BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy15410
         (87 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2QGY|A Chain A, Crystal Structure Of An Enolase From The Environmental
           Genome Shotgun Sequencing Of The Sargasso Sea
 pdb|2QGY|B Chain B, Crystal Structure Of An Enolase From The Environmental
           Genome Shotgun Sequencing Of The Sargasso Sea
          Length = 391

 Score = 25.8 bits (55), Expect = 5.6,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 22/35 (62%), Gaps = 3/35 (8%)

Query: 29  KYIEKVQITSGDELELLI---IPEGVVPVLQFLKD 60
           +++EKV+   GDEL L++   +PE +     FLK+
Sbjct: 182 QFVEKVREIVGDELPLMLDLAVPEDLDQTKSFLKE 216


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.141    0.410 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,748,745
Number of Sequences: 62578
Number of extensions: 101326
Number of successful extensions: 270
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 270
Number of HSP's gapped (non-prelim): 3
length of query: 87
length of database: 14,973,337
effective HSP length: 55
effective length of query: 32
effective length of database: 11,531,547
effective search space: 369009504
effective search space used: 369009504
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 45 (21.9 bits)