BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy15410
(87 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2QGY|A Chain A, Crystal Structure Of An Enolase From The Environmental
Genome Shotgun Sequencing Of The Sargasso Sea
pdb|2QGY|B Chain B, Crystal Structure Of An Enolase From The Environmental
Genome Shotgun Sequencing Of The Sargasso Sea
Length = 391
Score = 25.8 bits (55), Expect = 5.6, Method: Composition-based stats.
Identities = 13/35 (37%), Positives = 22/35 (62%), Gaps = 3/35 (8%)
Query: 29 KYIEKVQITSGDELELLI---IPEGVVPVLQFLKD 60
+++EKV+ GDEL L++ +PE + FLK+
Sbjct: 182 QFVEKVREIVGDELPLMLDLAVPEDLDQTKSFLKE 216
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.322 0.141 0.410
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,748,745
Number of Sequences: 62578
Number of extensions: 101326
Number of successful extensions: 270
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 270
Number of HSP's gapped (non-prelim): 3
length of query: 87
length of database: 14,973,337
effective HSP length: 55
effective length of query: 32
effective length of database: 11,531,547
effective search space: 369009504
effective search space used: 369009504
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 45 (21.9 bits)