner.
          Length = 277

 Score = 54.0 bits (130), Expect = 2e-09
 Identities = 20/35 (57%), Positives = 23/35 (65%), Gaps = 4/35 (11%)

Query: 5   KHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           K +TF+GTPYWMAPEV+         YD K DIWS
Sbjct: 157 KRSTFVGTPYWMAPEVIT----EGKYYDTKADIWS 187


>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine
           Kinase, Thousand-and-one amino acids proteins.
           Serine/threonine kinases (STKs), thousand-and-one amino
           acids (TAO) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The TAO subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. TAO proteins possess mitogen-activated protein
           kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK)
           activity. They activate the MAPKs, p38 and c-Jun
           N-terminal kinase (JNK), by phosphorylating and
           activating the respective MAP/ERK kinases (MEKs, also
           known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. MAPK
           signaling cascades are important in mediating cellular
           responses to extracellular signals. Vertebrates contain
           three TAO subfamily members, named TAO1, TAO2, and TAO3.
          Length = 307

 Score = 53.7 bits (129), Expect = 2e-09
 Identities = 20/33 (60%), Positives = 25/33 (75%), Gaps = 2/33 (6%)

Query: 7   NTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           N+F+GTPYWMAPEV+L     +  YD KVD+WS
Sbjct: 169 NSFVGTPYWMAPEVIL--AMDEGQYDGKVDVWS 199


>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein
           Serine/Threonine Kinase, Class IIIB myosin.
           Serine/threonine kinases (STKs), class IIIB myosin
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           class III myosin subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Class III myosins are motor
           proteins containing an N-terminal kinase catalytic
           domain and a C-terminal actin-binding domain. Class III
           myosins may play an important role in maintaining the
           structural integrity of photoreceptor cell microvilli.
           They may also function as cargo carriers during
           light-dependent translocation, in photoreceptor cells,
           of proteins such as transducin and arrestin. Class IIIB
           myosin is expressed highly in retina. It is also present
           in the brain and testis. The human class IIIB myosin
           gene maps to a region that overlaps the locus for
           Bardet-Biedl syndrome, which is characterized by
           dysmorphic extremities, retinal dystrophy, obesity, male
           hypogenitalism, and renal abnormalities.
          Length = 291

 Score = 52.7 bits (126), Expect = 5e-09
 Identities = 19/35 (54%), Positives = 25/35 (71%)

Query: 5   KHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           + NT +GTP+WMAPEV+ CE   D  YD + D+WS
Sbjct: 184 RRNTSVGTPFWMAPEVIACEQQYDYSYDARCDVWS 218


>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein
           Serine/Threonine Kinase, Class IIIA myosin.
           Serine/threonine kinases (STKs), class IIIA myosin
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           class III myosin subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Class III myosins are motor
           proteins containing an N-terminal kinase catalytic
           domain and a C-terminal actin-binding domain. Class III
           myosins may play an important role in maintaining the
           structural integrity of photoreceptor cell microvilli.
           In photoreceptor cells, they may also function as cargo
           carriers during light-dependent translocation of
           proteins such as transducin and arrestin. Class IIIA
           myosin is highly expressed in retina and in inner ear
           hair cells. It is localized to the distal ends of
           actin-bundled structures. Mutations in human myosin IIIA
           are responsible for progressive nonsyndromic hearing
           loss. Human myosin IIIA possesses ATPase and kinase
           activities, and the ability to move actin filaments in a
           motility assay. It may function as a cellular
           transporter capable of moving along actin bundles in
           sensory cells.
          Length = 286

 Score = 52.3 bits (125), Expect = 8e-09
 Identities = 20/38 (52%), Positives = 27/38 (71%)

Query: 2   TLQKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           T  + NT +GTP+WMAPEV+ CE   D+ YD + D+WS
Sbjct: 177 TRLRRNTSVGTPFWMAPEVIACEQQLDSTYDARCDVWS 214


>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, STK25 or Yeast
           Sps1/Ste20-related kinase 1.  Serine/threonine kinases
           (STKs), STK25 subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The STK25 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. STK25 is also called Ste20/oxidant stress
           response kinase 1 (SOK1) or yeast Sps1/Ste20-related
           kinase 1 (YSK1). STK25 is localized in the Golgi
           apparatus through its interaction with the Golgi matrix
           protein GM130. It may play a role in the regulation of
           cell migration and polarization. STK25 binds and
           phosphorylates CCM3 (cerebral cavernous malformation 3),
           also called PCD10 (programmed cell death 10), and may
           play a role in apoptosis. Human STK25 is a candidate
           gene responsible for pseudopseudohypoparathyroidism
           (PPHP), a disease that shares features with the Albright
           hereditary osteodystrophy (AHO) phenotype.
          Length = 277

 Score = 52.0 bits (124), Expect = 1e-08
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 5/35 (14%)

Query: 5   KHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           K NTF+GTP+WMAPEV+     + + YDFK DIWS
Sbjct: 157 KRNTFVGTPFWMAPEVI-----KQSAYDFKADIWS 186


>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein
           Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1. 
           Serine/threonine kinases (STKs), plant MAP/ERK kinase
           kinase 1 (MEKK1)-like subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The plant MEKK1 subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein STKs, protein tyrosine kinases, RIO
           kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. This subfamily is
           composed of plant mitogen-activated protein kinase
           (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks)
           including Arabidopsis thaliana MEKK1 and MAPKKK3. MEKK1
           is a MAPKKK that phosphorylates and activates MAPK
           kinases (MAPKKs or MKKs or MAP2Ks), which in turn
           phosphorylate and activate MAPKs during signaling
           cascades that are important in mediating cellular
           responses to extracellular signals. Arabidopsis thaliana
           MEKK1 activates MPK4, a MAPK that regulates systemic
           acquired resistance. MEKK1 also participates in the
           regulation of temperature-sensitive and tissue-specific
           cell death.
          Length = 258

 Score = 50.9 bits (122), Expect = 3e-08
 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 4/32 (12%)

Query: 8   TFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           +F G+PYWMAPEV+     +   Y    DIWS
Sbjct: 160 SFKGSPYWMAPEVIA----QQGGYGLAADIWS 187


>gnl|CDD|215681 pfam00054, Laminin_G_1, Laminin G domain. 
          Length = 131

 Score = 48.9 bits (117), Expect = 4e-08
 Identities = 25/74 (33%), Positives = 39/74 (52%), Gaps = 6/74 (8%)

Query: 74  ISDGKYHTVEMLAIGKTFTLRVDHGNSRSITNE-GSTEHLRLHSPMYVGGVPLDPVGMEA 132
           ++DGK+H+VE+   G++ TL VD     +  +  G+T  L +  P+YVGG+P       A
Sbjct: 50  LNDGKWHSVELERNGRSGTLSVDGEARVTGESPLGATTDLDVDGPLYVGGLP-----SLA 104

Query: 133 FTHWHLRNLTSFNG 146
                L    SF+G
Sbjct: 105 VKLRRLAISPSFDG 118


>gnl|CDD|238058 cd00110, LamG, Laminin G domain; Laminin G-like domains are usually
           Ca++ mediated receptors that can have binding sites for
           steroids, beta1 integrins, heparin, sulfatides,
           fibulin-1, and alpha-dystroglycans. Proteins that
           contain LamG domains serve a variety of purposes
           including signal transduction via cell-surface steroid
           receptors, adhesion, migration and differentiation
           through mediation of cell adhesion molecules.
          Length = 151

 Score = 49.0 bits (117), Expect = 5e-08
 Identities = 22/78 (28%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 69  TSYEIISDGKYHTVEMLAIGKTFTLRVDHGNSRSITNEGSTEHLRLHSPMYVGGVPLDPV 128
           +S   ++DG++H+V +   G++ TL VD        + G +  L L  P+Y+GG+P D  
Sbjct: 72  SSKTPLNDGQWHSVSVERNGRSVTLSVDGERVVESGSPGGSALLNLDGPLYLGGLPEDLK 131

Query: 129 GMEAFTHWHLRNLTSFNG 146
                    L     F G
Sbjct: 132 S------PGLPVSPGFVG 143


>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein
           Serine/Threonine Kinase, Thousand-and-one amino acids 3.
            Serine/threonine kinases (STKs), thousand-and-one amino
           acids 3 (TAO3) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The TAO subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. TAO proteins possess mitogen-activated protein
           kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK)
           activity. MAPK signaling cascades are important in
           mediating cellular responses to extracellular signals.
           TAO3 is also known as JIK (JNK inhibitory kinase) or KFC
           (kinase from chicken). It specifically activates c-Jun
           N-terminal kinase (JNK), presumably by phosphorylating
           and activating MKK4/MKK7. In Saccharomyces cerevisiae,
           TAO3 is a component of the RAM (regulation of Ace2p
           activity and cellular morphogenesis) signaling pathway.
           TAO3 is upregulated in retinal ganglion cells after
           axotomy, and may play a role in apoptosis.
          Length = 313

 Score = 49.6 bits (118), Expect = 7e-08
 Identities = 20/33 (60%), Positives = 25/33 (75%), Gaps = 2/33 (6%)

Query: 7   NTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           N+F+GTPYWMAPEV+L     +  YD KVD+WS
Sbjct: 175 NSFVGTPYWMAPEVIL--AMDEGQYDGKVDVWS 205


>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein
           Serine/Threonine Kinase, Thousand-and-one amino acids 2.
            Serine/threonine kinases (STKs), thousand-and-one amino
           acids 2 (TAO2) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The TAO subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. TAO proteins possess mitogen-activated protein
           kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK)
           activity. MAPK signaling cascades are important in
           mediating cellular responses to extracellular signals.
           Human TAO2 is also known as prostate-derived Ste20-like
           kinase (PSK) and was identified in a screen for
           overexpressed RNAs in prostate cancer. TAO2 activates
           both p38 and c-Jun N-terminal kinase (JNK), by
           phosphorylating and activating the respective MAP/ERK
           kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6
           and MKK4/MKK7. TAO2 contains a long C-terminal extension
           with autoinhibitory segments. It is activated by the
           release of this inhibition and the phosphorylation of
           its activation loop serine. TAO2 functions as a
           regulator of actin cytoskeletal and microtubule
           organization. In addition, it regulates the transforming
           growth factor-activated kinase 1 (TAK1), which is a
           MAPKKK that plays an essential role in the signaling
           pathways of tumor necrosis factor (TNF), interleukin 1
           (IL-1), and Toll-like receptor (TLR).
          Length = 308

 Score = 49.3 bits (117), Expect = 1e-07
 Identities = 20/33 (60%), Positives = 24/33 (72%), Gaps = 2/33 (6%)

Query: 7   NTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           N F+GTPYWMAPEV+L     +  YD KVD+WS
Sbjct: 169 NXFVGTPYWMAPEVIL--AMDEGQYDGKVDVWS 199


>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain. 
          Length = 260

 Score = 48.8 bits (117), Expect = 1e-07
 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 4/37 (10%)

Query: 4   QKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWSY 40
               TF+GTP++MAPEV+L      N Y  KVD+WS 
Sbjct: 153 SSLTTFVGTPWYMAPEVLLG----GNGYGPKVDVWSL 185


>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Thousand-and-one amino acids 1.
            Serine/threonine kinases (STKs), thousand-and-one amino
           acids 1 (TAO1) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The TAO subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. TAO proteins possess mitogen-activated protein
           kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK)
           activity. MAPK signaling cascades are important in
           mediating cellular responses to extracellular signals.
           TAO1 is sometimes referred to as prostate-derived
           sterile 20-like kinase 2 (PSK2). TAO1 activates the p38
           MAPK through direct interaction with and activation of
           MEK3. TAO1 is highly expressed in the brain and may play
           a role in neuronal apoptosis. TAO1 interacts with the
           checkpoint proteins BubR1 and Mad2, and plays an
           important role in regulating mitotic progression, which
           is required for both chromosome congression and
           checkpoint-induced anaphase delay. TAO1 may play a role
           in protecting genomic stability.
          Length = 317

 Score = 48.9 bits (116), Expect = 1e-07
 Identities = 20/33 (60%), Positives = 25/33 (75%), Gaps = 2/33 (6%)

Query: 7   NTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           N+F+GTPYWMAPEV+L     +  YD KVD+WS
Sbjct: 179 NSFVGTPYWMAPEVIL--AMDEGQYDGKVDVWS 209


>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein
           Serine/Threonine Kinase, Mammalian Ste20-like protein
           kinase 4.  Serine/threonine kinases (STKs), mammalian
           Ste20-like protein kinase 4 (MST4) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MST4 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. MST4 is sometimes
           referred to as MASK (MST3 and SOK1-related kinase). It
           plays a role in mitogen-activated protein kinase (MAPK)
           signaling during cytoskeletal rearrangement,
           morphogenesis, and apoptosis. It influences cell growth
           and transformation by modulating the extracellular
           signal-regulated kinase (ERK) pathway. MST4 may also
           play a role in tumor formation and progression. It
           localizes in the Golgi apparatus by interacting with the
           Golgi matrix protein GM130 and may play a role in cell
           migration.
          Length = 277

 Score = 47.7 bits (113), Expect = 3e-07
 Identities = 20/35 (57%), Positives = 25/35 (71%), Gaps = 5/35 (14%)

Query: 5   KHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           K NTF+GTP+WMAPEV+     + + YD K DIWS
Sbjct: 157 KRNTFVGTPFWMAPEVI-----QQSAYDSKADIWS 186


>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 2.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 2 (Nek2) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek2 subfamily is
           one of a family of 11 different Neks (Nek1-11) that are
           involved in cell cycle control. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. The Nek2
           subfamily includes Aspergillus nidulans NIMA kinase, the
           founding member of the Nek family, which was identified
           in a screen for cell cycle mutants prevented from
           entering mitosis. NIMA is essential for mitotic entry
           and progression through mitosis, and its degradation is
           essential for mitotic exit. NIMA is involved in nuclear
           membrane fission. Vertebrate Nek2 is a cell
           cycle-regulated STK, localized in centrosomes and
           kinetochores, that regulates centrosome splitting at the
           G2/M phase. It also interacts with other mitotic kinases
           such as Polo-like kinase 1 and may play a role in
           spindle checkpoint. An increase in the expression of the
           human NEK2 gene is strongly associated with the
           progression of non-Hodgkin lymphoma.
          Length = 265

 Score = 47.2 bits (113), Expect = 5e-07
 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 5/33 (15%)

Query: 7   NTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
            T++GTPY+M+PE +         YD K DIWS
Sbjct: 168 KTYVGTPYYMSPEQLN-----HMSYDEKSDIWS 195


>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein
           Serine/Threonine Kinase, Group II p21-activated kinase. 
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) subfamily, Group II, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The PAK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           Group II PAKs, also called non-conventional PAKs,
           include PAK4, PAK5, and PAK6. Group II PAKs contain PBD
           (p21-binding domain) and catalytic domains, but lack
           other motifs found in group I PAKs, such as an AID
           (autoinhibitory domain) and SH3 binding sites. Since
           group II PAKs do not contain an obvious AID, they may be
           regulated differently from group I PAKs. While group I
           PAKs interact with the SH3 containing proteins Nck, Grb2
           and PIX, no such binding has been demonstrated for group
           II PAKs. Some known substrates of group II PAKs are also
           substrates of group I PAKs such as Raf, BAD, LIMK and
           GEFH1. Unique group II substrates include MARK/Par-1 and
           PDZ-RhoGEF. Group II PAKs play important roles in
           filopodia formation, neuron extension, cytoskeletal
           organization, and cell survival.
          Length = 285

 Score = 45.9 bits (109), Expect = 1e-06
 Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 5/35 (14%)

Query: 5   KHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           +  + +GTPYWMAPEV+        PY  +VDIWS
Sbjct: 171 RRKSLVGTPYWMAPEVISRL-----PYGTEVDIWS 200


>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein
           Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2,
            and similar domains.  Serine/Threonine Kinases (STKs),
           Chlamydomonas reinhardtii Never In Mitosis gene A
           (NIMA)-related kinase 1 (CNK2)-like subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Chlamydomonas
           reinhardtii CNK2-like subfamily belongs to the
           (NIMA)-related kinase (Nek) family. The Nek family
           includes seven different Chlamydomonas Neks (CNKs 1-6
           and Fa2). This subfamily includes CNK1, and -2.  The Nek
           family is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase.  Chlamydomonas reinhardtii CNK2 has both
           cilliary and cell cycle functions. It influences
           flagellar length through promoting flagellar
           disassembly, and it regulates cell size, through
           influencing the size threshold at which cells commit to
           mitosis.
          Length = 256

 Score = 45.9 bits (109), Expect = 1e-06
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 5/33 (15%)

Query: 7   NTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
            T IGTP++MAPEV     ++  PY +K DIWS
Sbjct: 159 KTQIGTPHYMAPEV-----WKGRPYSYKSDIWS 186


>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein
           Serine/Threonine Kinase, Mammalian Ste20-like protein
           kinase 3.  Serine/threonine kinases (STKs), mammalian
           Ste20-like protein kinase 3 (MST3) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MST3 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. MST3
           phosphorylates the STK NDR and may play a role in cell
           cycle progression and cell morphology. It may also
           regulate paxillin and consequently, cell migration. MST3
           is present in human placenta, where it plays an
           essential role in the oxidative stress-induced apoptosis
           of trophoblasts in normal spontaneous delivery.
           Dysregulation of trophoblast apoptosis may result in
           pregnancy complications such as preeclampsia and
           intrauterine growth retardation.
          Length = 277

 Score = 45.8 bits (108), Expect = 2e-06
 Identities = 20/35 (57%), Positives = 25/35 (71%), Gaps = 5/35 (14%)

Query: 5   KHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           K NTF+GTP+WMAPEV+     + + YD K DIWS
Sbjct: 157 KRNTFVGTPFWMAPEVI-----KQSAYDSKADIWS 186


>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein
           Serine/Threonine Kinase, Group I p21-activated kinase.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) subfamily, Group I, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The PAK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs are
           implicated in the regulation of many cellular processes
           including growth factor receptor-mediated proliferation,
           cell polarity, cell motility, cell death and survival,
           and actin cytoskeleton organization. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           Group I PAKs, also called conventional PAKs, include
           PAK1, PAK2, and PAK3. Group I PAKs contain a PBD
           (p21-binding domain) overlapping with an AID
           (autoinhibitory domain), a C-terminal catalytic domain,
           SH3 binding sites and a non-classical SH3 binding site
           for PIX (PAK-interacting exchange factor). They interact
           with the SH3 domain containing proteins Nck, Grb2 and
           PIX. Binding of group I PAKs to activated GTPases leads
           to conformational changes that destabilize the AID,
           allowing autophosphorylation and full activation of the
           kinase domain. Known group I PAK substrates include
           MLCK, Bad, Raf, MEK1, LIMK, Merlin, Vimentin, Myc,
           Stat5a, and Aurora A, among others.
          Length = 293

 Score = 45.3 bits (107), Expect = 2e-06
 Identities = 20/35 (57%), Positives = 22/35 (62%), Gaps = 5/35 (14%)

Query: 5   KHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           K +T +GTPYWMAPEVV         Y  KVDIWS
Sbjct: 171 KRSTMVGTPYWMAPEVV-----TRKAYGPKVDIWS 200


>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase
           3-like Protein Serine/Threonine Kinases.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3
           (MEKK3)-like subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The MEKK3-like subfamily is part of a larger superfamily
           that includes the catalytic domains of other protein
           STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. This subfamily is composed of
           MEKK3, MEKK2, and related proteins, all containing an
           N-terminal PB1 domain, which mediates oligomerization,
           and a C-terminal catalytic domain. MEKK2 and MEKK3 are
           mitogen-activated protein kinase (MAPK) kinase kinases
           (MAPKKKs or MKKKs or MAP3Ks), proteins that
           phosphorylate and activate MAPK kinases (MAPKKs or MKKs
           or MAP2Ks), which in turn phosphorylate and activate
           MAPKs during signaling cascades that are important in
           mediating cellular responses to extracellular signals.
           MEKK2 and MEKK3 activate MEK5 (also called MKK5), which
           activates extracellular signal-regulated kinase 5
           (ERK5). The ERK5 cascade plays roles in promoting cell
           proliferation, differentiation, neuronal survival, and
           neuroprotection. MEKK3 plays an essential role in
           embryonic angiogenesis and early heart development.
           MEKK2 and MEKK3 can also activate the MAPKs, c-Jun
           N-terminal kinase (JNK) and p38, through their
           respective MAPKKs.
          Length = 263

