Query         psy15424
Match_columns 153
No_of_seqs    46 out of 48
Neff          2.7 
Searched_HMMs 46136
Date          Fri Aug 16 20:39:46 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15424.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15424hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3600|consensus               99.9 2.5E-26 5.5E-31  224.3   4.8   71   38-143    20-91  (2238)
  2 PF11597 Med13_N:  Mediator com  99.9 4.8E-26   1E-30  197.6   5.5   83   39-149    15-97  (401)
  3 PLN02705 beta-amylase           81.4     4.4 9.5E-05   39.6   6.4   48    3-50     66-144 (681)
  4 PF15127 DUF4565:  Protein of u  27.0      22 0.00047   27.1   0.1   20   67-86     48-67  (91)
  5 PF05704 Caps_synth:  Capsular   26.5      47   0.001   28.1   2.0   14  124-137    43-57  (276)
  6 PF11705 RNA_pol_3_Rpc31:  DNA-  25.2      45 0.00097   27.3   1.6   10    1-10      1-10  (233)
  7 KOG1346|consensus               23.4      47   0.001   32.3   1.5   21  115-137   212-232 (659)
  8 PF15125 TMEM238:  TMEM238 prot  22.6      11 0.00025   27.0  -2.0    8  129-136    49-56  (65)
  9 PF08344 TRP_2:  Transient rece  21.4      51  0.0011   23.1   1.0   13   67-79     37-49  (63)
 10 smart00774 WRKY DNA binding do  17.7      20 0.00043   24.8  -1.6   26   45-81      4-29  (59)

No 1  
>KOG3600|consensus
Probab=99.92  E-value=2.5e-26  Score=224.30  Aligned_cols=71  Identities=45%  Similarity=0.845  Sum_probs=63.8

Q ss_pred             CCcccccCceeeeeecCCCCCCCCCCCCCCC-CchHHHHHHHHhhCCceeEEeecCCCCCCCCCCCCCCcccccCCCCcC
Q psy15424         38 GGDTDLCGIKWRKLVHGDSAGTGYSPGSEPL-EDPVLASYAKCLAGDILCVWRRVGTPQNGGSGGGGGGLFDSIGLPQVT  116 (153)
Q Consensus        38 ~~lTDL~GIKWRkyv~~~~~~~~~~p~~~pL-~DPVL~SYSRCL~adILCVWRR~~~p~~~~~~~~~~~~f~~~~~~~~~  116 (153)
                      -.|.||+|||||||+|+.++     |++.++ +|+||+||||||.+||||||||++.+                      
T Consensus        20 ~~l~el~gikwk~y~~k~~a-----p~~~~~t~d~vl~a~skcl~~~il~~wrr~~~~----------------------   72 (2238)
T KOG3600|consen   20 YALLELPGIKWKCYRTKPNA-----PRGVALTADFVLKAYSKCLLDGILCTWRRKPND----------------------   72 (2238)
T ss_pred             HHhhcCCCcceeEEeccCCC-----cceeeechhHHHHHHHHHHhhCceeeeecCCCC----------------------
Confidence            36899999999999998865     788888 99999999999999999999998753                      


Q ss_pred             CCCCccccccceeEEEecCCCCCCCcc
Q psy15424        117 SVPPLSLQAAKELWIFWYGEEPDLSSI  143 (153)
Q Consensus       117 ~~PplSl~~aKELWIFWYGeEPdLs~l  143 (153)
                              ++||||||||||||.|..+
T Consensus        73 --------~~kelwvfw~~dep~ll~~   91 (2238)
T KOG3600|consen   73 --------APKELWVFWYDDEPALLQK   91 (2238)
T ss_pred             --------CcceeEEEEeCCCcHHHHh
Confidence                    7799999999999988654


