Diaphorina citri psyllid: psy15409


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MTLQKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWSYKKEHILKMSWRDKAKFKELDRPVRLEASTSYEIISDGKYHTVEMLAIGKTFTLRVDHGNSRSITNEGSTEHLRLHSPMYVGGVPLDPVGMEAFTHWHLRNLTSFNGTFL
ccccccccccccccccccCEEEEcccccccccCEEEEEccccHHHHHHHHccccccccccccccccccccccccccccccEEEEEEEcccEEEEEccccccccccccccccccccccEEEccccccccHHHHHHHcccccccccccccc
****KHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWSYKKEHILKMSWRDKAKFKELDRPVRLEASTSYEIISDGKYHTVEMLAIGKTFTLRVDHGN***********HLRLHSPMYVGGVPLDPVGMEAFTHWHLRNLTSFNGTFL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLQKHNTFIGTPYWMAPEVVLCETFRDNPYDFKVDIWSYKKEHILKMSWRDKAKFKELDRPVRLEASTSYEIISDGKYHTVEMLAIGKTFTLRVDHGNSRSITNEGSTEHLRLHSPMYVGGVPLDPVGMEAFTHWHLRNLTSFNGTFL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein slit A short-range repellent, controlling axon crossing of the midline and a long-range chemorepellent, controlling mesoderm migration and patterning away from the midline. May interact with extracellular matrix molecules. Repulsive ligand for the guidance receptor roundabout (robo) and prevents inappropriate midline crossing by Robo-expressing axons.confidentP24014

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044421 [CC]extracellular region partprobableGO:0005575, GO:0005576
GO:0040012 [BP]regulation of locomotionprobableGO:0008150, GO:0065007, GO:0050789
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:2000026 [BP]regulation of multicellular organismal developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0051270 [BP]regulation of cellular component movementprobableGO:0008150, GO:0032879, GO:0065007, GO:0050789, GO:0050794
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0071666 [CC]Slit-Robo signaling complexprobableGO:0005575, GO:0032991, GO:0032992
GO:0031012 [CC]extracellular matrixprobableGO:0005575
GO:0021834 [BP]chemorepulsion involved in embryonic olfactory bulb interneuron precursor migrationprobableGO:0021537, GO:0032502, GO:0044707, GO:0021826, GO:0030154, GO:0048468, GO:0006928, GO:0021988, GO:0051674, GO:0021885, GO:0021889, GO:0007275, GO:0044699, GO:0007417, GO:0051179, GO:0042330, GO:0048869, GO:0021891, GO:0048513, GO:0021879, GO:0030900, GO:0016477, GO:0021872, GO:0021953, GO:0048666, GO:0021831, GO:0006935, GO:0030182, GO:0032501, GO:0009987, GO:0048731, GO:0044767, GO:0008150, GO:0021772, GO:0050919, GO:0042221, GO:0022008, GO:0022028, GO:0022029, GO:0040011, GO:0048699, GO:0007420, GO:0009605, GO:0048870, GO:0050896, GO:0048856, GO:0007399, GO:0021843, GO:0044763
GO:0008201 [MF]heparin bindingprobableGO:0043168, GO:1901681, GO:0097367, GO:0043167, GO:0005539, GO:0003674, GO:0005488
GO:0048846 [BP]axon extension involved in axon guidanceprobableGO:0048675, GO:0048666, GO:0044707, GO:0048589, GO:0048588, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007411, GO:0009653, GO:0007275, GO:0044699, GO:0000902, GO:0000904, GO:0016049, GO:0040007, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0060560, GO:0032502, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0032990, GO:0040011, GO:0048699, GO:0048858, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J7T, chain A
Confidence level:very confident
Coverage over the Query: 10-127
View the alignment between query and template
View the model in PyMOL
Template: 2R1B, chain A
Confidence level:probable
Coverage over the Query: 68-104,122-147
View the alignment between query and template
View the model in PyMOL