 Score = 44.8 bits (106), Expect = 3e-06
 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 5/32 (15%)

Query: 8   TFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           +  GTPYWM+PEV+  E      Y  K D+WS
Sbjct: 166 SVTGTPYWMSPEVISGEG-----YGRKADVWS 192


>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein
           Serine/Threonine Kinase, Mitogen-activated protein
           kinase kinase kinase kinase 5.  Serine/threonine kinases
           (STKs), mitogen-activated protein kinase (MAPK) kinase
           kinase kinase 5 (MAPKKKK5 or MAP4K5) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAP4K5 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Members of this
           subfamily contain an N-terminal catalytic domain and a
           C-terminal citron homology (CNH) regulatory domain,
           similar to MAP4K4/6. MAP4Ks are involved in some MAPK
           signaling pathways that are important in mediating
           cellular responses to extracellular signals by
           activating a MAPK kinase kinase (MAPKKK or MAP3K or
           MKKK). Each MAPK cascade is activated either by a small
           GTP-binding protein or by an adaptor protein, which
           transmits the signal either directly to a MAP3K to start
           the triple kinase core cascade or indirectly through a
           mediator kinase, a MAP4K. MAP4K5, also called germinal
           center kinase-related enzyme (GCKR), has been shown to
           activate the MAPK c-Jun N-terminal kinase (JNK). MAP4K5
           also facilitates Wnt signaling in B cells, and may
           therefore be implicated in the control of cell fate,
           proliferation, and polarity.
          Length = 267

 Score = 44.6 bits (105), Expect = 3e-06
 Identities = 19/38 (50%), Positives = 25/38 (65%), Gaps = 2/38 (5%)

Query: 2   TLQKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           T+ K  +FIGTPYWMAPEV   E  ++  Y+   DIW+
Sbjct: 159 TIAKRKSFIGTPYWMAPEVAAVE--KNGGYNQLCDIWA 194


>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases.  Protein Kinases
           (PKs), catalytic (c) domain. PKs catalyze the transfer
           of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The PK family is part of a larger
           superfamily that includes the catalytic domains of RIO
           kinases, aminoglycoside phosphotransferase, choline
           kinase, phosphoinositide 3-kinase (PI3K), and
           actin-fragmin kinase. PKs make up a large family of
           serine/threonine kinases, protein tyrosine kinases
           (PTKs), and dual-specificity PKs that phosphorylate both
           serine/threonine and tyrosine residues of target
           proteins. Majority of protein phosphorylation, about
           95%, occurs on serine residues while only 1% occurs on
           tyrosine residues. Protein phosphorylation is a
           mechanism by which a wide variety of cellular proteins,
           such as enzymes and membrane channels, are reversibly
           regulated in response to certain stimuli. PKs often
           function as components of signal transduction pathways
           in which one kinase activates a second kinase, which in
           turn, may act on other kinases; this sequential action
           transmits a signal from the cell surface to target
           proteins, which results in cellular responses. The PK
           family is one of the largest known protein families with
           more than 100 homologous yeast enzymes and 550 human
           proteins. A fraction of PK family members are
           pseudokinases that lack crucial residues for catalytic
           activity. The mutiplicity of kinases allows for specific
           regulation according to substrate, tissue distribution,
           and cellular localization. PKs regulate many cellular
           processes including proliferation, division,
           differentiation, motility, survival, metabolism,
           cell-cycle progression, cytoskeletal rearrangement,
           immunity, and neuronal functions. Many kinases are
           implicated in the development of various human diseases
           including different types of cancer.
          Length = 215

 Score = 44.5 bits (106), Expect = 3e-06
 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 4/36 (11%)

Query: 4   QKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
               T +GTP +MAPEV+L +      Y  K DIWS
Sbjct: 148 SLLKTIVGTPAYMAPEVLLGKG----YYSEKSDIWS 179


>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein
           Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2
           and similar domains.  Serine/Threonine Kinases (STKs),
           Chlamydomonas reinhardtii FA2-like subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Chlamydomonas
           reinhardtii FA2-like subfamily belongs to the
           (NIMA)-related kinase (Nek) family. The Nek family
           includes seven different Chlamydomonas Neks (CNKs 1-6
           and Fa2). This subfamily includes FA2 and CNK4.  The Nek
           family is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase.  Chlamydomonas reinhardtii FA2 was discovered
           in a genetic screen for deflagellation-defective
           mutants. It is essential for
           basal-body/centriole-associated microtubule severing,
           and plays a role in cell cycle progression. No cellular
           function has yet been ascribed to CNK4.
          Length = 256

 Score = 44.8 bits (106), Expect = 4e-06
 Identities = 17/33 (51%), Positives = 24/33 (72%), Gaps = 5/33 (15%)

Query: 7   NTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           NT +GTPY+++PE  LCE   D PY+ K D+W+
Sbjct: 159 NTIVGTPYYLSPE--LCE---DKPYNEKSDVWA 186


>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein
           Serine/Threonine Kinase, Mitogen-activated protein
           kinase kinase kinase kinase 3.  Serine/threonine kinases
           (STKs), mitogen-activated protein kinase (MAPK) kinase
           kinase kinase 3 (MAPKKKK3 or MAP4K3) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAP4K3 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Members of this
           subfamily contain an N-terminal catalytic domain and a
           C-terminal citron homology (CNH) regulatory domain,
           similar to MAP4K4/6. MAP4Ks are involved in some MAPK
           signaling pathways that are important in mediating
           cellular responses to extracellular signals by
           activating a MAPK kinase kinase (MAPKKK or MAP3K or
           MKKK). Each MAPK cascade is activated either by a small
           GTP-binding protein or by an adaptor protein, which
           transmits the signal either directly to a MAP3K to start
           the triple kinase core cascade or indirectly through a
           mediator kinase, a MAP4K. MAP4K3 plays a role in the
           nutrient-responsive pathway of mTOR (mammalian target of
           rapamycin) signaling. MAP4K3 is required in the
           activation of S6 kinase by amino acids and for the
           phosphorylation of the mTOR-regulated inhibitor of
           eukaryotic initiation factor 4E. mTOR regulates ribosome
           biogenesis and protein translation, and is frequently
           deregulated in cancer.
          Length = 267

 Score = 44.7 bits (105), Expect = 4e-06
 Identities = 20/38 (52%), Positives = 24/38 (63%), Gaps = 2/38 (5%)

Query: 2   TLQKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           T+ K  +FIGTPYWMAPEV   E  R   Y+   DIW+
Sbjct: 159 TIAKRKSFIGTPYWMAPEVAAVE--RKGGYNQLCDIWA 194


>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control
           protein 7-like Protein Serine/Threonine Kinases.
           Serine/threonine kinases (STKs),  (Cdc7)-like subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Cdc7-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this subfamily include
           Schizosaccharomyces pombe Cdc7, Saccharomyces cerevisiae
           Cdc15, Arabidopsis thaliana mitogen-activated protein
           kinase (MAPK) kinase kinase (MAPKKK) epsilon, and
           related proteins. MAPKKKs phosphorylate and activate
           MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn
           phosphorylate and activate MAPKs during signaling
           cascades that are important in mediating cellular
           responses to extracellular signals. Fission yeast Cdc7
           is essential for cell division by playing a key role in
           the initiation of septum formation and cytokinesis.
           Budding yeast Cdc15 functions to coordinate mitotic exit
           with cytokinesis. Arabidopsis MAPKKK epsilon is required
           for pollen development in the plasma membrane.
          Length = 254

 Score = 44.2 bits (105), Expect = 5e-06
 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 5/33 (15%)

Query: 7   NTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
            + +GTPYWMAPEV+       +      DIWS
Sbjct: 157 ASVVGTPYWMAPEVI-----EMSGASTASDIWS 184


>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 6.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 6, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK6 belongs to group II. Group II PAKs contain a PBD
           (p21-binding domain) and a C-terminal catalytic domain,
           but do not harbor an AID (autoinhibitory domain) or SH3
           binding sites. PAK6 may play a role in stress responses
           through its activation by the mitogen-activated protein
           kinase (MAPK) p38 and MAPK kinase 6 (MKK6) pathway. PAK6
           is highly expressed in the brain. It is not required for
           viability, but together with PAK5, it is required for
           normal levels of locomotion and activity, and for
           learning and memory. Increased expression of PAK6 is
           found in primary and metastatic prostate cancer. PAK6
           may play a role in the regulation of motility.
          Length = 297

 Score = 43.9 bits (103), Expect = 7e-06
 Identities = 18/35 (51%), Positives = 22/35 (62%), Gaps = 5/35 (14%)

Query: 5   KHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           K  + +GTPYWMAPEV+        PY  +VDIWS
Sbjct: 173 KRKSLVGTPYWMAPEVI-----SRTPYGTEVDIWS 202


>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein
           Serine/Threonine Kinases, Never In Mitosis gene
           A-related kinase 6 and 7.  Serine/Threonine Kinases
           (STKs), Never In Mitosis gene A (NIMA)-related kinase 6
           (Nek6) and Nek7 subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The Nek6/7 subfamily is part of a family of 11 different
           Neks (Nek1-11) that are involved in cell cycle control.
           The Nek family is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Nek6 and Nek7 are the shortest Neks,
           consisting only of the catalytic domain and a very short
           N-terminal extension. They show distinct expression
           patterns and both appear to be downstream substrates of
           Nek9. They are required for mitotic spindle formation
           and cytokinesis. They may also be regulators of the p70
           ribosomal S6 kinase.
          Length = 267

 Score = 43.2 bits (102), Expect = 1e-05
 Identities = 15/30 (50%), Positives = 21/30 (70%), Gaps = 5/30 (16%)

Query: 10  IGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           +GTPY+M+PE +      +N Y+FK DIWS
Sbjct: 167 VGTPYYMSPERI-----HENGYNFKSDIWS 191


>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 2.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 2, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK2 belongs to group I. Group I PAKs contain a PBD
           (p21-binding domain) overlapping with an AID
           (autoinhibitory domain), a C-terminal catalytic domain,
           SH3 binding sites and a non-classical SH3 binding site
           for PIX (PAK-interacting exchange factor). PAK2 plays a
           role in pro-apoptotic signaling. It is cleaved and
           activated by caspases leading to morphological changes
           during apoptosis. PAK2 is also activated in response to
           a variety of stresses including DNA damage,
           hyperosmolarity, serum starvation, and contact
           inhibition, and may play a role in coordinating the
           stress response. PAK2 also contributes to cancer cell
           invasion through a mechanism distinct from that of PAK1.
          Length = 296

 Score = 42.8 bits (100), Expect = 2e-05
 Identities = 20/35 (57%), Positives = 22/35 (62%), Gaps = 5/35 (14%)

Query: 5   KHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           K +T +GTPYWMAPEVV         Y  KVDIWS
Sbjct: 171 KRSTMVGTPYWMAPEVV-----TRKAYGPKVDIWS 200


>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 3.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 3, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK3 belongs to group I. Group I PAKs contain a PBD
           (p21-binding domain) overlapping with an AID
           (autoinhibitory domain), a C-terminal catalytic domain,
           SH3 binding sites and a non-classical SH3 binding site
           for PIX (PAK-interacting exchange factor). PAK3 is
           highly expressed in the brain. It is implicated in
           neuronal plasticity, synapse formation, dendritic spine
           morphogenesis, cell cycle progression, neuronal
           migration, and apoptosis. Inactivating mutations in the
           PAK3 gene cause X-linked non-syndromic mental
           retardation, the severity of which depends on the site
           of the mutation.
          Length = 297

 Score = 42.8 bits (100), Expect = 2e-05
 Identities = 20/35 (57%), Positives = 22/35 (62%), Gaps = 5/35 (14%)

Query: 5   KHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           K +T +GTPYWMAPEVV         Y  KVDIWS
Sbjct: 171 KRSTMVGTPYWMAPEVV-----TRKAYGPKVDIWS 200


>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein
           Serine/Threonine Kinase, cGMP-dependent protein kinase. 
           Serine/Threonine Kinases (STKs), cGMP-dependent protein
           kinase (cGK or PKG) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The cGK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Mammals have two cGK isoforms
           from different genes, cGKI and cGKII. cGKI exists as two
           splice variants, cGKI-alpha and cGKI-beta. cGK consists
           of an N-terminal regulatory domain containing a
           dimerization and an autoinhibitory pseudosubstrate
           region, two cGMP-binding domains, and a C-terminal
           catalytic domain. Binding of cGMP to both binding sites
           releases the inhibition of the catalytic center by the
           pseudosubstrate region, allowing autophosphorylation and
           activation of the kinase. cGKI is a  soluble protein
           expressed in all smooth muscles, platelets, cerebellum,
           and kidney. It is also expressed at lower concentrations
           in other tissues. cGKII is a membrane-bound protein that
           is most abundantly expressed in the intestine. It is
           also present in the brain nuclei, adrenal cortex,
           kidney, lung, and prostate. cGKI is involved in the
           regulation of smooth muscle tone, smooth cell
           proliferation, and platelet activation. cGKII plays a
           role in the regulation of secretion, such as renin
           secretion by the kidney and aldosterone secretion by the
           adrenal. It also regulates bone growth and the circadian
           rhythm.
          Length = 262

 Score = 42.2 bits (100), Expect = 2e-05
 Identities = 18/36 (50%), Positives = 23/36 (63%), Gaps = 5/36 (13%)

Query: 4   QKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           QK  TF GTP ++APE++L     +  YDF VD WS
Sbjct: 147 QKTWTFCGTPEYVAPEIIL-----NKGYDFSVDYWS 177


>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 4.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 4 (Nek4) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek4 subfamily is
           one of a family of 11 different Neks (Nek1-11). The Nek
           family is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Neks are involved in the regulation of
           downstream processes following the activation of Cdc2,
           and many of their functions are cell cycle-related. They
           play critical roles in microtubule dynamics during
           ciliogenesis and mitosis. Nek4 is highly abundant in the
           testis. Its specific function is unknown.
          Length = 257

 Score = 41.5 bits (97), Expect = 4e-05
 Identities = 15/33 (45%), Positives = 24/33 (72%), Gaps = 5/33 (15%)

Query: 7   NTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           +T IGTPY+M+PE+     F + PY++K D+W+
Sbjct: 160 STLIGTPYYMSPEL-----FSNKPYNYKSDVWA 187


>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 5.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 5, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK5 belongs to group II. Group II PAKs contain a PBD
           (p21-binding domain) and a C-terminal catalytic domain,
           but do not harbor an AID (autoinhibitory domain) or SH3
           binding sites. PAK5 is mainly expressed in the brain. It
           is not required for viability, but together with PAK6,
           it is required for normal levels of locomotion and
           activity, and for learning and memory. PAK5 cooperates
           with Inca (induced in neural crest by AP2) in the
           regulation of cell adhesion and cytoskeletal
           organization in the embryo and in neural crest cells
           during craniofacial development. PAK5 may also play a
           role in controlling the signaling of Raf-1, an effector
           of Ras, at the mitochondria.
          Length = 292

 Score = 41.6 bits (97), Expect = 5e-05
 Identities = 18/35 (51%), Positives = 22/35 (62%), Gaps = 5/35 (14%)

Query: 5   KHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           K  + +GTPYWMAPEV+        PY  +VDIWS
Sbjct: 174 KRKSLVGTPYWMAPEVI-----SRLPYGTEVDIWS 203


>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 1.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 1, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK1 belongs to group I. Group I PAKs contain a PBD
           (p21-binding domain) overlapping with an AID
           (autoinhibitory domain), a C-terminal catalytic domain,
           SH3 binding sites and a non-classical SH3 binding site
           for PIX (PAK-interacting exchange factor). PAK1 is
           important in the regulation of many cellular processes
           including cytoskeletal dynamics, cell motility, growth,
           and proliferation. Although PAK1 has been regarded
           mainly as a cytosolic protein, recent reports indicate
           that PAK1 also exists in significant amounts in the
           nucleus, where it is involved in transcription
           modulation and in cell cycle regulatory events. PAK1 is
           also involved in transformation and tumorigenesis. Its
           overexpression, hyperactivation and increased nuclear
           accumulation is correlated to breast cancer invasiveness
           and progression. Nuclear accumulation is also linked to
           tamoxifen resistance in breast cancer cells.
          Length = 296

 Score = 40.9 bits (95), Expect = 9e-05
 Identities = 20/35 (57%), Positives = 22/35 (62%), Gaps = 5/35 (14%)

Query: 5   KHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           K +T +GTPYWMAPEVV         Y  KVDIWS
Sbjct: 172 KRSTMVGTPYWMAPEVV-----TRKAYGPKVDIWS 201


>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 4.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 4, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK4 belongs to group II. Group II PAKs contain a PBD
           (p21-binding domain) and a C-terminal catalytic domain,
           but do not harbor an AID (autoinhibitory domain) or SH3
           binding sites. PAK4 regulates cell morphology and
           cytoskeletal organization. It is essential for embryonic
           viability and proper neural development. Mice lacking
           PAK4 die due to defects in the fetal heart. In addition,
           their spinal cord motor neurons showed failure to
           differentiate and migrate. PAK4 also plays a role in
           cell survival and tumorigenesis. It is overexpressed in
           many primary tumors including colon, esophageal, and
           mammary tumors. PAK4 has also been implicated in viral
           and bacterial infection pathways.
          Length = 292

 Score = 40.4 bits (94), Expect = 1e-04
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 5/38 (13%)

Query: 3   LQKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWSY 40
           + +  + +GTPYWMAPE++        PY  +VDIWS 
Sbjct: 170 VPRRKSLVGTPYWMAPELI-----SRLPYGPEVDIWSL 202


>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein
           Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase
           4.  Serine/threonine kinases (STKs), yeast
           Sps1/Ste20-related kinase 4 (YSK4) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The YSK4 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. YSK4 is a
           putative MAPKKK, whose mammalian gene has been isolated.
           MAPKKKs (MKKKs or MAP3Ks) phosphorylate and activate
           MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn
           phosphorylate and activate MAPKs during signaling
           cascades that are important in mediating cellular
           responses to extracellular signals.
          Length = 265

 Score = 39.9 bits (93), Expect = 2e-04
 Identities = 16/29 (55%), Positives = 19/29 (65%), Gaps = 5/29 (17%)

Query: 11  GTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           GTPYWMAPEV+      ++ Y  K DIWS
Sbjct: 170 GTPYWMAPEVI-----NESGYGRKSDIWS 193


>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 1.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 1 (Nek1) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek1 subfamily is
           one of a family of 11 different Neks (Nek1-11) that are
           involved in cell cycle control. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Nek1 is
           associated with centrosomes throughout the cell cycle.
           It is involved in the formation of primary cilium and in
           the maintenance of centrosomes. It cycles through the
           nucleus and may be capable of relaying signals between
           the cilium and the nucleus. Nek1 is implicated in the
           development of polycystic kidney disease, which is
           characterized by benign polycystic tumors formed by
           abnormal overgrowth of renal epithelial cells. It
           appears also to be involved in DNA damage response, and
           may be important for both correct DNA damage checkpoint
           activation and DNA repair.
          Length = 256

 Score = 39.0 bits (91), Expect = 3e-04
 Identities = 17/38 (44%), Positives = 26/38 (68%), Gaps = 5/38 (13%)

Query: 2   TLQKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           T++   T IGTPY+++PE+  CE   + PY+ K DIW+
Sbjct: 154 TVELARTCIGTPYYLSPEI--CE---NRPYNNKSDIWA 186


>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated
           serine/threonine kinase-like proteins.  Serine/Threonine
           Kinases (STKs), Microtubule-associated serine/threonine
           (MAST) kinase subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The MAST kinase subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. The MAST kinase subfamily
           includes MAST kinases, MAST-like (MASTL) kinases, and
           fungal kinases with similarity to Saccharomyces
           cerevisiae Rim15 and Schizosaccharomyces pombe cek1.
           MAST kinases contain an N-terminal domain of unknown
           function, a central catalytic domain, and a C-terminal
           PDZ domain that mediates protein-protein interactions.
           MASTL kinases carry only a catalytic domain which
           contains a long insert relative to other kinases. The
           fungal kinases in this subfamily harbor other domains in
           addition to a central catalytic domain, which also
           contains an insert relative to MAST kinases like MASTL.
           Rim15 contains a C-terminal signal receiver (REC) domain
           while cek1 contains an N-terminal PAS domain. MAST
           kinases are cytoskeletal associated kinases of unknown
           function that are also expressed at neuromuscular
           junctions and postsynaptic densities. The fungal
           proteins Rim15 and cek1 are involved in the regulation
           of meiosis and mitosis, respectively.
          Length = 265