No 2  
>PF11597 Med13_N:  Mediator complex subunit 13 N-terminal;  InterPro: IPR021643  Mediator is a large complex of up to 33 proteins that is conserved from plants through fungi to humans - the number and representation of individual subunits varying with species [],[]. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function. Med13 is part of the ancillary kinase module, together with Med12, CDK8 and CycC, which in yeast is implicated in transcriptional repression, though most of this activity is likely attributable to the CDK8 kinase. The large Med12 and Med13 proteins are required for specific developmental processes in Drosophila, zebrafish, and Caenorhabditis elegans but their biochemical functions are not understood []. 
Probab=99.92  E-value=4.8e-26  Score=197.58  Aligned_cols=83  Identities=51%  Similarity=0.824  Sum_probs=71.7

Q ss_pred             CcccccCceeeeeecCCCCCCCCCCCCCCCCchHHHHHHHHhhCCceeEEeecCCCCCCCCCCCCCCcccccCCCCcCCC
Q psy15424         39 GDTDLCGIKWRKLVHGDSAGTGYSPGSEPLEDPVLASYAKCLAGDILCVWRRVGTPQNGGSGGGGGGLFDSIGLPQVTSV  118 (153)
Q Consensus        39 ~lTDL~GIKWRkyv~~~~~~~~~~p~~~pL~DPVL~SYSRCL~adILCVWRR~~~p~~~~~~~~~~~~f~~~~~~~~~~~  118 (153)
                      .++||+|||||+|++..+++    ....+++||||+||+||++++|||+|||++.+...                     
T Consensus        15 ~l~~lsgI~WR~Y~~~~~~~----~~~~~~~dpvl~s~~~~~~~~~l~~~lR~~~~lv~---------------------   69 (401)
T PF11597_consen   15 ALDDLSGIKWRIYVWEPNAS----RSPGPLEDPVLSSYSRCLAADILEVWLRNQGCLVS---------------------   69 (401)
T ss_pred             eeccCCcceEEEeecCCCCC----CCCCCCCChHHHHHHHhhhhhHHHHHhhcCCCCCC---------------------
Confidence            58999999999999977653    45678899999999999999999999998887432                     


Q ss_pred             CCccccccceeEEEecCCCCCCCcccchhhh
Q psy15424        119 PPLSLQAAKELWIFWYGEEPDLSSIVTPELF  149 (153)
Q Consensus       119 PplSl~~aKELWIFWYGeEPdLs~lV~pEL~  149 (153)
                         ....+|||||||||+|||+.+++++|+.
T Consensus        70 ---~~~~rkeLWvF~~~~ep~~~~~~~~~~~   97 (401)
T PF11597_consen   70 ---YDADRKELWVFWYGPEPDLLDPVHPEDE   97 (401)
T ss_pred             ---CCCCCcEEEEEecCCCcccccceeeccc
Confidence               1238999999999999999999998854


No 3  
>PLN02705 beta-amylase
Probab=81.42  E-value=4.4  Score=39.57  Aligned_cols=48  Identities=33%  Similarity=0.562  Sum_probs=31.5

Q ss_pred             CCCCCCCCcccCcccccchHHHHHHHHHHH-------------------------------HhhccCCcccccCceeee
Q psy15424          3 GRGGGGGGEREGGKVRETEEEEEEEVEKWE-------------------------------RLGERGGDTDLCGIKWRK   50 (153)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------------------------------~~~~~~~lTDL~GIKWRk   50 (153)
                      +.||||||.+.|.+-||.|.|....-|.=.                               ++-|+|-+.++.|.+.|+
T Consensus        66 ~~~~~~~~~~~~~~~~~~e~e~~~~rer~rrai~~ki~aglr~~g~~~lp~~~d~n~vl~al~~eagw~v~~dg~~yr~  144 (681)
T PLN02705         66 SSGGGGGGGGKGKREREKEKERTKLRERHRRAITSRMLAGLRQYGNFPLPARADMNDVLAALAREAGWTVEADGTTYRQ  144 (681)
T ss_pred             cCCCCCCCCCCCCCcchhhhhhhHHHHHHHHHHHHHHHHHHHhccCCCCCcccchHHHHHHHHHhcCcEEcCCCCcccC
Confidence            456666777777777766665544444332                               234677788999999984