 Score = 38.8 bits (91), Expect = 4e-04
 Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 5/33 (15%)

Query: 7   NTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
              +GTP ++APEV+L +      +   VD WS
Sbjct: 159 KRIVGTPDYIAPEVILGQ-----GHSKTVDWWS 186


>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 6.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 6 (Nek6) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek6 subfamily is
           one of a family of 11 different Neks (Nek1-11) that are
           involved in cell cycle control. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Nek6 is required
           for the transition from metaphase to anaphase. It also
           plays important roles in mitotic spindle formation and
           cytokinesis.  Activated by Nek9 during mitosis, Nek6
           phosphorylates Eg5, a kinesin that is important for
           spindle bipolarity. Nek6 localizes to spindle
           microtubules during metaphase and anaphase, and to the
           midbody during cytokinesis.
          Length = 267

 Score = 38.5 bits (89), Expect = 5e-04
 Identities = 15/33 (45%), Positives = 23/33 (69%), Gaps = 5/33 (15%)

Query: 7   NTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           ++ +GTPY+M+PE +      +N Y+FK DIWS
Sbjct: 164 HSLVGTPYYMSPERI-----HENGYNFKSDIWS 191


>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein
           Serine/Threonine Kinases.  Serine/Threonine Kinases
           (STKs), AGC (Protein Kinases A, G and C) family,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The AGC family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and Phosphoinositide 3-Kinase (PI3K). Members of
           this family include cAMP-dependent Protein Kinase (PKA),
           cGMP-dependent Protein Kinase (PKG), Protein Kinase C
           (PKC), Protein Kinase B (PKB), G protein-coupled
           Receptor Kinase (GRK), Serum- and Glucocorticoid-induced
           Kinase (SGK), and 70 kDa ribosomal Protein S6 Kinase
           (p70S6K or S6K), among others. AGC kinases share an
           activation mechanism based on the phosphorylation of up
           to three sites: the activation loop (A-loop), the
           hydrophobic motif (HM) and the turn motif.
           Phosphorylation at the A-loop is required of most AGC
           kinases, which results in a disorder-to-order transition
           of the A-loop. The ordered conformation results in the
           access of substrates and ATP to the active site. A
           subset of AGC kinases with C-terminal extensions
           containing the HM also requires phosphorylation at this
           site. Phosphorylation at the HM allows the C-terminal
           extension to form an ordered structure that packs into
           the hydrophobic pocket of the catalytic domain, which
           then reconfigures the kinase into an active bi-lobed
           state. In addition, growth factor-activated AGC kinases
           such as PKB, p70S6K, RSK, MSK, PKC, and SGK, require
           phosphorylation at the turn motif (also called tail or
           zipper site), located N-terminal to the HM at the
           C-terminal extension. AGC kinases regulate many cellular
           processes including division, growth, survival,
           metabolism, motility, and differentiation. Many are
           implicated in the development of various human diseases.
          Length = 250

 Score = 38.3 bits (90), Expect = 5e-04
 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 5/34 (14%)

Query: 7   NTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWSY 40
           NTF GTP ++APEV+L        Y   VD WS 
Sbjct: 151 NTFCGTPEYLAPEVLL-----GKGYGKAVDWWSL 179


>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant
           dual-specificity MAP kinase kinases and similar
           proteins.  Protein kinases (PKs), MAP kinase kinase
           (MAPKK) subfamily, Plant MAPKKs and similar proteins,
           catalytic (c) domain. PKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine or
           tyrosine residues on protein substrates. The MAPKK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein serine/threonine
           kinases, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. The mitogen-activated protein
           (MAP) kinase signaling pathways are important mediators
           of cellular responses to extracellular signals. The
           pathways involve a triple kinase core cascade comprising
           of the MAP kinase (MAPK), which is phosphorylated and
           activated by a MAPK kinase (MAPKK or MKK), which itself
           is phosphorylated and activated by a MAPK kinase kinase
           (MAPKKK or MKKK). Members of this group include MAPKKs
           from plants, kinetoplastids, alveolates, and mycetozoa.
           The MAPKK, LmxPK4, from Leishmania mexicana, is
           important in differentiation and virulence.
           Dictyostelium discoideum MEK1 is required for proper
           chemotaxis. MEK1 null mutants display severe defects in
           cell polarization and directional movement. Plants
           contain multiple MAPKKs like other eukaryotes. The
           Arabidopsis genome encodes for 10 MAPKKs while poplar
           and rice contain 13 MAPKKs each. The functions of these
           proteins have not been fully elucidated. There is
           evidence to suggest that MAPK cascades are involved in
           plant stress responses. In Arabidopsis, MKK3 plays a
           role in pathogen signaling, MKK2 is involved in cold and
           salt stress signaling, MKK4/MKK5 participates in innate
           immunity, and MKK7 regulates basal and systemic acquired
           resistance.
          Length = 264

 Score = 38.3 bits (90), Expect = 6e-04
 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 5/38 (13%)

Query: 2   TLQKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           TL + NTF+GT  +M+PE +  E      Y +  DIWS
Sbjct: 153 TLDQCNTFVGTVTYMSPERIQGE-----SYSYAADIWS 185


>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 5.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 5 (Nek5) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek5 subfamily is
           one of a family of 11 different Neks (Nek1-11). The Nek
           family is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Neks are involved in the regulation of
           downstream processes following the activation of Cdc2,
           and many of their functions are cell cycle-related. They
           play critical roles in microtubule dynamics during
           ciliogenesis and mitosis. The specific function of Nek5
           is unknown.
          Length = 257

 Score = 38.0 bits (88), Expect = 7e-04
 Identities = 15/38 (39%), Positives = 26/38 (68%), Gaps = 5/38 (13%)

Query: 2   TLQKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           +++   T +GTPY+++PE+  C+   + PY+ K DIWS
Sbjct: 155 SMELAYTCVGTPYYLSPEI--CQ---NRPYNNKTDIWS 187


>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 7.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 7 (Nek7) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek7 subfamily is
           one of a family of 11 different Neks (Nek1-11) that are
           involved in cell cycle control. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Nek7 is required
           for mitotic spindle formation and cytokinesis. It is
           enriched in the centrosome and is critical for
           microtubule nucleation. Nek7 is activated by Nek9 during
           mitosis, and may regulate the p70 ribosomal S6 kinase.
          Length = 267

 Score = 37.7 bits (87), Expect = 8e-04
 Identities = 15/33 (45%), Positives = 23/33 (69%), Gaps = 5/33 (15%)

Query: 7   NTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           ++ +GTPY+M+PE +      +N Y+FK DIWS
Sbjct: 164 HSLVGTPYYMSPERI-----HENGYNFKSDIWS 191


>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and
           Dbf2p-like Protein Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), ROCK- and NDR-like
           subfamily, fungal Sid2p- and Dbf2p-like proteins,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Sid2p- and
           Dbf2p-like group is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This group contains fungal kinases including
           Schizosaccharomyces pombe Sid2p and Saccharomyces
           cerevisiae Dbf2p. Group members show similarity to NDR
           kinases in that they contain an N-terminal regulatory
           (NTR) domain and an insert within the catalytic domain
           that contains an auto-inhibitory sequence. Sid2p plays a
           crucial role in the septum initiation network (SIN) and
           in the initiation of cytokinesis. Dbf2p is important in
           regulating the mitotic exit network (MEN) and in
           cytokinesis.
          Length = 333

 Score = 37.8 bits (88), Expect = 8e-04
 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 5/38 (13%)

Query: 2   TLQKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
            +   N+ +G+P +MAPEV+     R   YDF VD WS
Sbjct: 151 IVTYANSVVGSPDYMAPEVL-----RGKGYDFTVDYWS 183


>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 9.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 9 (Nek9) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek9 subfamily is
           one of a family of 11 different Neks (Nek1-11) that are
           involved in cell cycle control. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Nek9, also called
           Nercc1, is primarily a cytoplasmic protein but can also
           localize in the nucleus. It is involved in modulating
           chromosome alignment and splitting during mitosis. It
           interacts with the gamma-tubulin ring complex and the
           Ran GTPase, and is implicated in microtubule
           organization. Nek9 associates with FACT (FAcilitates
           Chromatin Transcription) and modulates interphase
           progression. It also interacts with Nek6, and Nek7,
           during mitosis, resulting in their activation.
          Length = 256

 Score = 37.4 bits (87), Expect = 0.001
 Identities = 16/32 (50%), Positives = 23/32 (71%), Gaps = 5/32 (15%)

Query: 8   TFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           T +GTPY+M+PE  LC+  +   Y+FK DIW+
Sbjct: 160 TVVGTPYYMSPE--LCQGVK---YNFKSDIWA 186


>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 11.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 11 (Nek11)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           Nek11 subfamily is one of a family of 11 different Neks
           (Nek1-11) that are involved in cell cycle control. The
           Nek family is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Nek11 is involved, through direct
           phosphorylation, in regulating the degradation of Cdc25A
           (Cell Division Cycle 25 homolog A), which plays a role
           in cell cycle progression and in activating cyclin
           dependent kinases. Nek11 is activated by CHK1
           (CHeckpoint Kinase 1) and may be involved in the G2/M
           checkpoint. Nek11 may also play a role in the S-phase
           checkpoint as well as in DNA replication and genotoxic
           stress responses.
          Length = 260

 Score = 37.2 bits (86), Expect = 0.001
 Identities = 16/32 (50%), Positives = 20/32 (62%), Gaps = 5/32 (15%)

Query: 8   TFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           TF GTPY+M+PE +     +   YD K DIWS
Sbjct: 164 TFTGTPYYMSPEAL-----KHQGYDSKSDIWS 190


>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine
           Kinase, Protein Kinase C.  Serine/Threonine Kinases
           (STKs), Protein Kinase C (PKC) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PKC subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PKCs are
           classified into three groups (classical, atypical, and
           novel) depending on their mode of activation and the
           structural characteristics of their regulatory domain.
           PKCs undergo three phosphorylations in order to take
           mature forms. In addition, classical PKCs depend on
           calcium, DAG (1,2-diacylglycerol), and in most cases,
           phosphatidylserine (PS) for activation. Novel PKCs are
           calcium-independent, but require DAG and PS for
           activity, while atypical PKCs only require PS. PKCs
           phosphorylate and modify the activities of a wide
           variety of cellular proteins including receptors,
           enzymes, cytoskeletal proteins, transcription factors,
           and other kinases. They play a central role in signal
           transduction pathways that regulate cell migration and
           polarity, proliferation, differentiation, and apoptosis.
           Also included in this subfamily are the PKC-like
           proteins, called PKNs.
          Length = 318

 Score = 37.0 bits (86), Expect = 0.002
 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 5/37 (13%)

Query: 4   QKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWSY 40
              +TF GTP ++APE++        PY   VD W+ 
Sbjct: 151 VTTSTFCGTPDYIAPEIL-----SYQPYGPAVDWWAL 182


>gnl|CDD|214801 smart00750, KIND, kinase non-catalytic C-lobe domain.  It is an
          interaction domain identified as being similar to the
          C-terminal protein kinase catalytic fold (C lobe). Its
          presence at the N terminus of signalling proteins and
          the absence of the active-site residues in the
          catalytic and activation loops suggest that it folds
          independently and is likely to be non-catalytic. The
          occurrence of KIND only in metazoa implies that it has
          evolved from the catalytic protein kinase domain into
          an interaction domain possibly by keeping the
          substrate-binding features.
          Length = 176

 Score = 36.6 bits (85), Expect = 0.002
 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 5/30 (16%)

Query: 10 IGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
             PY+MAPEV+  +      Y  K DI+S
Sbjct: 65 RPDPYFMAPEVIQGQ-----SYTEKADIYS 89


>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like
           dual-specificity MAP kinase kinases.  Protein kinases
           (PKs), MAP kinase kinase(MAPKK) subfamily, fungal
           Pek1-like proteins, catalytic (c) domain. PKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MAPKK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases, protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           mitogen-activated protein (MAP) kinase signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising of the MAP kinase (MAPK),
           which is phosphorylated and activated by a MAPK kinase
           (MAPKK or MKK), which itself is phosphorylated and
           activated by a MAPK kinase kinase (MAPKKK or MKKK).
           Members of this group include the MAPKKs Pek1/Skh1 from
           Schizosaccharomyces pombe and MKK2 from Saccharomyces
           cerevisiae, and related proteins. Both fission yeast
           Pek1 and baker's yeast MKK2 are components of the cell
           integrity MAPK pathway. In fission yeast, Pek1
           phosphorylates and activates the MAPK Pmk1/Spm1 and is
           regulated by the MAPKKK Mkh1. In baker's yeast, the
           pathway involves the MAPK Slt2, the MAPKKs MKK1 and
           MKK2, and the MAPKKK Bck1. The cell integrity MAPK
           cascade is activated by multiple stress conditions, and
           is essential  in cell wall construction, morphogenesis,
           cytokinesis, and ion homeostasis.
          Length = 287

 Score = 36.2 bits (84), Expect = 0.003
 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 5/32 (15%)

Query: 8   TFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           TF GT ++MAPE +     +  PY    D+WS
Sbjct: 162 TFTGTSFYMAPERI-----QGKPYSITSDVWS 188


>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional.
          Length = 496

 Score = 36.4 bits (84), Expect = 0.003
 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 5/32 (15%)

Query: 8   TFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           TF GTPY++APE+     +R  PY  K D++S
Sbjct: 204 TFCGTPYYVAPEI-----WRRKPYSKKADMFS 230


>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal
           Bck1-like MAP Kinase Kinase Kinases.  Serine/threonine
           kinases (STKs), mitogen-activated protein kinase (MAPK)
           kinase kinase (MAPKKK) subfamily, fungal Bck1-like
           proteins, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MAPKKK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this group include the MAPKKKs
           Saccharomyces cerevisiae Bck1 and Schizosaccharomyces
           pombe Mkh1, and related proteins. MAPKKKs phosphorylate
           and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks),
           which in turn phosphorylate and activate MAPKs during
           signaling cascades that are important in mediating
           cellular responses to extracellular signals. Budding
           yeast Bck1 is part of the cell integrity MAPK pathway,
           which is activated by stresses and aggressions to the
           cell wall. The MAPKKK Bck1, MAPKKs Mkk1 and Mkk2, and
           the MAPK Slt2 make up the cascade that is important in
           the maintenance of cell wall homeostasis. Fission yeast
           Mkh1 is involved in MAPK cascades regulating cell
           morphology, cell wall integrity, salt resistance, and
           filamentous growth in response to stress.
          Length = 272

 Score = 35.9 bits (83), Expect = 0.003
 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 3/33 (9%)

Query: 7   NTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
            +  G+ +WMAPEV+   ++    Y  KVDIWS
Sbjct: 168 MSMQGSVFWMAPEVI--HSYSQG-YSAKVDIWS 197


>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Phosphoinositide-dependent
           kinase 1.  Serine/Threonine Kinases (STKs),
           Phosphoinositide-dependent kinase 1 (PDK1) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PDK1 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase (PI3K). PDK1
           carries an N-terminal catalytic domain and a C-terminal
           pleckstrin homology (PH) domain that binds
           phosphoinositides. It phosphorylates the activation loop
           of AGC kinases that are regulated by PI3K such as PKB,
           SGK, and PKC, among others, and is crucial for their
           activation. Thus, it contributes in regulating many
           processes including metabolism, growth, proliferation,
           and survival. PDK1 also has the ability to
           autophosphorylate and is constitutively active in
           mammalian cells. PDK1 is essential for normal embryo
           development and is important in regulating cell volume.
          Length = 280

 Score = 36.0 bits (84), Expect = 0.004
 Identities = 8/37 (21%), Positives = 20/37 (54%), Gaps = 5/37 (13%)

Query: 4   QKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWSY 40
           ++  +F+GT  +++PE++      + P     D+W+ 
Sbjct: 177 RRFASFVGTAEYVSPELL-----NEKPAGKSSDLWAL 208


>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 3.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 3 (Nek3) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek3 subfamily is
           one of a family of 11 different Neks (Nek1-11) that are
           involved in cell cycle control. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Nek3 is primarily
           localized in the cytoplasm and shows no cell
           cycle-dependent changes in its activity. It is present
           in the axons of neurons and affects morphogenesis and
           polarity through its regulation of microtubule
           acetylation. Nek3 modulates the signaling of the
           prolactin receptor through its activation of Vav2 and
           contributes to prolactin-mediated motility of breast
           cancer cells.
          Length = 255

 Score = 35.7 bits (82), Expect = 0.004
 Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 5/32 (15%)

Query: 8   TFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           T++GTPY++ PE+     + + PY+ K DIWS
Sbjct: 159 TYVGTPYYVPPEI-----WENMPYNNKSDIWS 185


>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein
           Serine/Threonine Kinase, Classical Protein Kinase C.
           Serine/Threonine Kinases (STKs), Classical (or
           Conventional) Protein Kinase C (cPKC) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The cPKC subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase (PI3K). PKCs are
           classified into three groups (classical, atypical, and
           novel) depending on their mode of activation and the
           structural characteristics of their regulatory domain.
           PKCs undergo three phosphorylations in order to take
           mature forms. In addition, cPKCs depend on calcium, DAG
           (1,2-diacylglycerol), and in most cases,
           phosphatidylserine (PS) for activation. cPKCs contain a
           calcium-binding C2 region in their regulatory domain.
           There are four cPKC isoforms, named alpha, betaI,
           betaII, and gamma. cPKCs are potent kinases for
           histones, myelin basic protein, and protamine. PKC-gamma
           is mainly expressed in neuronal tissues. It plays a role
           in protection from ischemia.
          Length = 324

 Score = 35.9 bits (83), Expect = 0.004
 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 5/33 (15%)

Query: 8   TFIGTPYWMAPEVVLCETFRDNPYDFKVDIWSY 40
           TF GTP ++APE++  +     PY   VD W++
Sbjct: 160 TFCGTPDYIAPEIIAYQ-----PYGKSVDWWAF 187


>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine
           Kinase, Serum- and Glucocorticoid-induced Kinase.
           Serine/Threonine Kinases (STKs), Serum- and
           Glucocorticoid-induced Kinase (SGK) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The SGK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. There are three
           isoforms of SGK, named SGK1, SGK2, and SGK3 (also called
           cytokine-independent survival kinase CISK). SGKs are
           activated by insulin and growth factors via
           phosphoinositide 3-kinase and PDK1. They activate ion
           channels, ion carriers, and the Na-K-ATPase, as well as
           regulate the activity of enzymes and transcription
           factors. SGKs play important roles in transport, hormone
           release, neuroexcitability, cell proliferation, and
           apoptosis.
          Length = 323

 Score = 35.9 bits (83), Expect = 0.004
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 5/31 (16%)

Query: 8   TFIGTPYWMAPEVVLCETFRDNPYDFKVDIW 38
           TF GTP ++APEV+     R  PYD  VD W
Sbjct: 155 TFCGTPEYLAPEVL-----RKQPYDRTVDWW 180


>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein
           Serine/Threonine Kinase, MAP/ERK kinase kinase 2.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 2
           (MEKK2) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MEKK2 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MEKK2 is a mitogen-activated protein kinase
           (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
           phosphorylates and activates the MAPK kinase MEK5 (or
           MKK5), which in turn phosphorylates and activates
           extracellular signal-regulated kinase 5 (ERK5). The ERK5
           cascade plays roles in promoting cell proliferation,
           differentiation, neuronal survival, and neuroprotection.
           MEKK2 also activates ERK1/2, c-Jun N-terminal kinase
           (JNK) and p38 through their respective MAPKKs MEK1/2,
           JNK-activating kinase 2 (JNKK2), and MKK3/6. MEKK2 plays
           roles in T cell receptor signaling, immune synapse
           formation, cytokine gene expression, as well as in EGF
           and FGF receptor signaling.
          Length = 265

 Score = 35.8 bits (82), Expect = 0.005
 Identities = 16/29 (55%), Positives = 18/29 (62%), Gaps = 5/29 (17%)

Query: 11  GTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           GTPYWM+PEV+  E      Y  K DIWS
Sbjct: 171 GTPYWMSPEVISGEG-----YGRKADIWS 194