No 4  
>PF15127 DUF4565:  Protein of unknown function (DUF4565)
Probab=27.00  E-value=22  Score=27.05  Aligned_cols=20  Identities=40%  Similarity=0.650  Sum_probs=17.6

Q ss_pred             CCCchHHHHHHHHhhCCcee
Q psy15424         67 PLEDPVLASYAKCLAGDILC   86 (153)
Q Consensus        67 pL~DPVL~SYSRCL~adILC   86 (153)
                      |..-|||.-||-||+.+||.
T Consensus        48 ~~a~~vvlEyA~rLSqEIl~   67 (91)
T PF15127_consen   48 PGASPVVLEYAHRLSQEILS   67 (91)
T ss_pred             CCCCchhHHHHHHHHHHHHH
Confidence            44779999999999999985


No 5  
>PF05704 Caps_synth:  Capsular polysaccharide synthesis protein;  InterPro: IPR008441 This entry consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae. This family is often transcribed with putative glycosyl transferases to give rise to bifunctional proteins [].
Probab=26.49  E-value=47  Score=28.14  Aligned_cols=14  Identities=43%  Similarity=1.227  Sum_probs=10.2

Q ss_pred             cccceeEEEec-CCC
Q psy15424        124 QAAKELWIFWY-GEE  137 (153)
Q Consensus       124 ~~aKELWIFWY-GeE  137 (153)
                      ...|-.|+||+ |.|
T Consensus        43 ~~~k~IW~~W~QG~e   57 (276)
T PF05704_consen   43 TNEKIIWVCWWQGEE   57 (276)
T ss_pred             CCCCcEEEEECCCcc
Confidence            35566999999 453


No 6  
>PF11705 RNA_pol_3_Rpc31:  DNA-directed RNA polymerase III subunit Rpc31;  InterPro: IPR024661 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. RNA polymerase III contains seventeen subunits in yeasts and in human cells. Twelve of these are akin to RNA polymerase I or II and the other five are RNA polymerase III-specific, and form the functionally distinct groups: (i) Rpc31-Rpc34-Rpc82, and (ii) Rpc37-Rpc53. Rpc31, Rpc34 and Rpc82 form a cluster of enzyme-specific subunits that contribute to transcription initiation in Saccharomyces cerevisiae and Homo sapiens. There is evidence that these subunits are anchored at or near the N-terminal Zn-fold of Rpc1, itself prolonged by a highly conserved but RNA polymerase III-specific domain []. This entry represents the Rpc31 subunit.
Probab=25.20  E-value=45  Score=27.28  Aligned_cols=10  Identities=80%  Similarity=1.577  Sum_probs=5.9

Q ss_pred             CCCCCCCCCC
Q psy15424          1 MRGRGGGGGG   10 (153)
Q Consensus         1 ~~~~~~~~~~   10 (153)
                      |-|||||+||
T Consensus         1 MSgRGggrg~   10 (233)
T PF11705_consen    1 MSGRGGGRGG   10 (233)
T ss_pred             CCCCCCCCCC
Confidence            5566666554


No 7  
>KOG1346|consensus
Probab=23.36  E-value=47  Score=32.28  Aligned_cols=21  Identities=38%  Similarity=0.960  Sum_probs=13.6

Q ss_pred             cCCCCCccccccceeEEEecCCC
Q psy15424        115 VTSVPPLSLQAAKELWIFWYGEE  137 (153)
Q Consensus       115 ~~~~PplSl~~aKELWIFWYGeE  137 (153)
                      -|-+|.....-+||||  ||||+
T Consensus       212 epelPYmRPPLSKELW--~~~dp  232 (659)
T KOG1346|consen  212 EPELPYMRPPLSKELW--WYGDP  232 (659)
T ss_pred             CccCcccCCCcchhce--ecCCC
Confidence            3455555555679998  77763


No 8  
>PF15125 TMEM238:  TMEM238 protein family
Probab=22.61  E-value=11  Score=27.04  Aligned_cols=8  Identities=50%  Similarity=1.817  Sum_probs=6.5