>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal
           Byr2-like MAP Kinase Kinase Kinases.  Serine/threonine
           kinases (STKs), mitogen-activated protein kinase (MAPK)
           kinase kinase (MAPKKK) subfamily, fungal Byr2-like
           proteins, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MAPKKK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this group include the MAPKKKs
           Schizosaccharomyces pombe Byr2, Saccharomyces cerevisiae
           and Cryptococcus neoformans Ste11, and related proteins.
           They contain an N-terminal SAM (sterile alpha-motif)
           domain, which mediates protein-protein interaction, and
           a C-terminal catalytic domain. MAPKKKs phosphorylate and
           activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which
           in turn phosphorylate and activate MAPKs during
           signaling cascades that are important in mediating
           cellular responses to extracellular signals. Fission
           yeast Byr2 is regulated by Ras1. It responds to
           pheromone signaling and controls mating through the MAPK
           pathway. Budding yeast Ste11 functions in MAPK cascades
           that regulate mating, high osmolarity glycerol, and
           filamentous growth responses.
          Length = 267

 Score = 35.6 bits (82), Expect = 0.005
 Identities = 14/40 (35%), Positives = 18/40 (45%), Gaps = 6/40 (15%)

Query: 1   MTLQKHN-TFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
                   +  G+ +WMAPEVV     +   Y  K DIWS
Sbjct: 163 TKTNGARPSLQGSVFWMAPEVV-----KQTSYTRKADIWS 197


>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein
           Serine/Threonine Kinase, Serum- and
           Glucocorticoid-induced Kinase 2.  Serine/Threonine
           Kinases (STKs), Serum- and Glucocorticoid-induced Kinase
           (SGK) subfamily, SGK2 isoform, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The SGK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. There are three isoforms of
           SGK, named SGK1, SGK2, and SGK3. SGK2 shows a more
           restricted distribution that SGK1 and is most abundantly
           expressed in epithelial tissues including kidney, liver,
           pancreas, and the choroid plexus of the brain. In vitro
           cellular assays show that SGK2 can stimulate the
           activity of ion channels, the glutamate transporter
           EEAT4, and the glutamate receptors, GluR6 and GLUR1.
          Length = 321

 Score = 35.3 bits (81), Expect = 0.006
 Identities = 16/32 (50%), Positives = 20/32 (62%), Gaps = 5/32 (15%)

Query: 7   NTFIGTPYWMAPEVVLCETFRDNPYDFKVDIW 38
           +TF GTP ++APEV+     R  PYD  VD W
Sbjct: 154 STFCGTPEYLAPEVL-----RKEPYDRTVDWW 180


>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase
           kinase 3-like Protein Serine/Threonine Kinases.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3
           (MEKK3)-like subfamily, catalytic (c) domain,
           functionally uncharacterized subgroup 1. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MEKK3-like subfamily is part of a larger superfamily
           that includes the catalytic domains of other protein
           STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. The MEKK3-like subfamily is
           composed of MEKK3, MEKK2, and related proteins, all
           containing an N-terminal PB1 domain, which mediates
           oligomerization, and a C-terminal catalytic domain.
           MEKK2 and MEKK3 are mitogen-activated protein kinase
           (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks),
           proteins that phosphorylate and activate MAPK kinases
           (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate
           and activate MAPKs during signaling cascades that are
           important in mediating cellular responses to
           extracellular signals. MEKK2 and MEKK3 activate MEK5
           (also called MKK5), which activates extracellular
           signal-regulated kinase 5 (ERK5). The ERK5 cascade plays
           roles in promoting cell proliferation, differentiation,
           neuronal survival, and neuroprotection. MEKK3 plays an
           essential role in embryonic angiogenesis and early heart
           development. MEKK2 and MEKK3 can also activate the
           MAPKs, c-Jun N-terminal kinase (JNK) and p38, through
           their respective MAPKKs.
          Length = 264

 Score = 35.4 bits (81), Expect = 0.006
 Identities = 15/29 (51%), Positives = 18/29 (62%), Gaps = 5/29 (17%)

Query: 11  GTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           GTPYWM+PEV+  E      Y  K D+WS
Sbjct: 171 GTPYWMSPEVISGEG-----YGRKADVWS 194


>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function
           prediction only / Signal transduction mechanisms /
           Transcription / DNA replication, recombination, and
           repair].
          Length = 384

 Score = 35.5 bits (80), Expect = 0.007
 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 2/37 (5%)

Query: 4   QKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWSY 40
              +T +GTP +MAPEV+L             DIWS 
Sbjct: 163 ALPSTSVGTPGYMAPEVLL--GLSLAYASSSSDIWSL 197


>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein
           Serine/Threonine Kinases, Novel Protein Kinase C theta
           and delta.  Serine/Threonine Kinases (STKs), Novel
           Protein Kinase C (nPKC), theta and delta-like isoforms,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The nPKC subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PKCs are
           classified into three groups (classical, atypical, and
           novel) depending on their mode of activation and the
           structural characteristics of their regulatory domain.
           nPKCs are calcium-independent, but require DAG
           (1,2-diacylglycerol) and phosphatidylserine (PS) for
           activity. There are four nPKC isoforms, delta, epsilon,
           eta, and theta. PKC-theta is selectively expressed in
           T-cells and plays an important and non-redundant role in
           several aspects of T-cell biology. PKC-delta plays a
           role in cell cycle regulation and programmed cell death
           in many cell types.
          Length = 316

 Score = 35.2 bits (81), Expect = 0.007
 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 5/36 (13%)

Query: 5   KHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWSY 40
           K +TF GTP ++APE++  +      Y+  VD WS+
Sbjct: 152 KASTFCGTPDYIAPEILKGQK-----YNESVDWWSF 182


>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein
           Serine/Threonine Kinase, Serum- and
           Glucocorticoid-induced Kinase 3.  Serine/Threonine
           Kinases (STKs), Serum- and Glucocorticoid-induced Kinase
           (SGK) subfamily, SGK3 isoform, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The SGK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. There are three isoforms of
           SGK, named SGK1, SGK2, and SGK3 (also called
           cytokine-independent survival kinase CISK). SGK3 is
           expressed in most tissues and is most abundant in the
           embryo and adult heart and spleen. It was originally
           discovered in a screen for antiapoptotic genes. It
           phosphorylates and inhibits the proapoptotic proteins,
           Bad and FKHRL1. SGK3 also regulates many transporters,
           ion channels, and receptors. It plays a critical role in
           hair follicle morphogenesis and hair cycling.
          Length = 325

 Score = 35.0 bits (80), Expect = 0.007
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 5/31 (16%)

Query: 8   TFIGTPYWMAPEVVLCETFRDNPYDFKVDIW 38
           TF GTP ++APEV+     R  PYD  VD W
Sbjct: 155 TFCGTPEYLAPEVI-----RKQPYDNTVDWW 180


>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity
           Protein Kinase, Mitogen-Activated Protein Kinase Kinase.
            Protein kinases (PKs), MAP kinase kinase (MAPKK)
           subfamily, catalytic (c) domain. PKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MAPKK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases, protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           mitogen-activated protein (MAP) kinase signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising the MAP kinase (MAPK),
           which is phosphorylated and activated by a MAPK kinase
           (MAPKK or MKK or MAP2K), which itself is phosphorylated
           and activated by a MAPK kinase kinase (MAPKKK or MKKK or
           MAP3K). MAPKKs are dual-specificity PKs that
           phosphorylate their downstream targets, MAPKs, at
           specific threonine and tyrosine residues. There are
           three MAPK subfamilies: extracellular signal-regulated
           kinase (ERK), c-Jun N-terminal kinase (JNK), and p38. In
           mammalian cells, there are seven MAPKKs (named MKK1-7)
           and 20 MAPKKKs. Each MAPK subfamily can be activated by
           at least two cognate MAPKKs and by multiple MAPKKKs.
          Length = 265

 Score = 35.0 bits (81), Expect = 0.008
 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 5/33 (15%)

Query: 7   NTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
            TF+GT  +MAPE +     + N Y  K DIWS
Sbjct: 157 KTFVGTSSYMAPERI-----QGNDYSVKSDIWS 184


>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 8.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 8 (Nek8) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek8 subfamily is
           one of a family of 11 different Neks (Nek1-11) that are
           involved in cell cycle control. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Nek8 contains an
           N-terminal kinase catalytic domain and a C-terminal RCC1
           (regulator of chromosome condensation) domain. A double
           point mutation in Nek8 causes cystic kidney disease in
           mice that genetically resembles human autosomal
           recessive polycystic kidney disease (ARPKD). Nek8 is
           also associated with a rare form of juvenile renal
           cystic disease, nephronophthisis type 9. It has been
           suggested that a defect in the ciliary localization of
           Nek8 contributes to the development of cysts manifested
           by these diseases.
          Length = 256

 Score = 34.8 bits (80), Expect = 0.009
 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 5/35 (14%)

Query: 5   KHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           K  T +GTP +++PE  LCE     PY+ K DIW+
Sbjct: 157 KAYTVVGTPCYISPE--LCEG---KPYNQKSDIWA 186


>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein
           Serine/Threonine Kinase, MAP/ERK kinase kinase 3.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3
           (MEKK3) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MEKK3 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MEKK3 is a mitogen-activated protein kinase
           (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
           phosphorylates and activates the MAPK kinase MEK5 (or
           MKK5), which in turn phosphorylates and activates
           extracellular signal-regulated kinase 5 (ERK5). The ERK5
           cascade plays roles in promoting cell proliferation,
           differentiation, neuronal survival, and neuroprotection.
           MEKK3 plays an essential role in embryonic angiogenesis
           and early heart development. In addition, MEKK3 is
           involved in interleukin-1 receptor and Toll-like
           receptor 4 signaling. It is also a specific regulator of
           the proinflammatory cytokines IL-6 and GM-CSF in some
           immune cells. MEKK3 also regulates calcineurin, which
           plays a critical role in T cell activation, apoptosis,
           skeletal myocyte differentiation, and cardiac
           hypertrophy.
          Length = 266

 Score = 34.7 bits (79), Expect = 0.010
 Identities = 15/29 (51%), Positives = 18/29 (62%), Gaps = 5/29 (17%)

Query: 11  GTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           GTPYWM+PEV+  E      Y  K D+WS
Sbjct: 171 GTPYWMSPEVISGEG-----YGRKADVWS 194


>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein
           Serine/Threonine Kinase, Atypical Protein Kinase C.
           Serine/Threonine Kinases (STKs), Atypical Protein Kinase
           C (aPKC) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           aPKC subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PKCs are classified into three groups
           (classical, atypical, and novel) depending on their mode
           of activation and the structural characteristics of
           their regulatory domain. aPKCs only require
           phosphatidylserine (PS) for activation. They contain a
           C2-like region, instead of a calcium-binding (C2) region
           found in classical PKCs, in their regulatory domain.
           There are two aPKC isoforms, zeta and iota. aPKCs are
           involved in many cellular functions including
           proliferation, migration, apoptosis, polarity
           maintenance and cytoskeletal regulation. They also play
           a critical role in the regulation of glucose metabolism
           and in the pathogenesis of type 2 diabetes.
          Length = 329

 Score = 34.0 bits (78), Expect = 0.020
 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 5/32 (15%)

Query: 8   TFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           TF GTP ++APE++     R   Y F VD W+
Sbjct: 155 TFCGTPNYIAPEIL-----RGEDYGFSVDWWA 181


>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity.
           Phosphotransferases. The specificity of this class of
           kinases can not be predicted. Possible dual-specificity
           Ser/Thr/Tyr kinase.
          Length = 258

 Score = 33.3 bits (77), Expect = 0.024
 Identities = 9/26 (34%), Positives = 15/26 (57%), Gaps = 5/26 (19%)

Query: 15  WMAPEVVLCETFRDNPYDFKVDIWSY 40
           WMAPE     + ++  +  K D+WS+
Sbjct: 170 WMAPE-----SLKEGKFTSKSDVWSF 190


>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR
           kinase-like Protein Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Rho-associated
           coiled-coil containing protein kinase (ROCK) and Nuclear
           Dbf2-Related (NDR)-like kinase subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The ROCK- and NDR-like
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this subfamily include ROCK and
           ROCK-like proteins such as DMPK, MRCK, and CRIK, as well
           as NDR and NDR-like proteins such as LATS, CBK1 and
           Sid2p. ROCK and CRIK are effectors of the small GTPase
           Rho, while MRCK is an effector of the small GTPase
           Cdc42. NDR and NDR-like kinases contain an N-terminal
           regulatory (NTR) domain and an insert within the
           catalytic domain that contains an auto-inhibitory
           sequence. Proteins in this subfamily are involved in
           regulating many cellular functions including
           contraction, motility, division, proliferation,
           apoptosis, morphogenesis, and cytokinesis.
          Length = 350

 Score = 33.4 bits (77), Expect = 0.025
 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 5/33 (15%)

Query: 7   NTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           N+ +GTP ++APEV      R  PY  + D WS
Sbjct: 188 NSTVGTPDYIAPEV-----LRGTPYGLECDWWS 215


>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein
           Serine/Threonine Kinase, Novel Protein Kinase C theta.
           Serine/Threonine Kinases (STKs), Novel Protein Kinase C
           (nPKC), theta isoform, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The nPKC subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PKCs are classified into three groups
           (classical, atypical, and novel) depending on their mode
           of activation and the structural characteristics of
           their regulatory domain. nPKCs are calcium-independent,
           but require DAG (1,2-diacylglycerol) and
           phosphatidylserine (PS) for activity. There are four
           nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta
           is selectively expressed in T-cells and plays an
           important and non-redundant role in several aspects of
           T-cell biology. Although T-cells also express other PKC
           isoforms, PKC-theta is unique in that upon antigen
           stimulation, it is translocated to the plasma membrane
           at the immunological synapse, where it mediates signals
           essential for T-cell activation. It is essential for
           TCR-induced proliferation, cytokine production, T-cell
           survival, and the differentiation and effector function
           of T-helper (Th) cells, particularly Th2 and Th17.
           PKC-theta is being developed as a therapeutic target for
           Th2-mediated allergic inflammation and Th17-mediated
           autoimmune diseases.
          Length = 316

 Score = 33.4 bits (76), Expect = 0.025
 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 5/36 (13%)

Query: 5   KHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWSY 40
           K  TF GTP ++APE++L +      Y+  VD WS+
Sbjct: 152 KTCTFCGTPDYIAPEILLGQK-----YNTSVDWWSF 182


>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine
           Kinase, cAMP-dependent protein kinase.  Serine/Threonine
           Kinases (STKs), cAMP-dependent protein kinase (PKA)
           subfamily, catalytic (c) subunit. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PKA
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase (PI3K). This subfamily is composed of the
           cAMP-dependent proteins kinases, PKA and PRKX. The
           inactive PKA holoenzyme is a heterotetramer composed of
           two phosphorylated and active catalytic (C) subunits
           with a dimer of regulatory (R) subunits. Activation is
           achieved through the binding of the important second
           messenger cAMP to the R subunits, which leads to the
           dissociation of PKA into the R dimer and two active C
           subunits. PKA is present ubiquitously in cells and
           interacts with many different downstream targets. It
           plays a role in the regulation of diverse processes such
           as growth, development, memory, metabolism, gene
           expression, immunity, and lipolysis.
          Length = 290

 Score = 33.3 bits (77), Expect = 0.026
 Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 5/32 (15%)

Query: 8   TFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           T  GTP ++APE++L +      Y   VD W+
Sbjct: 157 TLCGTPEYLAPEIILSK-----GYGKAVDWWA 183


>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine
           Kinase, Protein Kinase N.  Serine/Threonine Kinases
           (STKs), Protein Kinase N (PKN) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PKN subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PKN has a
           C-terminal catalytic domain that is highly homologous to
           PKCs. Its unique N-terminal regulatory region contains
           antiparallel coiled-coil (ACC) domains. In mammals,
           there are three PKN isoforms from different genes
           (designated PKN-alpha, beta, and gamma), which show
           different enzymatic properties, tissue distribution, and
           varied functions. PKN can be activated by the small
           GTPase Rho, and by fatty acids such as arachidonic and
           linoleic acids. It is involved in many biological
           processes including cytokeletal regulation, cell
           adhesion, vesicle transport, glucose transport,
           regulation of meiotic maturation and embryonic cell
           cycles, signaling to the nucleus, and tumorigenesis.
          Length = 324

 Score = 33.5 bits (77), Expect = 0.029
 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 5/35 (14%)

Query: 4   QKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIW 38
            + +TF GTP ++APEV+      +  Y   VD W
Sbjct: 156 DRTSTFCGTPEFLAPEVLT-----ETSYTRAVDWW 185


>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain.
           Phosphotransferases. Tyrosine-specific kinase subfamily.
          Length = 257

 Score = 32.9 bits (76), Expect = 0.035
 Identities = 9/26 (34%), Positives = 15/26 (57%), Gaps = 5/26 (19%)

Query: 15  WMAPEVVLCETFRDNPYDFKVDIWSY 40
           WMAPE     + ++  +  K D+WS+
Sbjct: 169 WMAPE-----SLKEGKFTSKSDVWSF 189


>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases.
           Protein Tyrosine Kinase (PTK) family, catalytic domain.
           This PTKc family is part of a larger superfamily that
           includes the catalytic domains of protein
           serine/threonine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase (PI3K). PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. They can be classified
           into receptor and non-receptor tyr kinases. PTKs play
           important roles in many cellular processes including,
           lymphocyte activation, epithelium growth and
           maintenance, metabolism control, organogenesis
           regulation, survival, proliferation, differentiation,
           migration, adhesion, motility, and morphogenesis.
           Receptor tyr kinases (RTKs) are integral membrane
           proteins which contain an extracellular ligand-binding
           region, a transmembrane segment, and an intracellular
           tyr kinase domain. RTKs are usually activated through
           ligand binding, which causes dimerization and
           autophosphorylation of the intracellular tyr kinase
           catalytic domain, leading to intracellular signaling.
           Some RTKs are orphan receptors with no known ligands.
           Non-receptor (or cytoplasmic) tyr kinases are
           distributed in different intracellular compartments and
           are usually multi-domain proteins containing a catalytic
           tyr kinase domain as well as various regulatory domains
           such as SH3 and SH2. PTKs are usually autoinhibited and
           require a mechanism for activation. In many PTKs, the
           phosphorylation of tyr residues in the activation loop
           is essential for optimal activity. Aberrant expression
           of PTKs is associated with many development
           abnormalities and cancers.
          Length = 262

 Score = 32.9 bits (76), Expect = 0.037
 Identities = 10/26 (38%), Positives = 15/26 (57%), Gaps = 5/26 (19%)

Query: 15  WMAPEVVLCETFRDNPYDFKVDIWSY 40
           WMAPE     + +D  +  K D+WS+
Sbjct: 173 WMAPE-----SLKDGIFTSKSDVWSF 193


>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein
           Serine/Threonine Kinase, Classical Protein Kinase C
           alpha.  Serine/Threonine Kinases (STKs), Classical
           Protein Kinase C (cPKC) subfamily, alpha isoform,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The cPKC subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PKCs are
           classified into three groups (classical, atypical, and
           novel) depending on their mode of activation and the
           structural characteristics of their regulatory domain.
           PKCs undergo three phosphorylations in order to take
           mature forms. In addition, cPKCs depend on calcium, DAG
           (1,2-diacylglycerol), and in most cases,
           phosphatidylserine (PS) for activation. There are four
           cPKC isoforms, named alpha, betaI, betaII, and gamma.
           PKC-alpha is expressed in many tissues and is associated
           with cell proliferation, apoptosis, and cell motility.
           It plays a role in the signaling of the growth factors
           PDGF, VEGF, EGF, and FGF. Abnormal levels of PKC-alpha
           have been detected in many transformed cell lines and
           several human tumors. In addition, PKC-alpha is required
           for HER2 dependent breast cancer invasion.
          Length = 323

 Score = 32.7 bits (74), Expect = 0.048
 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 5/33 (15%)

Query: 8   TFIGTPYWMAPEVVLCETFRDNPYDFKVDIWSY 40
           TF GTP ++APE++  +     PY   VD W+Y
Sbjct: 160 TFCGTPDYIAPEIIAYQ-----PYGKSVDWWAY 187


>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional.
          Length = 1021

 Score = 32.8 bits (74), Expect = 0.050
 Identities = 14/30 (46%), Positives = 21/30 (70%), Gaps = 3/30 (10%)

Query: 10  IGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           +GTPY+ +PE++L ET     YD K D+W+
Sbjct: 202 VGTPYYWSPELLLHET---KSYDDKSDMWA 228