Q ss_pred             eEEEecCC
Q psy15424        129 LWIFWYGE  136 (153)
Q Consensus       129 LWIFWYGe  136 (153)
                      .|||||.-
T Consensus        49 ~Wv~WYtg   56 (65)
T PF15125_consen   49 WWVFWYTG   56 (65)
T ss_pred             HHHHHHhc
Confidence            59999965


No 9  
>PF08344 TRP_2:  Transient receptor ion channel II;  InterPro: IPR013555 TRP (transient receptor potential) channels can be described as tetramers formed by subunits with six transmembrane domains and containing cation-selective pores, which in several cases show high calcium permeability. The molecular architecture of TRP channels is reminiscent of voltage-gated channels and comprises six putative transmembrane segments (S1-S6), intracellular N- and C-termini, and a pore-forming reentrant loop between S5 and S6 []. TRP channels represent a superfamily conserved from worms to humans that comprise seven subfamilies []: TRPC (canonical), TRPV (vanilloid), TRPM (melastatin or long TRPs), TRPA (ankyrin), whose only member is the transmembrane protein 1, TRPP(polycystin), TRPML (mucolipin) and TRPN (Nomp-C homologues), which has a single member that can be found in worms, flies, and zebrafish. TRPs are classified essentially according to their primary amino acid sequence rather than selectivity or ligand affinity, due to their heterogenous properties and complex regulation. TRP channels are involved in many physiological functions, ranging from pure sensory functions, such as pheromone signalling, taste transduction, nociception, and temperature sensation, over homeostatic functions, such as Ca2+ and Mg2+ reabsorption and osmoregulation, to many other motile functions, such as muscle contraction and vaso-motor control []. This domain is found in Trp proteins, generally located to the C terminus of the Ankyrin repeats (IPR002110 from INTERPRO). 
Probab=21.40  E-value=51  Score=23.12  Aligned_cols=13  Identities=23%  Similarity=0.639  Sum_probs=10.5

Q ss_pred             CCCchHHHHHHHH
Q psy15424         67 PLEDPVLASYAKC   79 (153)
Q Consensus        67 pL~DPVL~SYSRC   79 (153)
                      .-+||||++|--+
T Consensus        37 ts~DPi~~AF~Ls   49 (63)
T PF08344_consen   37 TSDDPILTAFELS   49 (63)
T ss_pred             cCccHHHHHHHHH
Confidence            4599999999754


No 10 
>smart00774 WRKY DNA binding domain. The WRKY domain is a DNA binding domain found in one or two copies in a superfamily of plant transcription factors. These transcription factors are involved in the regulation of various physiological programs that are unique to plants, including pathogen defense, senescence and trichome development. The domain is a 60 amino acid region that is defined by the conserved amino acid sequence WRKYGQK at its N-terminal end, together with a novel zinc-finger-like motif. It binds specifically to the DNA sequence motif (T)(T)TGAC(C/T), which is known as the W box. The invariant TGAC core is essential for function and WRKY binding.
Probab=17.73  E-value=20  Score=24.79  Aligned_cols=26  Identities=35%  Similarity=0.675  Sum_probs=19.1

Q ss_pred             CceeeeeecCCCCCCCCCCCCCCCCchHHHHHHHHhh
Q psy15424         45 GIKWRKLVHGDSAGTGYSPGSEPLEDPVLASYAKCLA   81 (153)
Q Consensus        45 GIKWRkyv~~~~~~~~~~p~~~pL~DPVL~SYSRCL~   81 (153)
                      |-+||||-.....+.           |-.+||=||-.
T Consensus         4 Gy~WRKYGQK~ikgs-----------~~pRsYYrCt~   29 (59)
T smart00774        4 GYQWRKYGQKVIKGS-----------PFPRSYYRCTY   29 (59)
T ss_pred             cccccccCcEecCCC-----------cCcceEEeccc
Confidence            789999988765422           33478999988


Done!