>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like
           dual-specificity MAP kinase kinases.  Protein kinases
           (PKs), MAP kinase kinase (MAPKK) subfamily, fungal
           Byr1-like proteins, catalytic (c) domain. PKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MAPKK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases, protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           mitogen-activated protein (MAP) kinase signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising of the MAP kinase (MAPK),
           which is phosphorylated and activated by a MAPK kinase
           (MAPKK or MKK), which itself is phosphorylated and
           activated by a MAPK kinase kinase (MAPKKK or MKKK).
           Members of this group include the MAPKKs Byr1 from
           Schizosaccharomyces pombe, FUZ7 from Ustilago maydis,
           and related proteins. Byr1 phosphorylates its downstream
           target, the MAPK Spk1, and is regulated by the MAPKKK
           Byr2. The Spk1 cascade is pheromone-responsive and is
           essential for sporulation and sexual differentiation in
           fission yeast. FUZ7 phosphorylates and activates its
           target, the MAPK Crk1, which is required in mating and
           virulence in U. maydis.
          Length = 284

 Score = 32.1 bits (73), Expect = 0.067
 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 5/33 (15%)

Query: 7   NTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           +TF+GT  +M+PE +     +   Y  K D+WS
Sbjct: 160 DTFVGTSTYMSPERI-----QGGKYTVKSDVWS 187


>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Serum- and
           Glucocorticoid-induced Kinase 1.  Serine/Threonine
           Kinases (STKs), Serum- and Glucocorticoid-induced Kinase
           (SGK) subfamily, SGK1 isoform, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The SGK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. There are three isoforms of
           SGK, named SGK1, SGK2, and SGK3. SGK1 is ubiquitously
           expressed and is under transcriptional control of
           numerous stimuli including cell stress (cell shrinkage),
           serum, hormones (gluco- and mineralocorticoids),
           gonadotropins, growth factors, interleukin-6, and other
           cytokines. It plays roles in sodium retention and
           potassium elimination in the kidney, nutrient transport,
           salt sensitivity, memory consolidation, and cardiac
           repolarization. A common SGK1 variant is associated with
           increased blood pressure and body weight. SGK1 may also
           contribute to tumor growth, neurodegeneration, fibrosing
           disease, and ischemia.
          Length = 325

 Score = 32.3 bits (73), Expect = 0.071
 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 5/32 (15%)

Query: 7   NTFIGTPYWMAPEVVLCETFRDNPYDFKVDIW 38
           +TF GTP ++APEV+        PYD  VD W
Sbjct: 154 STFCGTPEYLAPEVL-----HKQPYDRTVDWW 180


>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein
           Serine/Threonine Kinase, Novel Protein Kinase C delta.
           Serine/Threonine Kinases (STKs), Novel Protein Kinase C
           (nPKC), delta isoform, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The nPKC subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PKCs are classified into three groups
           (classical, atypical, and novel) depending on their mode
           of activation and the structural characteristics of
           their regulatory domain. nPKCs are calcium-independent,
           but require DAG (1,2-diacylglycerol) and
           phosphatidylserine (PS) for activity. There are four
           nPKC isoforms, delta, epsilon, eta, and theta. PKC-delta
           plays a role in cell cycle regulation and programmed
           cell death in many cell types. It slows down cell
           proliferation, inducing cell cycle arrest and enhancing
           cell differentiation. PKC-delta is also involved in the
           regulation of transcription as well as immune and
           inflammatory responses. It plays a central role in the
           genotoxic stress response that leads to DNA
           damaged-induced apoptosis.
          Length = 316

 Score = 31.8 bits (72), Expect = 0.087
 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 5/36 (13%)

Query: 5   KHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWSY 40
           + +TF GTP ++APE++         Y F VD WS+
Sbjct: 152 RASTFCGTPDYIAPEILQGLK-----YTFSVDWWSF 182


>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine
           Kinase, G protein-coupled Receptor Kinase.
           Serine/Threonine Kinases (STKs), G protein-coupled
           Receptor Kinase (GRK) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The GRK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. GRKs phosphorylate and
           regulate G protein-coupled receptors (GPCRs), the
           largest superfamily of cell surface receptors, which
           regulate some part of nearly all physiological
           functions. Phosphorylated GPCRs bind to arrestins, which
           prevents further G protein signaling despite the
           presence of activating ligand. GRKs contain a central
           catalytic domain, flanked by N- and C-terminal
           extensions. The N-terminus contains an RGS (regulator of
           G protein signaling) homology (RH) domain and several
           motifs. The C-terminus diverges among different groups
           of GRKs. There are seven types of GRKs, named GRK1 to
           GRK7. They are subdivided into three main groups: visual
           (GRK1/7); beta-adrenergic receptor kinases (GRK2/3); and
           GRK4-like (GRK4/5/6). Expression of GRK2/3/5/6 is
           widespread while GRK1/4/7 show a limited tissue
           distribution. The substrate spectrum of the widely
           expressed GRKs partially overlaps. GRKs play important
           roles in the cardiovascular, immune, respiratory,
           skeletal, and nervous systems.
          Length = 277

 Score = 31.7 bits (72), Expect = 0.091
 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 5/36 (13%)

Query: 4   QKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           +K     GTP +MAPEV+  E      YDF VD ++
Sbjct: 149 KKIKGRAGTPGYMAPEVLQGEV-----YDFSVDWFA 179


>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine
           Kinases, Fungal Mitogen-Activated Protein Kinases Sty1
           and Hog1.  Serine/Threonine Kinases (STKs), Fungal
           Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           Sty1/Hog1 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of the MAPKs Sty1
           from Schizosaccharomyces pombe, Hog1 from Saccharomyces
           cerevisiae, and similar proteins. MAPKs are important
           mediators of cellular responses to extracellular
           signals. Sty1 and Hog1 are stress-activated MAPKs that
           partipate in transcriptional regulation in response to
           stress. Sty1 is activated in response to oxidative
           stress, osmotic stress, and UV radiation. Sty1 is
           regulated by the MAP2K Wis1, which is activated by the
           MAP3Ks Wis4 and Win1, which receive signals of the
           stress condition from membrane-spanning histidine
           kinases Mak1-3. Activated Sty1 stabilizes the Atf1
           transcription factor and induces transcription of
           Atf1-dependent genes of the core environmetal stress
           response (CESR). Hog1 is the key element in the high
           osmolarity glycerol (HOG) pathway and is activated upon
           hyperosmotic stress. Activated Hog1 accumulates in the
           nucleus and regulates stress-induced transcription. The
           HOG pathway is mediated by two transmembrane
           osmosensors, Sln1 and Sho1.
          Length = 328

 Score = 31.7 bits (72), Expect = 0.11
 Identities = 14/31 (45%), Positives = 22/31 (70%), Gaps = 4/31 (12%)

Query: 9   FIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           ++ T Y+ APE++L  T++   YD +VDIWS
Sbjct: 165 YVSTRYYRAPEIML--TWQK--YDVEVDIWS 191


>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase. 
          Length = 258

 Score = 31.3 bits (72), Expect = 0.12
 Identities = 10/26 (38%), Positives = 14/26 (53%), Gaps = 5/26 (19%)

Query: 15  WMAPEVVLCETFRDNPYDFKVDIWSY 40
           WMAPE       +D  +  K D+WS+
Sbjct: 170 WMAPES-----LKDGKFTSKSDVWSF 190


>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of
           cAMP-dependent protein kinase-like Protein
           Serine/Threonine Kinases.  Serine/Threonine Kinases
           (STKs), Fission yeast Suppressor of loss of
           cAMP-dependent protein kinase (Sck1)-like subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Sck1-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of fungal proteins
           with similarity to the Schizosaccharomyces pombe STK
           Sck1. Sck1 plays a role in trehalase activation
           triggered by glucose and a nitrogen source. Trehalase
           catalyzes the cleavage of the disaccharide trehalose to
           glucose. Trehalose, as a carbohydrate reserve and stress
           metabolite, plays an important role in the response of
           yeast to environmental changes.
          Length = 330

 Score = 31.4 bits (71), Expect = 0.12
 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 4/33 (12%)

Query: 7   NTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           NTF GT  ++APEV+L     +  Y   VD WS
Sbjct: 154 NTFCGTTEYLAPEVLL----DEKGYTKHVDFWS 182


>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine
           Kinases, Platelet Derived Growth Factor Receptors.
           Protein Tyrosine Kinase (PTK) family; Platelet Derived
           Growth Factor Receptor (PDGFR) subfamily; catalytic (c)
           domain. The PDGFR subfamily consists of PDGFR alpha,
           PDGFR beta, KIT, CSF-1R, the mammalian FLT3, and similar
           proteins. The PTKc family is part of a larger
           superfamily that includes the catalytic domains of other
           kinases such as protein serine/threonine kinases, RIO
           kinases, and phosphoinositide 3-kinase (PI3K). PTKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to tyrosine (tyr) residues in protein substrates.
           PDGFR subfamily members are receptor tyr kinases (RTKs)
           containing an extracellular ligand-binding region with
           five immunoglobulin-like domains, a transmembrane
           segment, and an intracellular catalytic domain. PDGFR
           kinase domains are autoinhibited by their juxtamembrane
           regions containing tyr residues. The binding to their
           ligands leads to receptor dimerization, trans
           phosphorylation and activation, and intracellular
           signaling. PDGFR subfamily receptors are important in
           the development of a variety of cells. PDGFRs are
           expressed in a many cells including fibroblasts,
           neurons, endometrial cells, mammary epithelial cells,
           and vascular smooth muscle cells. PDGFR signaling is
           critical in normal embryonic development, angiogenesis,
           and wound healing. PDGFRs transduce mitogenic signals
           for connective tissue cells and are important for cell
           shape and motility. Kit is important in the development
           of melanocytes, germ cells, mast cells, hematopoietic
           stem cells, the interstitial cells of Cajal, and the
           pacemaker cells of the GI tract. CSF-1R signaling is
           critical in the regulation of macrophages and
           osteoclasts. Mammalian FLT3 plays an important role in
           the survival, proliferation, and differentiation of stem
           cells.
          Length = 302

 Score = 31.7 bits (72), Expect = 0.12
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 5/26 (19%)

Query: 15  WMAPEVVLCETFRDNPYDFKVDIWSY 40
           WMAPE +      +  Y F+ D+WSY
Sbjct: 209 WMAPESIF-----NCVYTFESDVWSY 229


>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein
           Serine/Threonine Kinase, Novel Protein Kinase C epsilon.
            Serine/Threonine Kinases (STKs), Novel Protein Kinase C
           (nPKC), epsilon isoform, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The nPKC subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PKCs are classified into three groups
           (classical, atypical, and novel) depending on their mode
           of activation and the structural characteristics of
           their regulatory domain. nPKCs are calcium-independent,
           but require DAG (1,2-diacylglycerol) and
           phosphatidylserine (PS) for activity. There are four
           nPKC isoforms, delta, epsilon, eta, and theta.
           PKC-epsilon has been shown to behave as an oncoprotein.
           Its overexpression contributes to neoplastic
           transformation depending on the cell type. It
           contributes to oncogenesis by inducing disordered cell
           growth and inhibiting cell death. It also plays a role
           in tumor invasion and metastasis. PKC-epsilon has also
           been found to confer cardioprotection against ischemia
           and reperfusion-mediated damage. Other cellular
           functions include the regulation of gene expression,
           cell adhesion, and cell motility.
          Length = 321

 Score = 31.4 bits (71), Expect = 0.13
 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 5/32 (15%)

Query: 8   TFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           TF GTP ++APE++     ++  Y   VD W+
Sbjct: 155 TFCGTPDYIAPEIL-----QELEYGPSVDWWA 181


>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein
           Serine/Threonine Kinase, MAP/ERK kinase kinase 4.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 4
           (MEKK4) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MEKK4 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MEKK4 is a mitogen-activated protein kinase
           (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
           phosphorylates and activates MAPK kinases (MAPKKs or
           MKKs or MAP2Ks), which in turn phosphorylate and
           activate MAPKs during signaling cascades that are
           important in mediating cellular responses to
           extracellular signals. MEKK4 activates the c-Jun
           N-terminal kinase (JNK) and p38 MAPK signaling pathways
           by directly activating their respective MAPKKs,
           MKK4/MKK7 and MKK3/MKK6. JNK and p38 are collectively
           known as stress-activated MAPKs, as they are activated
           in response to a variety of environmental stresses and
           pro-inflammatory cytokines. MEKK4 also plays roles in
           the re-polarization of the actin cytoskeleton in
           response to osmotic stress, in the proper closure of the
           neural tube, in cardiovascular development, and in
           immune responses.
          Length = 264

 Score = 31.2 bits (71), Expect = 0.14
 Identities = 12/36 (33%), Positives = 14/36 (38%), Gaps = 8/36 (22%)

Query: 7   NTFIGTPYWMAPEVVLCETFRDNPYDFK---VDIWS 39
            +  GTP +MAPEV                  DIWS
Sbjct: 161 QSLAGTPAYMAPEV-----ITGGKGKGHGRAADIWS 191


>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional.
          Length = 478

 Score = 31.5 bits (71), Expect = 0.15
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 5/39 (12%)

Query: 1   MTLQKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           ++L   ++F GTPY++APE+     +    Y  K D+WS
Sbjct: 223 VSLDVASSFCGTPYYLAPEL-----WERKRYSKKADMWS 256


>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein
           Serine/Threonine Kinase, Atypical Protein Kinase C zeta.
            Serine/Threonine Kinases (STKs), Atypical Protein
           Kinase C (aPKC) subfamily, zeta isoform, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The aPKC subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PKCs are
           classified into three groups (classical, atypical, and
           novel) depending on their mode of activation and the
           structural characteristics of their regulatory domain.
           aPKCs only require phosphatidylserine (PS) for
           activation. There are two aPKC isoforms, zeta and iota.
           PKC-zeta plays a critical role in activating the glucose
           transport response. It is activated by glucose, insulin,
           and exercise through diverse pathways. PKC-zeta also
           plays a central role in maintaining cell polarity in
           yeast and mammalian cells. In addition, it affects actin
           remodeling in muscle cells.
          Length = 327

 Score = 31.2 bits (70), Expect = 0.16
 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 5/33 (15%)

Query: 7   NTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           +TF GTP ++APE++     R   Y F VD W+
Sbjct: 154 STFCGTPNYIAPEIL-----RGEEYGFSVDWWA 181


>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine
           Kinase, Protein Kinase B.  Serine/Threonine Kinases
           (STKs), Protein Kinase B (PKB) or Akt subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PKB subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase (PI3K). There are
           three PKB isoforms from different genes, PKB-alpha (or
           Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB
           contains an N-terminal pleckstrin homology (PH) domain
           and a C-terminal catalytic domain. It is activated
           downstream of PI3K and plays important roles in diverse
           cellular functions including cell survival, growth,
           proliferation, angiogenesis, motility, and migration.
           PKB also has a central role in a variety of human
           cancers, having been implicated in tumor initiation,
           progression, and metastasis.
          Length = 323

 Score = 30.9 bits (70), Expect = 0.18
 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 5/31 (16%)

Query: 8   TFIGTPYWMAPEVVLCETFRDNPYDFKVDIW 38
           TF GTP ++APEV+      DN Y   VD W
Sbjct: 154 TFCGTPEYLAPEVL-----EDNDYGRAVDWW 179


>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein
           Kinase, MAP kinase kinase 4.  Protein kinases (PKs), MAP
           kinase kinase 4 (MKK4) subfamily, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The MKK4 subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising of the MAP
           kinase (MAPK), which is phosphorylated and activated by
           a MAPK kinase (MAPKK or MKK), which itself is
           phosphorylated and activated by a MAPK kinase kinase
           (MAPKKK or MKKK). MKK4 is a dual-specificity PK that
           phosphorylates and activates the downstream targets,
           c-Jun N-terminal kinase (JNK) and p38 MAPK, on specific
           threonine and tyrosine residues. JNK and p38 are
           collectively known as stress-activated MAPKs, as they
           are activated in response to a variety of environmental
           stresses and pro-inflammatory cytokines. Their
           activation is associated with the induction of cell
           death. Mice deficient in MKK4 die during embryogenesis
           and display anemia, severe liver hemorrhage, and
           abnormal hepatogenesis. MKK4 may also play roles in the
           immune system and in cardiac hypertrophy. It plays a
           major role in cancer as a tumor and metastasis
           suppressor. Under certain conditions, MKK4 is
           pro-oncogenic.
          Length = 288

 Score = 30.8 bits (70), Expect = 0.19
 Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 13  PYWMAPEVVLCETFRDNPYDFKVDIWS 39
           PY MAPE +       + YD + D+WS
Sbjct: 172 PY-MAPERID--PSARDGYDVRSDVWS 195


>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like
           Protein Serine/Threonine Kinases.  Serine/Threonine
           Kinases (STKs), Microtubule-associated serine/threonine
           (MAST) kinase subfamily, fungal Rim15-like kinases,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAST kinase
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this group include Saccharomyces
           cerevisiae Rim15, Schizosaccharomyces pombe cek1, and
           similar fungal proteins. They contain a central
           catalytic domain, which contains an insert relative to
           MAST kinases. In addition, Rim15 contains a C-terminal
           signal receiver (REC) domain while cek1 contains an
           N-terminal PAS domain. Rim15 (or Rim15p) functions as a
           regulator of meiosis. It acts as a downstream effector
           of PKA and regulates entry into stationary phase (G0).
           Thus, it plays a crucial role in regulating yeast
           proliferation, differentiation, and aging. Cek1 may
           facilitate progression of mitotic anaphase.
          Length = 260

 Score = 30.9 bits (70), Expect = 0.22
 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 5/31 (16%)

Query: 9   FIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           F+GTP ++APE +L         D   D WS
Sbjct: 153 FVGTPDYLAPETIL-----GVGDDKMSDWWS 178


>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like
           Protein Tyrosine Kinases.  Protein Tyrosine Kinase (PTK)
           family; Insulin Receptor (InsR) subfamily; catalytic (c)
           domain. The PTKc family is part of a larger superfamily
           that includes the catalytic domains of other kinases
           such as protein serine/threonine kinases, RIO kinases,
           and phosphoinositide 3-kinase (PI3K). The InsR subfamily
           is composed of InsR, Insulin-like Growth Factor-1
           Receptor (IGF-1R), and similar proteins. PTKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. InsR and
           IGF-1R are receptor tyr kinases (RTKs) composed of two
           alphabeta heterodimers. Binding of the ligand (insulin,
           IGF-1, or IGF-2) to the extracellular alpha subunit
           activates the intracellular tyr kinase domain of the
           transmembrane beta subunit. Receptor activation leads to
           autophosphorylation, stimulating downstream kinase
           activities, which initiate signaling cascades and
           biological function. InsR and IGF-1R, which share 84%
           sequence identity in their kinase domains, display
           physiologically distinct yet overlapping functions in
           cell growth, differentiation, and metabolism. InsR
           activation leads primarily to metabolic effects while
           IGF-1R activation stimulates mitogenic pathways. In
           cells expressing both receptors, InsR/IGF-1R hybrids are
           found together with classical receptors. Both receptors
           can interact with common adaptor molecules such as IRS-1
           and IRS-2.
          Length = 277

 Score = 30.8 bits (70), Expect = 0.24
 Identities = 10/26 (38%), Positives = 15/26 (57%), Gaps = 5/26 (19%)

Query: 15  WMAPEVVLCETFRDNPYDFKVDIWSY 40
           WMAPE     + +D  +  K D+WS+
Sbjct: 187 WMAPE-----SLKDGVFTTKSDVWSF 207


>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein
           Serine/Threonine Kinase, Protein Kinase B beta.
           Serine/Threonine Kinases (STKs), Protein Kinase B (PKB)
           or Akt subfamily, beta (or Akt2) isoform, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PKB subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. There are three
           PKB isoforms from different genes, PKB-alpha (or Akt1),
           PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB
           contains an N-terminal pleckstrin homology (PH) domain
           and a C-terminal catalytic domain. PKB-beta is the
           predominant PKB isoform expressed in insulin-responsive
           tissues. It plays a critical role in the regulation of
           glucose homeostasis. It is also implicated in muscle
           cell differentiation. Mice deficient in PKB-beta display
           normal growth weights but exhibit severe insulin
           resistance and diabetes, accompanied by lipoatrophy and
           B-cell failure.
          Length = 323

 Score = 30.7 bits (69), Expect = 0.24
 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 5/31 (16%)

Query: 8   TFIGTPYWMAPEVVLCETFRDNPYDFKVDIW 38
           TF GTP ++APEV+      DN Y   VD W
Sbjct: 154 TFCGTPEYLAPEVL-----EDNDYGRAVDWW 179


>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein
           Serine/Threonine Kinase, Protein Kinase B alpha.
           Serine/Threonine Kinases (STKs), Protein Kinase B (PKB)
           or Akt subfamily, alpha (or Akt1) isoform, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PKB subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. There are three
           PKB isoforms from different genes, PKB-alpha (or Akt1),
           PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB
           contains an N-terminal pleckstrin homology (PH) domain
           and a C-terminal catalytic domain. PKB-alpha is
           predominantly expressed in endothelial cells. It is
           critical for the regulation of angiogenesis and the
           maintenance of vascular integrity. It also plays a role
           in adipocyte differentiation. Mice deficient in
           PKB-alpha exhibit perinatal morbidity, growth
           retardation, reduction in body weight accompanied by
           reduced sizes of multiple organs, and enhanced apoptosis
           in some cell types. PKB-alpha activity has been reported
           to be frequently elevated in breast and prostate
           cancers. In some cancer cells, PKB-alpha may act as a
           suppressor of metastasis.
          Length = 325

 Score = 30.4 bits (68), Expect = 0.28
 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 5/31 (16%)

Query: 8   TFIGTPYWMAPEVVLCETFRDNPYDFKVDIW 38
           TF GTP ++APEV+      DN Y   VD W
Sbjct: 155 TFCGTPEYLAPEVL-----EDNDYGRAVDWW 180


>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, G protein-coupled Receptor
           Kinase 1.  Serine/Threonine Kinases (STKs), G
           protein-coupled Receptor Kinase (GRK) subfamily, GRK1
           isoform, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The GRK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. GRKs phosphorylate and regulate G
           protein-coupled receptors (GPCRs), the largest
           superfamily of cell surface receptors, which regulate
           some part of nearly all physiological functions.
           Phosphorylated GPCRs bind to arrestins, which prevents
           further G protein signaling despite the presence of
           activating ligand. There are seven types of GRKs, named
           GRK1 to GRK7. GRK1, also called rhodopsin kinase,
           belongs to the visual group of GRKs and is expressed in
           retinal cells. It phosphorylates rhodopsin in rod cells,
           which leads to termination of the phototransduction
           cascade. Mutations in GRK1 are associated to a
           recessively inherited form of stationary nightblindness
           called Oguchi disease.
          Length = 280

 Score = 30.2 bits (68), Expect = 0.35
 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 5/35 (14%)

Query: 5   KHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           K   + GTP +MAPE++     +   YDF VD ++
Sbjct: 153 KTKGYAGTPGFMAPELL-----QGEEYDFSVDYFA 182


>gnl|CDD|236774 PRK10839, PRK10839, 16S rRNA pseudouridylate synthase A;
           Provisional.
          Length = 232

 Score = 30.1 bits (68), Expect = 0.38
 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 4/34 (11%)

Query: 57  KELDRPVRLEASTSYEI---ISDGKYHTVE-MLA 86
           K+L +P  LE  T  ++   IS+G+YH V+ M A
Sbjct: 158 KDLTKPAVLEVITPTQVRLTISEGRYHQVKRMFA 191


>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein
           Serine/Threonine Kinase, Classical Protein Kinase C
           beta.  Serine/Threonine Kinases (STKs), Classical
           Protein Kinase C (cPKC) subfamily, beta isoforms,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The cPKC subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PKCs are
           classified into three groups (classical, atypical, and
           novel) depending on their mode of activation and the
           structural characteristics of their regulatory domain.
           PKCs undergo three phosphorylations in order to take
           mature forms. In addition, cPKCs depend on calcium, DAG
           (1,2-diacylglycerol), and in most cases,
           phosphatidylserine (PS) for activation. There are four
           cPKC isoforms, named alpha, betaI, betaII, and gamma.
           The PKC beta isoforms (I and II), generated by
           alternative splicing of a single gene, are
           preferentially activated by hyperglycemia-induced DAG in
           retinal tissues. This is implicated in diabetic
           microangiopathy such as ischemia, neovascularization,
           and abnormal vasodilator function. PKC-beta also plays
           an important role in VEGF signaling. In addition,
           glucose regulates proliferation in retinal endothelial
           cells via PKC-betaI. PKC-beta is also being explored as
           a therapeutic target in cancer. It contributes to tumor
           formation and is involved in the tumor host mechanisms
           of inflammation and angiogenesis.
          Length = 323

 Score = 30.0 bits (67), Expect = 0.38
 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 5/33 (15%)

Query: 8   TFIGTPYWMAPEVVLCETFRDNPYDFKVDIWSY 40
           TF GTP ++APE++        PY   VD W++
Sbjct: 160 TFCGTPDYIAPEII-----AYQPYGKSVDWWAF 187


>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Yank1.  Serine/Threonine
           Kinases (STKs), Yank1 or STK32A subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Yank1 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. This subfamily
           contains uncharacterized STKs with similarity to the
           human protein designated Yank1 or STK32A.
          Length = 258

 Score = 30.0 bits (68), Expect = 0.39
 Identities = 13/36 (36%), Positives = 15/36 (41%), Gaps = 5/36 (13%)

Query: 4   QKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
               +  GTP +MAPEV          Y   VD WS
Sbjct: 154 TLTTSTSGTPGYMAPEV-----LCRQGYSVAVDWWS 184


>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein
           Serine/Threonine Kinase, Protein Kinase B gamma.
           Serine/Threonine Kinases (STKs), Protein Kinase B (PKB)
           or Akt subfamily, gamma (or Akt3) isoform, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PKB subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. There are three
           PKB isoforms from different genes, PKB-alpha (or Akt1),
           PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB
           contains an N-terminal pleckstrin homology (PH) domain
           and a C-terminal catalytic domain. PKB-gamma is
           predominantly expressed in neuronal tissues. Mice
           deficient in PKB-gamma show a reduction in brain weight
           due to the decreases in cell size and cell number.
           PKB-gamma has also been shown to be upregulated in
           estrogen-deficient breast cancer cells,
           androgen-independent prostate cancer cells, and primary
           ovarian tumors. It acts as a key mediator in the genesis
           of ovarian cancer.
          Length = 328

 Score = 30.0 bits (67), Expect = 0.43
 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 5/31 (16%)

Query: 8   TFIGTPYWMAPEVVLCETFRDNPYDFKVDIW 38
           TF GTP ++APEV+      DN Y   VD W
Sbjct: 154 TFCGTPEYLAPEVL-----EDNDYGRAVDWW 179


>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine
           Kinase, Colon Carcinoma Kinase 4.  Protein Tyrosine
           Kinase (PTK) family; Colon Carcinoma Kinase 4 (CCK4);
           pseudokinase domain. The PTKc (catalytic domain) family,
           to which this subfamily belongs, includes the catalytic
           domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. CCK4,
           also called protein tyrosine kinase 7 (PTK7), is an
           orphan receptor tyr kinase (RTK) containing an
           extracellular region with seven immunoglobulin domains,
           a transmembrane segment, and an intracellular inactive
           pseudokinase domain. Studies in mice reveal that CCK4 is
           essential for neural development. Mouse embryos
           containing a truncated CCK4 die perinatally and display
           craniorachischisis, a severe form of neural tube defect.
           The mechanism of action of the CCK4 pseudokinase is
           still unknown. Other pseudokinases such as HER3 rely on
           the activity of partner RTKs.
          Length = 275

 Score = 29.7 bits (67), Expect = 0.51
 Identities = 9/26 (34%), Positives = 16/26 (61%), Gaps = 5/26 (19%)

Query: 15  WMAPEVVLCETFRDNPYDFKVDIWSY 40
           W+APE V     +++ +  K D+WS+
Sbjct: 184 WLAPEAV-----QEDDFSTKSDVWSF 204


>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, MAP/ERK kinase kinase 1.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 1
           (MEKK1) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MEKK1 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MEKK1 is a mitogen-activated protein kinase
           (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
           phosphorylates and activates MAPK kinases (MAPKKs or
           MKKs or MAP2Ks), which in turn phosphorylate and
           activate MAPKs during signaling cascades that are
           important in mediating cellular responses to
           extracellular signals. MEKK1 activates the extracellular
           signal-regulated kinase 1/2 (ERK1/2) and c-Jun
           N-terminal kinase (JNK) pathways by activating their
           respective MAPKKs, MEK1/2 and MKK4/MKK7, respectively.
           MEKK1 is important in regulating cell survival and
           apoptosis. MEKK1 also plays a role in cell migration,
           tissue maintenance and homeostasis, and wound healing.
          Length = 268

 Score = 29.4 bits (66), Expect = 0.54
 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 5/31 (16%)

Query: 9   FIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
            +GT  +MAPEV+     R   Y    D+WS
Sbjct: 168 LLGTIAFMAPEVL-----RGEQYGRSCDVWS 193


>gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein
           Kinase, MAP/ERK Kinase.  Protein kinases (PKs), MAP/ERK
           kinase (MEK) subfamily, catalytic (c) domain. PKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine or tyrosine residues on protein
           substrates. The MEK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases, protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           mitogen-activated protein (MAP) kinase signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising the MAP kinase (MAPK),
           which is phosphorylated and activated by a MAPK kinase
           (MAPKK or MKK), which itself is phosphorylated and
           activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1
           and MEK2 are dual-specificity PKs that phosphorylate and
           activate the downstream targets, ERK(extracellular
           signal-regulated kinase) 1 and ERK2, on specific
           threonine and tyrosine residues. The ERK cascade starts
           with extracellular signals including growth factors,
           hormones, and neurotransmitters, which act through
           receptors and ion channels to initiate intracellular
           signaling that leads to the activation at the MAPKKK
           (Raf-1 or MOS) level, which leads to the transmission of
           signals to MEK1/2, and finally to ERK1/2. The ERK
           cascade plays an important role in cell proliferation,
           differentiation, oncogenic transformation, and cell
           cycle control, as well as in apoptosis and cell survival
           under certain conditions. This cascade has also been
           implicated in synaptic plasticity, migration,
           morphological determination, and stress response
           immunological reactions. Gain-of-function mutations in
           genes encoding ERK cascade proteins, including MEK1/2,
           cause cardiofaciocutaneous (CFC) syndrome, a condition
           leading to multiple congenital anomalies and mental
           retardation in patients.
          Length = 308

 Score = 29.3 bits (66), Expect = 0.62
 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 5/34 (14%)

Query: 7   NTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWSY 40
           N+F+GT  +M+P     E  +   Y  + DIWS 
Sbjct: 156 NSFVGTRSYMSP-----ERLQGTHYTVQSDIWSL 184


>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase,
           c-Jun N-terminal Kinase.  Serine/Threonine Kinases
           (STKs), c-Jun N-terminal kinase (JNK) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The JNK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. JNKs are
           mitogen-activated protein kinases (MAPKs) that are
           involved in many stress-activated responses including
           those during inflammation, neurodegeneration, apoptosis,
           and persistent pain sensitization, among others. They
           are also essential regulators of physiological and
           pathological processes and are involved in the
           pathogenesis of several diseases such as diabetes,
           atherosclerosis, stroke, Parkinson's and Alzheimer's.
           Vetebrates harbor three different JNK genes (Jnk1, Jnk2,
           and Jnk3) that are alternatively spliced to produce at
           least 10 isoforms. JNKs are specifically activated by
           the MAPK kinases MKK4 and MKK7, which are in turn
           activated by upstream MAPK kinase kinases as a result of
           different stimuli including stresses such as ultraviolet
           (UV) irradiation, hyperosmolarity, heat shock, or
           cytokines. JNKs activate a large number of different
           substrates based on specific stimulus, cell type, and
           cellular condition, and may be implicated in seemingly
           contradictory functions.
          Length = 353

 Score = 29.3 bits (66), Expect = 0.73
 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 10/38 (26%)

Query: 7   NTFIGTP-----YWMAPEVVLCETFRDNPYDFKVDIWS 39
            +F+ TP     Y+ APEV+L        Y   VDIWS
Sbjct: 170 TSFMMTPYVVTRYYRAPEVIL-----GMGYKENVDIWS 202


>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ
           cell-Associated Kinase-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Male germ
           cell-Associated Kinase (MAK)-like subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAK-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of human MAK and
           MAK-related kinase (MRK), Saccharomyces cerevisiae
           Ime2p, Schizosaccharomyces pombe Mei4-dependent protein
           3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5,
           Arabidopsis thaliana MHK, and similar proteins. These
           proteins play important roles during meiosis. MAK is
           highly expressed in testicular cells specifically in the
           meiotic phase, but is not essential for spermatogenesis
           and fertility. It functions as a coactivator of the
           androgen receptor in prostate cells. MRK, also called
           Intestinal Cell Kinase (ICK), is expressed ubiquitously,
           with highest expression in the ovary and uterus. A
           missense mutation in MRK causes
           endocrine-cerebro-osteodysplasia (ECO), suggesting that
           this protein plays an important role in the development
           of many organs. MAK and MRK may be involved in
           regulating cell cycle and cell fate. Ime2p is a
           meiosis-specific kinase that is important during meiotic
           initiation and during the later stages of meiosis. Mde3
           functions downstream of the transcription factor Mei-4
           which is essential for meiotic prophase I.
          Length = 283

 Score = 29.0 bits (66), Expect = 0.77
 Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 4/31 (12%)

Query: 8   TFIGTPYWMAPEVVLCETFRDNPYDFKVDIW 38
            ++ T ++ APE++L    R   Y   VDIW
Sbjct: 157 DYVSTRWYRAPEILL----RSTSYSSPVDIW 183


>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein
           Serine/Threonine Kinase, G protein-coupled Receptor
           Kinase 4.  Serine/Threonine Kinases (STKs), G
           protein-coupled Receptor Kinase (GRK) subfamily, GRK4
           isoform, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The GRK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. GRKs phosphorylate and regulate G
           protein-coupled receptors (GPCRs), the largest
           superfamily of cell surface receptors which regulate
           some part of nearly all physiological functions.
           Phosphorylated GPCRs bind to arrestins, which prevents
           further G protein signaling despite the presence of
           activating ligand. There are seven types of GRKs, named
           GRK1 to GRK7. GRK4 has a limited tissue distribution. It
           is mainly found in the testis, but is also present in
           the cerebellum and kidney. It is expressed as multiple
           splice variants with different domain architectures. It
           is post-translationally palmitoylated and localized in
           the membrane. GRK4 polymorphisms are associated with
           hypertension and salt sensitivity, as they cause
           hyperphosphorylation, desensitization, and
           internalization of the dopamine 1 (D1) receptor while
           increasing the expression of the angiotensin II type 1
           receptor. GRK4 plays a crucial role in the D1 receptor
           regulation of sodium excretion and blood pressure.
          Length = 285

 Score = 29.2 bits (65), Expect = 0.83
 Identities = 23/83 (27%), Positives = 35/83 (42%), Gaps = 12/83 (14%)

Query: 10  IGTPYWMAPEVVLCETFRDNPYDFKVDIWSYK---KEHILKMS----WRDKAKFKELDRP 62
           +GT  +MAPEV+      +  Y F  D W       E I   S     +++ K +E+DR 
Sbjct: 162 VGTVGYMAPEVI-----NNEKYTFSPDWWGLGCLIYEMIQGQSPFRKRKERVKREEVDRR 216

Query: 63  VRLEASTSYEIISDGKYHTVEML 85
           V+ +     E  S+       ML
Sbjct: 217 VKEDQEEYSEKFSEDAKSICRML 239


>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein
           Serine/Threonine Kinase, Atypical Protein Kinase C iota.
            Serine/Threonine Kinases (STKs), Atypical Protein
           Kinase C (aPKC) subfamily, iota isoform, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The aPKC subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PKCs are
           classified into three groups (classical, atypical, and
           novel) depending on their mode of activation and the
           structural characteristics of their regulatory domain.
           aPKCs only require phosphatidylserine (PS) for
           activation. There are two aPKC isoforms, zeta and iota.
           PKC-iota is directly implicated in carcinogenesis. It is
           critical to oncogenic signaling mediated by Ras and
           Bcr-Abl. The PKC-iota gene is the target of
           tumor-specific gene amplification in many human cancers,
           and has been identified as a human oncogene. In addition
           to its role in transformed growth, PKC-iota also
           promotes invasion, chemoresistance, and tumor cell
           survival. Expression profiling of PKC-iota is a
           prognostic marker of poor clinical outcome in several
           human cancers. PKC-iota also plays a role in
           establishing cell polarity, and has critical embryonic
           functions.
          Length = 329

 Score = 28.9 bits (64), Expect = 0.89
 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 5/31 (16%)

Query: 9   FIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           F GTP ++APE++     R   Y F VD W+
Sbjct: 156 FCGTPNYIAPEIL-----RGEDYGFSVDWWA 181


>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like
           dual-specificity MAP kinase kinases.  Protein kinases
           (PKs), MAP kinase kinase (MAPKK) subfamily, fungal
           PBS2-like proteins, catalytic (c) domain. PKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MAPKK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases, protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           mitogen-activated protein (MAP) kinase signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising of the MAP kinase (MAPK),
           which is phosphorylated and activated by a MAPK kinase
           (MAPKK or MKK), which itself is phosphorylated and
           activated by a MAPK kinase kinase (MAPKKK or MKKK).
           Members of this group include the MAPKKs Polymyxin B
           resistance protein 2 (PBS2) from Saccharomyces
           cerevisiae, Wis1 from Schizosaccharomyces pombe, and
           related proteins. PBS2 and Wis1 are components of
           stress-activated MAPK cascades in budding and fission
           yeast, respectively. PBS2 is the specific activator of
           the MAPK Hog1, which plays a central role in the
           response of budding yeast to stress including exposure
           to arsenite and hyperosmotic environments. Wis1
           phosphorylates and activates the MAPK Sty1 (also called
           Spc1 or Phh1), which stimulates a transcriptional
           response to a wide range of cellular insults through the
           bZip transcription factors Atf1, Pcr1, and Pap1.
          Length = 286

 Score = 28.7 bits (64), Expect = 1.0
 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%)

Query: 8   TFIGTPYWMAPEVVLCETFRDNP-YDFKVDIWS 39
           T IG   +MAPE +       NP Y  + D+WS
Sbjct: 160 TNIGCQSYMAPERIKSGGPNQNPTYTVQSDVWS 192


>gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine
           Kinase, c-Jun N-terminal Kinase 2.  Serine/Threonine
           Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           JNK2 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. JNKs are mitogen-activated protein kinases
           (MAPKs) that are involved in many stress-activated
           responses including those during inflammation,
           neurodegeneration, apoptosis, and persistent pain
           sensitization, among others. Vetebrates harbor three
           different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like
           JNK2, is expressed in every cell and tissue type.
           Initially it was thought that JNK1 and JNK2 were
           functionally redundant as mice deficient in either genes
           (Jnk1 or Jnk2) could survive but disruption of both
           genes resulted in lethality. However, recent studies
           have shown that JNK1 and JNK2 perform distinct functions
           through specific binding partners and substrates.  JNK2
           is specifically translocated to the mitochondria during
           dopaminergic cell death. Specific substrates include the
           microtubule-associated proteins DCX and Tau, as well as
           TIF-IA which is involved in ribosomal RNA synthesis
           regulation. Mice deficient in Jnk2 show protection
           against arthritis, type 1 diabetes, atherosclerosis,
           abdominal aortic aneurysm, cardiac cell death,
           TNF-induced liver damage, and tumor growth, indicating
           that JNK2 may play roles in the pathogenesis of these
           diseases.
          Length = 359

 Score = 28.8 bits (64), Expect = 1.2
 Identities = 13/31 (41%), Positives = 20/31 (64%), Gaps = 5/31 (16%)

Query: 9   FIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           ++ T Y+ APEV+L   +++N     VDIWS
Sbjct: 182 YVVTRYYRAPEVILGMGYKEN-----VDIWS 207


>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family
           Serine/Threonine Kinases.  Serine/Threonine Kinases
           (STKs), CMGC family, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           CMGC family is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The CMGC family consists of Cyclin-Dependent
           protein Kinases (CDKs), Mitogen-activated protein
           kinases (MAPKs) such as Extracellular signal-regulated
           kinase (ERKs), c-Jun N-terminal kinases (JNKs), and p38,
           and similar proteins. CDKs belong to a large subfamily
           of STKs that are regulated by their cognate cyclins.
           Together, they are involved in the control of cell-cycle
           progression, transcription, and neuronal function. MAPKs
           serve as important mediators of cellular responses to
           extracellular signals. They control critical cellular
           functions including differentiation, proliferation,
           migration, and apoptosis. They are also implicated in
           the pathogenesis of many diseases including multiple
           types of cancer, stroke, diabetes, and chronic
           inflammation.
          Length = 283

 Score = 28.4 bits (64), Expect = 1.2
 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 4/31 (12%)

Query: 9   FIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           ++ T ++ APE++L     D  Y   VDIWS
Sbjct: 158 YVVTRWYRAPELLL----GDKGYSTPVDIWS 184


>gnl|CDD|239400 cd03126, alpha_CA_XII_XIV, Carbonic anhydrase alpha, isozymes XII
           and XIV. Carbonic anhydrases (CAs) are zinc-containing
           enzymes that catalyze the reversible hydration of carbon
           dioxide in a two-step mechanism: a nucleophilic attack
           of a zinc-bound hydroxide ion on carbon dioxide,
           followed by the regeneration of the active site by
           ionization of the zinc-bound water molecule and removal
           of a proton from the active site. They are ubiquitous
           enzymes involved in fundamental processes like
           photosynthesis, respiration, pH homeostasis and ion
           transport. There are three evolutionary distinct groups
           - alpha, beta and gamma carbonic anhydrases - which show
           no significant sequence identity or structural
           similarity. Most alpha CAs are monomeric enzymes. The
           zinc ion is complexed by three histidine residues. This
           sub-family comprises the membrane proteins CA XII and
           XIV.
          Length = 249

 Score = 28.3 bits (63), Expect = 1.3
 Identities = 13/38 (34%), Positives = 18/38 (47%)

Query: 103 ITNEGSTEHLRLHSPMYVGGVPLDPVGMEAFTHWHLRN 140
           +TN G T  L L   M++GG+P      +   HW  R 
Sbjct: 51  LTNNGHTVQLSLPPTMHIGGLPFKYTASQLHLHWGQRG 88


>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein
           Kinase Like Serine/Threonine Kinases.  Serine/Threonine
           Kinases (STKs), Cyclin-dependent protein kinase like
           (CDKL) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           CDKL subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. This subfamily is
           composed of CDKL1-5 and similar proteins. Some CDKLs,
           like CDKL1 and CDKL3, may be implicated in
           transformation and others, like CDKL3 and CDKL5, are
           associated with mental retardation when impaired. CDKL2
           plays a role in learning and memory.
          Length = 288

 Score = 28.4 bits (64), Expect = 1.4
 Identities = 9/32 (28%), Positives = 18/32 (56%), Gaps = 4/32 (12%)

Query: 8   TFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
            ++ T ++ APE+++     D  Y   VD+W+
Sbjct: 160 DYVATRWYRAPELLVG----DTNYGKPVDVWA 187


>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein
           Kinase, MAP kinase kinase 7.  Protein kinases (PKs), MAP
           kinase kinase 7 (MKK7) subfamily, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The MKK7 subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising the MAP kinase
           (MAPK), which is phosphorylated and activated by a MAPK
           kinase (MAPKK or MKK), which itself is phosphorylated
           and activated by a MAPK kinase kinase (MAPKKK or MKKK).
           MKK7 is a dual-specificity PK that phosphorylates and
           activates its downstream target, c-Jun N-terminal kinase
           (JNK), on specific threonine and tyrosine residues.
           Although MKK7 is capable of dual phosphorylation, it
           prefers to phosphorylate the threonine residue of JNK.
           Thus, optimal activation of JNK requires both MKK4 (not
           included in this subfamily) and MKK7. MKK7 is primarily
           activated by cytokines. MKK7 is essential for liver
           formation during embryogenesis. It plays roles in G2/M
           cell cycle arrest and cell growth. In addition, it is
           involved in the control of programmed cell death, which
           is crucial in oncogenesis, cancer chemoresistance, and
           antagonism to TNFalpha-induced killing, through its
           inhibition by Gadd45beta and the subsequent suppression
           of the JNK cascade.
          Length = 296

 Score = 28.5 bits (64), Expect = 1.5
 Identities = 10/29 (34%), Positives = 14/29 (48%), Gaps = 1/29 (3%)

Query: 11  GTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           G   +MAPE +         YD + D+WS
Sbjct: 176 GCAAYMAPERIDPPDPNPK-YDIRADVWS 203


>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of
           Phototropin-like Protein Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Phototropin-like
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           phototropin-like subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Included in this subfamily
           are plant phototropins and predominantly uncharacterized
           fungal STKs whose catalytic domains resemble the
           phototropin kinase domain. One protein from Neurospora
           crassa is called nrc-2. Phototropins are blue-light
           receptors that control responses such as phototropism,
           stromatal opening, and chloroplast movement in order to
           optimize the photosynthetic efficiency of plants. They
           are light-activated STKs that contain an N-terminal
           photosensory domain and a C-terminal catalytic domain.
           The N-terminal domain contains two LOV (Light, Oxygen or
           Voltage) domains that binds FMN. Photoexcitation of the
           LOV domains results in autophosphorylation at multiple
           sites and activation of the catalytic domain. Neurospora
           crassa nrc-2 plays a role in growth and development by
           controlling entry into the conidiation program.
          Length = 316

 Score = 28.0 bits (63), Expect = 1.7
 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 5/33 (15%)

Query: 7   NTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           N+F+GT  ++APEV+       + +   VD W+
Sbjct: 190 NSFVGTEEYIAPEVI-----SGDGHGSAVDWWT 217


>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled
           Receptor Kinase 4-like Protein Serine/Threonine Kinases.
            Serine/Threonine Kinases (STKs), G protein-coupled
           Receptor Kinase (GRK) subfamily, GRK4-like group,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The GRK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. GRKs
           phosphorylate and regulate G protein-coupled receptors
           (GPCRs), the largest superfamily of cell surface
           receptors which regulate some part of nearly all
           physiological functions. Phosphorylated GPCRs bind to
           arrestins, which prevents further G protein signaling
           despite the presence of activating ligand. There are
           seven types of GRKs, named GRK1 to GRK7. Members of the
           GRK4-like group include GRK4, GRK5, GRK6, and similar
           GRKs. GRKs in this group contain an N-terminal RGS
           homology (RH) domain and a catalytic domain, but lack a
           G protein betagamma-subunit binding domain. They are
           localized to the plasma membrane through
           post-translational lipid modification or direct binding
           to PIP2.
          Length = 285

 Score = 28.3 bits (63), Expect = 1.8
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 12/62 (19%)

Query: 10  IGTPYWMAPEVVLCETFRDNPYDFKVDIWSYK---KEHILKMS----WRDKAKFKELDRP 62
           +GT  +MAPEVV     ++  Y F  D W       E I   S     ++K K +E++R 
Sbjct: 162 VGTVGYMAPEVV-----KNERYTFSPDWWGLGCLIYEMIEGKSPFRQRKEKVKREEVERR 216

Query: 63  VR 64
           V+
Sbjct: 217 VK 218


>gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine
           Kinase, c-Jun N-terminal Kinase 3.  Serine/Threonine
           Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           JNK3 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. JNKs are mitogen-activated protein kinases
           (MAPKs) that are involved in many stress-activated
           responses including those during inflammation,
           neurodegeneration, apoptosis, and persistent pain
           sensitization, among others. Vetebrates harbor three
           different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is
           expressed primarily in the brain, and to a lesser extent
           in the heart and testis. Mice deficient in Jnk3 are
           protected against kainic acid-induced seizures, stroke,
           sciatic axotomy neural death, and neuronal death due to
           NGF deprivation, oxidative stress, or exposure to
           beta-amyloid peptide. This suggests that JNK3 may play
           roles in the pathogenesis of these diseases.
          Length = 355

 Score = 28.1 bits (62), Expect = 1.9
 Identities = 13/31 (41%), Positives = 20/31 (64%), Gaps = 5/31 (16%)

Query: 9   FIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           ++ T Y+ APEV+L   +++N     VDIWS
Sbjct: 178 YVVTRYYRAPEVILGMGYKEN-----VDIWS 203


>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase
           1-like Protein Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Yeast protein kinase 1
           (YPK1)-like subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The YPK1-like subfamily is part of a larger superfamily
           that includes the catalytic domains of other protein
           STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. This subfamily is composed of
           fungal proteins with similarity to the AGC STKs,
           Saccharomyces cerevisiae YPK1 and Schizosaccharomyces
           pombe Gad8p. YPK1 is required for cell growth and acts
           as a downstream kinase in the sphingolipid-mediated
           signaling pathway of yeast. It also plays a role in
           efficient endocytosis and in the maintenance of cell
           wall integrity. Gad8p is a downstream target of Tor1p,
           the fission yeast homolog of mTOR. It plays a role in
           cell growth and sexual development.
          Length = 312

 Score = 28.0 bits (62), Expect = 2.1
 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 5/35 (14%)

Query: 5   KHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           K NTF GTP ++APE++L      + Y   VD W+
Sbjct: 149 KTNTFCGTPEYLAPELLL-----GHGYTKAVDWWT 178


>gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine
           Kinase, Colony-Stimulating Factor-1 Receptor.  Protein
           Tyrosine Kinase (PTK) family; Colony-Stimulating
           Factor-1 Receptor (CSF-1R); catalytic (c) domain. The
           PTKc family is part of a larger superfamily that
           includes the catalytic domains of other kinases such as
           protein serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. CSF-1R,
           also called c-Fms, is a member of the Platelet Derived
           Growth Factor Receptor (PDGFR) subfamily of proteins,
           which are receptor tyr kinases (RTKs) containing an
           extracellular ligand-binding region with five
           immunoglobulin-like domains, a transmembrane segment,
           and an intracellular catalytic domain. The binding of
           CSF-1R to its ligand, CSF-1, leads to receptor
           dimerization, trans phosphorylation and activation, and
           intracellular signaling. CSF-1R signaling is critical in
           the regulation of macrophages and osteoclasts. It leads
           to increases in gene transcription and protein
           translation, and induces cytoskeletal remodeling. CSF-1R
           signaling leads to a variety of cellular responses
           including survival, proliferation, and differentiation
           of target cells. It plays an important role in innate
           immunity, tissue development and function, and the
           pathogenesis of some diseases including atherosclerosis
           and cancer. CSF-1R signaling is also implicated in
           mammary gland development during pregnancy and
           lactation. Aberrant CSF-1/CSF-1R expression correlates
           with tumor cell invasiveness, poor clinical prognosis,
           and bone metastasis in breast cancer. Although the
           structure of the human CSF-1R catalytic domain is known,
           it is excluded from this specific alignment model
           because it contains a deletion in its sequence.
          Length = 374

 Score = 27.9 bits (62), Expect = 2.2
 Identities = 11/26 (42%), Positives = 14/26 (53%), Gaps = 5/26 (19%)

Query: 15  WMAPEVVLCETFRDNPYDFKVDIWSY 40
           WMAPE +      D  Y  + D+WSY
Sbjct: 280 WMAPESIF-----DCVYTVQSDVWSY 300


>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent
           protein Kinase-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase (CDK)-like subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. CDKs are partly
           regulated by their subcellular localization, which
           defines substrate phosphorylation and the resulting
           specific function. CDK1, CDK2, CDK4, and CDK6 have
           well-defined functions in the cell cycle, such as the
           regulation of the early G1 phase by CDK4 or CDK6, the
           G1/S phase transition by CDK2, or the entry of mitosis
           by CDK1. They also exhibit overlapping cyclin
           specificity and functions in certain conditions.
           Knockout mice with a single CDK deleted remain viable
           with specific phenotypes, showing that some CDKs can
           compensate for each other. For example, CDK4 can
           compensate for the loss of CDK6, however, double
           knockout mice with both CDK4 and CDK6 deleted die in
           utero. CDK8 and CDK9 are mainly involved in
           transcription while CDK5 is implicated in neuronal
           function. CDK7 plays essential roles in both the cell
           cycle as a CDK-Activating Kinase (CAK) and in
           transcription as a component of the general
           transcription factor TFIIH.
          Length = 282

 Score = 27.8 bits (63), Expect = 2.2
 Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 4/28 (14%)

Query: 12  TPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           T ++ APE++L        Y   VDIWS
Sbjct: 161 TLWYRAPEILLGSKH----YSTAVDIWS 184


>gnl|CDD|133235 cd05104, PTKc_Kit, Catalytic domain of the Protein Tyrosine Kinase,
           Kit.  Protein Tyrosine Kinase (PTK) family; Kit (or
           c-Kit); catalytic (c) domain. The PTKc family is part of
           a larger superfamily that includes the catalytic domains
           of other kinases such as protein serine/threonine
           kinases, RIO kinases, and phosphoinositide 3-kinase
           (PI3K). PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. Kit is a member of the
           Platelet Derived Growth Factor Receptor (PDGFR)
           subfamily of proteins, which are receptor tyr kinases
           (RTKs) containing an extracellular ligand-binding region
           with five immunoglobulin-like domains, a transmembrane
           segment, and an intracellular catalytic domain. The
           binding of Kit to its ligand, the stem-cell factor
           (SCF), leads to receptor dimerization, trans
           phosphorylation and activation, and intracellular
           signaling. Kit is important in the development of
           melanocytes, germ cells, mast cells, hematopoietic stem
           cells, the interstitial cells of Cajal, and the
           pacemaker cells of the GI tract. Kit signaling is
           involved in major cellular functions including cell
           survival, proliferation, differentiation, adhesion, and
           chemotaxis. Mutations in Kit, which result in
           constitutive ligand-independent activation, are found in
           human cancers such as gastrointestinal stromal tumor
           (GIST) and testicular germ cell tumor (TGCT). The
           aberrant expression of Kit and/or SCF is associated with
           other tumor types such as systemic mastocytosis and
           cancers of the breast, neurons, lung, prostate, colon,
           and rectum.  Although the structure of the human Kit
           catalytic domain is known, it is excluded from this
           specific alignment model because it contains a deletion
           in its sequence.
          Length = 375

 Score = 27.5 bits (61), Expect = 2.9
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 5/26 (19%)

Query: 15  WMAPEVVLCETFRDNPYDFKVDIWSY 40
           WMAPE +      +  Y F+ D+WSY
Sbjct: 282 WMAPESIF-----NCVYTFESDVWSY 302


>gnl|CDD|173653 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the Protein Tyrosine
           Kinase, Platelet Derived Growth Factor Receptor alpha.
           Protein Tyrosine Kinase (PTK) family; Platelet Derived
           Growth Factor Receptor (PDGFR) alpha; catalytic (c)
           domain. The PTKc family is part of a larger superfamily
           that includes the catalytic domains of other kinases
           such as protein serine/threonine kinases, RIO kinases,
           and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. PDGFR
           alpha is a receptor tyr kinase (RTK) containing an
           extracellular ligand-binding region with five
           immunoglobulin-like domains, a transmembrane segment,
           and an intracellular catalytic domain. The binding to
           its ligands, the PDGFs, leads to receptor dimerization,
           trans phosphorylation and activation, and intracellular
           signaling. PDGFR alpha forms homodimers or heterodimers
           with PDGFR beta, depending on the nature of the PDGF
           ligand. PDGF-AA, PDGF-AB, and PDGF-CC induce PDGFR alpha
           homodimerization. PDGFR signaling plays many roles in
           normal embryonic development and adult physiology. PDGFR
           alpha signaling is important in the formation of lung
           alveoli, intestinal villi, mesenchymal dermis, and hair
           follicles, as well as in the development of
           oligodendrocytes, retinal astrocytes, neural crest
           cells, and testicular cells. Aberrant PDGFR alpha
           expression is associated with some human cancers.
           Mutations in PDGFR alpha have been found within a subset
           of gastrointestinal stromal tumors (GISTs). An active
           fusion protein FIP1L1-PDGFR alpha, derived from
           interstitial deletion, is associated with idiopathic
           hypereosinophilic syndrome (HES) and chronic
           eosinophilic leukemia (CEL).
          Length = 400

 Score = 27.7 bits (61), Expect = 3.0
 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 6/38 (15%)

Query: 3   LQKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWSY 40
           + K +TF+    WMAPE +      DN Y    D+WSY
Sbjct: 294 VSKGSTFLPVK-WMAPESIF-----DNLYTTLSDVWSY 325


>gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein
           Kinase, MAP/ERK Kinase 2.  Protein kinases (PKs),
           MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The MEK subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising the MAP kinase
           (MAPK), which is phosphorylated and activated by a MAPK
           kinase (MAPKK or MKK), which itself is phosphorylated
           and activated by a MAPK kinase kinase (MAPKKK or MKKK).
           MEK2 is a dual-specificity PK that phosphorylates and
           activates the downstream targets, extracellular
           signal-regulated kinase (ERK) 1 and ERK2, on specific
           threonine and tyrosine residues. The ERK cascade starts
           with extracellular signals including growth factors,
           hormones, and neurotransmitters, which act through
           receptors and ion channels to initiate intracellular
           signaling that leads to the activation at the MAPKKK
           (Raf-1 or MOS) level, which leads to the transmission of
           signals to MEK2, and finally to ERK1/2. The ERK cascade
           plays an important role in cell proliferation,
           differentiation, oncogenic transformation, and cell
           cycle control, as well as in apoptosis and cell survival
           under certain conditions. Gain-of-function mutations in
           genes encoding  ERK cascade proteins, including MEK2,
           cause cardiofaciocutaneous (CFC) syndrome, a condition
           leading to multiple congenital anomalies and mental
           retardation in patients.
          Length = 331

 Score = 27.3 bits (60), Expect = 3.1
 Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 5/33 (15%)

Query: 7   NTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           N+F+GT  +M+P     E  +   Y  + DIWS
Sbjct: 160 NSFVGTRSYMSP-----ERLQGTHYSVQSDIWS 187


>gnl|CDD|132883 cd07062, Peptidase_S66_mccF_like, Microcin C7 self-immunity protein
           determines resistance to exogenous microcin C7.
           Microcin C7 self-immunity protein (mccF): MccF, a
           homolog of the LD-carboxypeptidase family, mediates
           resistance against exogenously added microcin C7
           (MccC7), a ribosomally-encoded peptide antibiotic that
           contains a phosphoramidate linkage to adenosine
           monophosphate at its C-terminus. The plasmid-encoded
           mccF gene is transcribed in the opposite direction to
           the other five genes (mccA-E) and is required for the
           full expression of immunity but not for production. The
           catalytic triad residues (Ser, His, Glu) of
           LD-carboxypeptidase are also conserved in MccF, strongly
           suggesting that MccF shares the hydrolytic activity with
           LD-carboxypeptidases. Substrates of MccF have not been
           deduced, but could likely be microcin C7 precursors. The
           possible role of MccF is to defend producer cells
           against exogenous microcin from re-entering after having
           been exported.  It is suggested that MccF is involved in
           microcin degradation or sequestration in the periplasm.
          Length = 308

 Score = 27.1 bits (61), Expect = 3.1
 Identities = 8/37 (21%), Positives = 15/37 (40%), Gaps = 5/37 (13%)

Query: 10  IGTPYW-----MAPEVVLCETFRDNPYDFKVDIWSYK 41
            GTPY      +  +++  ET   +P   +  +   K
Sbjct: 206 AGTPYMPDPYKLEGKILFLETSELSPATVERALRQLK 242


>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein
           Serine/Threonine Kinase, Mitogen and stress-activated
           kinase.  Serine/Threonine Kinases (STKs), Mitogen and
           stress-activated kinase (MSK) subfamily, N-terminal
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MSK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. MSKs contain an
           N-terminal kinase domain (NTD) from the AGC family and a
           C-terminal kinase domain (CTD) from the CAMK family,
           similar to 90 kDa ribosomal protein S6 kinases (RSKs).
           MSKs are activated by two major signaling cascades, the
           Ras-MAPK and p38 stress kinase pathways, in response to
           various stimuli such as growth factors, hormones,
           neurotransmitters, cellular stress, and pro-inflammatory
           cytokines. This triggers phosphorylation in the
           activation loop (A-loop) of the CTD of MSK. The active
           CTD phosphorylates the hydrophobic motif (HM) in the
           C-terminal extension of NTD, which facilitates the
           phosphorylation of the A-loop and activates the NTD,
           which in turn phosphorylates downstream targets. MSKs
           are predominantly nuclear proteins. They are widely
           expressed in many tissues including heart, brain, lung,
           liver, kidney, and pancreas. There are two isoforms of
           MSK, called MSK1 and MSK2.
          Length = 288

 Score = 27.1 bits (60), Expect = 3.3
 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 3/38 (7%)

Query: 2   TLQKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
             ++  +F GT  +MAPEV+         +D  VD WS
Sbjct: 159 EEERAYSFCGTIEYMAPEVI---RGGSGGHDKAVDWWS 193


>gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein
           Kinase, MAP/ERK Kinase 1.  Protein kinases (PKs),
           MAP/ERK kinase (MEK) 1 subfamily, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The MEK subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising the MAP kinase
           (MAPK), which is phosphorylated and activated by a MAPK
           kinase (MAPKK or MKK), which itself is phosphorylated
           and activated by a MAPK kinase kinase (MAPKKK or MKKK).
           MEK1 is a dual-specificity PK that phosphorylates and
           activates the downstream targets, extracellular
           signal-regulated kinase (ERK) 1 and ERK2, on specific
           threonine and tyrosine residues. The ERK cascade starts
           with extracellular signals including growth factors,
           hormones, and neurotransmitters, which act through
           receptors and ion channels to initiate intracellular
           signaling that leads to the activation at the MAPKKK
           (Raf-1 or MOS) level, which leads to the transmission of
           signals to MEK1, and finally to ERK1/2. The ERK cascade
           plays an important role in cell proliferation,
           differentiation, oncogenic transformation, and cell
           cycle control, as well as in apoptosis and cell survival
           under certain conditions. Gain-of-function mutations in
           genes encoding ERK cascade proteins, including MEK1,
           cause cardiofaciocutaneous (CFC) syndrome, a condition
           leading to multiple congenital anomalies and mental
           retardation in patients. MEK1 also plays a role in cell
           cycle control.
          Length = 333

 Score = 27.3 bits (60), Expect = 3.5
 Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 5/33 (15%)

Query: 7   NTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           N+F+GT  +M+P     E  +   Y  + DIWS
Sbjct: 160 NSFVGTRSYMSP-----ERLQGTHYSVQSDIWS 187


>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein
           Kinase, MAP kinase kinase 5.  Protein kinases (PKs), MAP
           kinase kinase 5 (MKK5) subfamily, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The MKK5 subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising of the MAP
           kinase (MAPK), which is phosphorylated and activated by
           a MAPK kinase (MAPKK or MKK), which itself is
           phosphorylated and activated by a MAPK kinase kinase
           (MAPKKK or MKKK). MKK5, also referred to as MEK5, is a
           dual-specificity PK that phosphorylates its downstream
           target, extracellular signal-regulated kinase 5 (ERK5),
           on specific threonine and tyrosine residues. MKK5 is
           activated by MEKK2 and MEKK3 in response to mitogenic
           and stress stimuli. The ERK5 cascade promotes cell
           proliferation, differentiation, neuronal survival, and
           neuroprotection. This cascade plays an essential role in
           heart development. Mice deficient in either ERK5 or MKK5
           die around embryonic day 10 due to cardiovascular
           defects including underdevelopment of the myocardium. In
           addition, MKK5 is associated with metastasis and
           unfavorable prognosis in prostate cancer.
          Length = 279

 Score = 27.2 bits (60), Expect = 3.6
 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 5/32 (15%)

Query: 8   TFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           T++GT  +MAPE +  E      Y    D+WS
Sbjct: 152 TYVGTNAYMAPERISGEQ-----YGIHSDVWS 178


>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein
           Serine/Threonine Kinase, 90 kDa ribosomal protein S6
           kinase.  Serine/Threonine Kinases (STKs), 90 kDa
           ribosomal protein S6 kinase (RSK) subfamily, N-terminal
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The RSK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. RSKs contain an
           N-terminal kinase domain (NTD) from the AGC family and a
           C-terminal kinase domain (CTD) from the CAMK family.
           They are activated by signaling inputs from
           extracellular regulated kinase (ERK) and
           phosphoinositide dependent kinase 1 (PDK1). ERK
           phosphorylates and activates the CTD of RSK, serving as
           a docking site for PDK1, which phosphorylates and
           activates the NTD, which in turn phosphorylates all
           known RSK substrates. RSKs act as downstream effectors
           of mitogen-activated protein kinase (MAPK) and play key
           roles in mitogen-activated cell growth, differentiation,
           and survival. Mammals possess four RSK isoforms (RSK1-4)
           from distinct genes. RSK proteins are also referred to
           as MAP kinase-activated protein kinases (MAPKAPKs),
           p90-RSKs, or p90S6Ks.
          Length = 318

 Score = 27.1 bits (60), Expect = 3.7
 Identities = 13/37 (35%), Positives = 18/37 (48%), Gaps = 5/37 (13%)

Query: 4   QKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWSY 40
           +K  +F GT  +MAPEVV         +    D WS+
Sbjct: 153 KKAYSFCGTVEYMAPEVV-----NRRGHTQSADWWSF 184


>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine
           Kinase, c-Jun N-terminal Kinase 1.  Serine/Threonine
           Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           JNK1 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. JNKs are mitogen-activated protein kinases
           (MAPKs) that are involved in many stress-activated
           responses including those during inflammation,
           neurodegeneration, apoptosis, and persistent pain
           sensitization, among others. Vetebrates harbor three
           different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like
           JNK2, is expressed in every cell and tissue type.
           Initially it was thought that JNK1 and JNK2 were
           functionally redundant as mice deficient in either genes
           (Jnk1 or Jnk2) could survive but disruption of both
           genes resulted in lethality. However, recent studies
           have shown that JNK1 and JNK2 perform distinct functions
           through specific binding partners and substrates. JNK1
           specifically binds with JAMP (JNK1-associated membrane
           protein), which regulates the duration of JNK1 activity
           in response to stimuli. Specific JNK1 substrates include
           Itch and SG10, which are implicated in Th2 responses and
           airway inflammation, and microtubule dynamics and
           axodendritic length, respectively. Mice deficient in
           Jnk1 are protected against arthritis, obesity, type 2
           diabetes, cardiac cell death, and non-alcoholic liver
           disease, suggesting that JNK1 may play roles in the
           pathogenesis of these diseases.
          Length = 364

 Score = 26.9 bits (59), Expect = 4.0
 Identities = 13/31 (41%), Positives = 20/31 (64%), Gaps = 5/31 (16%)

Query: 9   FIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           ++ T Y+ APEV+L   +++N     VDIWS
Sbjct: 185 YVVTRYYRAPEVILGMGYKEN-----VDIWS 210


>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine
           Kinase, Mitogen-Activated Protein Kinase.
           Serine/Threonine Kinases (STKs), Mitogen-Activated
           Protein Kinase (MAPK) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The MAPK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. MAPKs serve as important
           mediators of cellular responses to extracellular
           signals. They control critical cellular functions
           including differentiation, proliferation, migration, and
           apoptosis. They are also implicated in the pathogenesis
           of many diseases including multiple types of cancer,
           stroke, diabetes, and chronic inflammation. Typical MAPK
           pathways involve a triple kinase core cascade comprising
           of the MAPK, which is phosphorylated and activated by a
           MAPK kinase (MAP2K or MKK), which itself is
           phosphorylated and activated by a MAPK kinase kinase
           (MAP3K or MKKK). Each cascade is activated either by a
           small GTP-binding protein or by an adaptor protein,
           which transmits the signal either directly to a MAP3K to
           start the triple kinase core cascade or indirectly
           through a mediator kinase, a MAP4K. There are three main
           typical MAPK subfamilies: Extracellular signal-Regulated
           Kinase (ERK), c-Jun N-terminal Kinase (JNK), and p38.
           Some MAPKs are atypical in that they are not regulated
           by MAP2Ks. These include MAPK4, MAPK6, NLK, and ERK7.
          Length = 330

 Score = 26.7 bits (60), Expect = 4.9
 Identities = 10/28 (35%), Positives = 16/28 (57%), Gaps = 4/28 (14%)

Query: 12  TPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           T ++ APE++L      + Y   +DIWS
Sbjct: 169 TRWYRAPELLLS----SSRYTKAIDIWS 192


>gnl|CDD|182065 PRK09764, PRK09764, DNA-binding transcriptional repressor MngR;
           Provisional.
          Length = 240

 Score = 26.7 bits (59), Expect = 5.2
 Identities = 13/67 (19%), Positives = 27/67 (40%), Gaps = 5/67 (7%)

Query: 19  EVVLCETFRDNPYDFKVD--IWSYKKEHILKMSWRDKAKFKELDRPVRLEASTSYEIISD 76
           EV+  + F            +W  K+    K   +     +E   P+ L    +++++ +
Sbjct: 103 EVIPADDFLQQQLQITAQDRVWHVKRVRYRK---QKPMALEETWMPLALFPDLTWQVMEN 159

Query: 77  GKYHTVE 83
            KYH +E
Sbjct: 160 SKYHFIE 166


>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein
           Serine/Threonine Kinase, Microtubule-associated
           serine/threonine-like kinase.  Serine/Threonine Kinases
           (STKs), Microtubule-associated serine/threonine (MAST)
           kinase subfamily, MAST-like (MASTL) kinases, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAST kinase
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MAST kinases contain an N-terminal domain of
           unknown function, a central catalytic domain, and a
           C-terminal PDZ domain that mediates protein-protein
           interactions. The MASTL kinases in this group carry only
           a catalytic domain, which contains a long insertion
           relative to MAST kinases. The human MASTL gene has also
           been labelled FLJ14813. A missense mutation in FLJ14813
           is associated with autosomal dominant thrombocytopenia.
           To date, the function of MASTL is unknown.
          Length = 669

 Score = 26.8 bits (59), Expect = 5.5
 Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 5/34 (14%)

Query: 6   HNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
               +GTP ++APE++L       P+   VD W+
Sbjct: 537 GERILGTPDYLAPELLL-----GKPHGPAVDWWA 565


>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity
           Protein Kinases, MAP kinase kinases 3 and 6.  Protein
           kinases (PKs), MAP kinase kinase 3 (MKK3) and MKK6
           subfamily, catalytic (c) domain. PKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MKK3 and MKK6 subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising the MAP kinase
           (MAPK), which is phosphorylated and activated by a MAPK
           kinase (MAPKK or MKK), which itself is phosphorylated
           and activated by a MAPK kinase kinase (MAPKKK or MKKK).
           MKK3 and MKK6 are dual-specificity PKs that
           phosphorylate and activate their downstream target, p38
           MAPK, on specific threonine and tyrosine residues.
           MKK3/6 plays roles in the regulation of cell cycle
           progression, cytokine- and stress-induced apoptosis,
           oncogenic transformation, and adult tissue regeneration.
           In addition, MKK6 plays a critical role in osteoclast
           survival in inflammatory disease while MKK3 is
           associated with tumor invasion, progression, and poor
           patient survival in glioma.
          Length = 283

 Score = 26.6 bits (59), Expect = 6.2
 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 14/33 (42%)

Query: 13  PYWMAPEVVLCETFRDNP------YDFKVDIWS 39
           PY MAPE       R NP      YD K D+WS
Sbjct: 168 PY-MAPE-------RINPELNQKGYDVKSDVWS 192


>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine
           Kinase, Apoptosis signal-regulating kinase.
           Serine/threonine kinases (STKs), Apoptosis
           signal-regulating kinase (ASK) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The ASK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Subfamily members
           are mitogen-activated protein kinase (MAPK) kinase
           kinases (MAPKKKs or MKKKs or MAP3Ks) and include ASK1,
           ASK2, and MAPKKK15. MAPKKKs phosphorylate and activate
           MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn
           phosphorylate and activate MAPKs during signaling
           cascades that are important in mediating cellular
           responses to extracellular signals. ASK1 (also called
           MAPKKK5) functions in the c-Jun N-terminal kinase (JNK)
           and p38 MAPK signaling pathways by directly activating
           their respective MAPKKs, MKK4/MKK7 and MKK3/MKK6. It
           plays important roles in cytokine and stress responses,
           as well as in reactive oxygen species (ROS)-mediated
           cellular responses. ASK1 is implicated in various
           diseases mediated by oxidative stress including
           inschemic heart disease, hypertension, vessel injury,
           brain ischemia, Fanconi anemia, asthma, and pulmonary
           edema, among others. ASK2 (also called MAPKKK6)
           functions only in a heteromeric complex with ASK1, and
           can activate ASK1 by direct phosphorylation. The
           function of MAPKKK15 is still unknown.
          Length = 268

 Score = 26.3 bits (58), Expect = 6.7
 Identities = 22/58 (37%), Positives = 27/58 (46%), Gaps = 11/58 (18%)

Query: 8   TFIGTPYWMAPEVVLCETFRDN---PYDFKVDIWSYKKEHILKMSWRDKAKFKELDRP 62
           TF GT  +MAPEV+      D     Y    DIWS     I++M+   K  F EL  P
Sbjct: 168 TFTGTLQYMAPEVI------DKGPRGYGAPADIWSLGCT-IVEMA-TGKPPFIELGEP 217


>gnl|CDD|131471 TIGR02418, acolac_catab, acetolactate synthase, catabolic.
           Acetolactate synthase (EC 2.2.1.6) combines two
           molecules of pyruvate to yield 2-acetolactate with the
           release of CO2. This reaction may be involved in either
           valine biosynthesis (biosynthetic) or conversion of
           pyruvate to acetoin and possibly to 2,3-butanediol
           (catabolic). The biosynthetic type, described by
           TIGR00118, is also capable of forming
           acetohydroxybutyrate from pyruvate and 2-oxobutyrate for
           isoleucine biosynthesis. The family described here, part
           of the same larger family of thiamine
           pyrophosphate-dependent enzymes (pfam00205, pfam02776)
           is the catabolic form, generally found associated with
           in species with acetolactate decarboxylase and usually
           found in the same operon. The model may not encompass
           all catabolic acetolactate synthases, but rather one
           particular clade in the larger TPP-dependent enzyme
           family [Energy metabolism, Fermentation].
          Length = 539

 Score = 26.6 bits (59), Expect = 6.7
 Identities = 10/27 (37%), Positives = 16/27 (59%)

Query: 58  ELDRPVRLEASTSYEIISDGKYHTVEM 84
           EL+  VRL+ +  + I +D  Y+ VE 
Sbjct: 444 ELETAVRLKLNIVHIIWNDNGYNMVEF 470


>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein
           Serine/Threonine Kinase, Rho-associated coiled-coil
           containing protein kinase.  Serine/Threonine Kinases
           (STKs), Rho-associated coiled-coil containing protein
           kinase (ROCK) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The ROCK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. ROCK is also referred to as Rho-associated
           kinase or simply as Rho kinase. It contains an
           N-terminal extension, a catalytic kinase domain, and a
           long C-terminal extension, which contains a coiled-coil
           region encompassing a Rho-binding domain (RBD) and a
           pleckstrin homology (PH) domain. ROCK is auto-inhibited
           by the RBD and PH domain interacting with the catalytic
           domain. It is activated via interaction with Rho GTPases
           and is involved in many cellular functions including
           contraction, adhesion, migration, motility,
           proliferation, and apoptosis. The ROCK subfamily
           consists of two isoforms, ROCK1 and ROCK2, which may be
           functionally redundant in some systems, but exhibit
           different tissue distributions. Both isoforms are
           ubiquitously expressed in most tissues, but ROCK2 is
           more prominent in brain and skeletal muscle while ROCK1
           is more pronounced in the liver, testes, and kidney.
           Studies in knockout mice result in different phenotypes,
           suggesting that the two isoforms do not compensate for
           each other during embryonic development.
          Length = 370

 Score = 26.3 bits (58), Expect = 7.5
 Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 7   NTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           +T +GTP +++PEV+  +   D  Y  + D WS
Sbjct: 201 DTAVGTPDYISPEVLKSQG-GDGYYGRECDWWS 232


>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein
           Serine/Threonine Kinase, G protein-coupled Receptor
           Kinase 6.  Serine/Threonine Kinases (STKs), G
           protein-coupled Receptor Kinase (GRK) subfamily, GRK6
           isoform, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The GRK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. GRKs phosphorylate and regulate G
           protein-coupled receptors (GPCRs), the largest
           superfamily of cell surface receptors which regulate
           some part of nearly all physiological functions.
           Phosphorylated GPCRs bind to arrestins, which prevents
           further G protein signaling despite the presence of
           activating ligand. There are seven types of GRKs, named
           GRK1 to GRK7. GRK6 is widely expressed in many tissues.
           t is expressed as multiple splice variants with
           different domain architectures. It is
           post-translationally palmitoylated and localized in the
           membrane. GRK6 plays important roles in the regulation
           of dopamine, M3 muscarinic, opioid, and chemokine
           receptor signaling. It also plays maladaptive roles in
           addiction and Parkinson's disease. GRK6-deficient mice
           exhibit altered dopamine receptor regulation, decreased
           lymphocyte chemotaxis, and increased acute inflammation
           and neutrophil chemotaxis.
          Length = 285

 Score = 26.1 bits (57), Expect = 8.1
 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 5/30 (16%)

Query: 10  IGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
           +GT  +MAPEVV     ++  Y F  D W+
Sbjct: 162 VGTVGYMAPEVV-----KNERYTFSPDWWA 186


>gnl|CDD|227560 COG5235, RFA2, Single-stranded DNA-binding replication protein A
           (RPA), medium (30 kD) subunit [DNA replication,
           recombination, and repair].
          Length = 258

 Score = 26.1 bits (57), Expect = 8.3
 Identities = 12/67 (17%), Positives = 24/67 (35%)

Query: 79  YHTVEMLAIGKTFTLRVDHGNSRSITNEGSTEHLRLHSPMYVGGVPLDPVGMEAFTHWHL 138
           YH +E +     +T ++       + N+G +   +L +    G   L    +E +     
Sbjct: 151 YHFLECIYQHLFYTRQLQRPLEEEVKNDGQSLFAKLDNDTSSGSSRLQEDILECYRRNQD 210

Query: 139 RNLTSFN 145
            N    N
Sbjct: 211 ENGLHIN 217


>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase,
           MAPK/MAK/MRK Overlapping Kinase.  Serine/Threonine
           Kinases (STKs), MAPK/MAK/MRK Overlapping Kinase (MOK)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The MOK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MOK, also called Renal tumor antigen 1
           (RAGE-1), is widely expressed and is enriched in testis,
           kidney, lung, and brain. It is expressed in
           approximately 50% of renal cell carcinomas (RCC) and is
           a potential target for immunotherapy. MOK is stabilized
           by its association with the HSP90 molecular chaperone.
           It is induced by the transcription factor Cdx2 and may
           be involved in regulating intestinal epithelial
           development and differentiation.
          Length = 282

 Score = 26.1 bits (58), Expect = 9.2
 Identities = 11/36 (30%), Positives = 20/36 (55%), Gaps = 4/36 (11%)

Query: 4   QKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWS 39
             +  +I T ++ APE +L + +    Y  K+DIW+
Sbjct: 153 PPYTEYISTRWYRAPECLLTDGY----YGPKMDIWA 184


>gnl|CDD|213364 cd12830, MtCorA-like, Mycobacterium tuberculosis CorA-like
           subfamily.  This bacterial subfamily belongs to the
           Thermotoga maritima CorA (TmCorA)-like family of the MIT
           superfamily of essential membrane proteins involved in
           transporting divalent cations (uptake or efflux) across
           membranes. This subfamily includes the Mg2+ transporter
           Mycobacterium tuberculosis CorA (which also transports
           Co2+). Thermotoga maritima CorA forms funnel-shaped
           homopentamers, the tip of the funnel is formed from two
           C-terminal transmembrane (TM) helices from each monomer,
           and the large opening of the funnel from the N-terminal
           cytoplasmic domains. The GMN signature motif of the MIT
           superfamily occurs just after TM1, mutation within this
           motif is known to abolish Mg2+ transport by a related
           protein, Saccharomyces cerevisiae Alr1p. Natural
           variants in this signature sequence may be associated
           with the transport of different divalent cations. The
           functional diversity of the MIT superfamily may also be
           due to minor structural differences regulating gating,
           substrate selection, and transport.
          Length = 292

 Score = 25.9 bits (58), Expect = 9.6
 Identities = 16/65 (24%), Positives = 23/65 (35%), Gaps = 12/65 (18%)

Query: 61  RPVRLEASTSYEIISDGKYHTVEMLAIGKTFTLRVDHGNSRSITN-----EGSTEHLRLH 115
           R  R    T  E +  G+ H    + +G  F + V HG +  +       E   E L   
Sbjct: 53  RTARYVDHT--EEVETGETH----VFVGPDFVVTVRHGAAGPLARVRARLEADPELLA-L 105

Query: 116 SPMYV 120
            P  V
Sbjct: 106 GPDAV 110


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.321    0.136    0.430 

Gapped
Lambda     K      H
   0.267   0.0685    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 7,685,661
Number of extensions: 672909
Number of successful extensions: 712
Number of sequences better than 10.0: 1
Number of HSP's gapped: 633
Number of HSP's successfully gapped: 172
Length of query: 149
Length of database: 10,937,602
Length adjustment: 88
Effective length of query: 61
Effective length of database: 7,034,450
Effective search space: 429101450
Effective search space used: 429101450
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (24.7 bits)