Diaphorina citri psyllid: psy15437


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MLYVKKCLGCSEKLGPDELVMKTLDNVFHVQCFVCVVCGSRLQRGEQFVIKQGQLFCRPDYEKEVEMLQGYAQGIPFDLITSSKSHDGRRGPKRPRTILTTQQRRAFKASFEISPKPCRKVREGLARDTGLSVRIVQSRPIPV
cccccccccccccccccccEEEEcccEEEccccccccccccccccccEEEEccCEEEccccHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHcccccEEEEEccccc
MLYVKKCLGCSEKLGPDELVMKTLDNVFHVQCFVCVVCGSRLQRGEQFVIKQGQLFCRPDYEKEVEMLQGYAQGIPFDLITSSK********KR*********RRAFKASFEISPKPCRKVREGLARDTGLSVRIVQSRPIP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLYVKKCLGCSEKLGPDELVMKTLDNVFHVQCFVCVVCGSRLQRGEQFVIKQGQLFCRPDYEKEVEMLQGYAQGIPFDLITSSKSHDGRRGPKRPRTILTTQQRRAFKASFEISPKPCRKVREGLARDTGLSVRIVQSRPIPV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
LIM homeobox transcription factor 1-alpha Acts as a transcriptional activator by binding to an A/T-rich sequence, the FLAT element, in the insulin gene promoter. Required for development of the roof plate and, in turn, for specification of dorsal cell fates in the CNS and developing vertebrae.confidentQ8TE12
LIM homeobox transcription factor 1-alpha Acts as a transcriptional activator by binding to an A/T-rich sequence, the FLAT element, in the insulin gene promoter. Required for development of the roof plate and, in turn, for specification of dorsal cell fates in the CNS and developing vertebrae.confidentQ9JKU8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008283 [BP]cell proliferationprobableGO:0008150, GO:0044699
GO:0008219 [BP]cell deathprobableGO:0010259, GO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0071542 [BP]dopaminergic neuron differentiationprobableGO:0032502, GO:0048699, GO:0009987, GO:0030182, GO:0007399, GO:0044707, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699, GO:0048856
GO:0001764 [BP]neuron migrationprobableGO:0040011, GO:0032502, GO:0048699, GO:0048856, GO:0044707, GO:0007399, GO:0048870, GO:0009987, GO:0048869, GO:0032501, GO:0030154, GO:0006928, GO:0008150, GO:0051674, GO:0044763, GO:0007275, GO:0048731, GO:0022008, GO:0016477, GO:0051179, GO:0044699
GO:0021954 [BP]central nervous system neuron developmentprobableGO:0048666, GO:0032502, GO:0048699, GO:0048856, GO:0030182, GO:0007399, GO:0008150, GO:0044707, GO:0048869, GO:0032501, GO:0030154, GO:0048468, GO:0044767, GO:0009987, GO:0044763, GO:0044699, GO:0048731, GO:0022008, GO:0007275, GO:0021953, GO:0007417
GO:0003700 [MF]sequence-specific DNA binding transcription factor activityprobableGO:0003674, GO:0001071
GO:0002930 [BP]trabecular meshwork developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0001654, GO:0048731, GO:0008150, GO:0043010, GO:0007275, GO:0044699
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0030901 [BP]midbrain developmentprobableGO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0035108 [BP]limb morphogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0060173, GO:0035107, GO:0044767, GO:0032501, GO:0008150, GO:0044699, GO:0009653, GO:0007275, GO:0048736
GO:0035265 [BP]organ growthprobableGO:0044699, GO:0032501, GO:0008150, GO:0040007, GO:0044707
GO:0030199 [BP]collagen fibril organizationprobableGO:0009987, GO:0016043, GO:0030198, GO:0044763, GO:0071840, GO:0043062, GO:0008150, GO:0044699
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0021587 [BP]cerebellum morphogenesisprobableGO:0032502, GO:0044707, GO:0021549, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0022037, GO:0021575, GO:0044767, GO:0048513, GO:0008150, GO:0030902, GO:0048731, GO:0009653, GO:0007275, GO:0044699, GO:0007417

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2RGT, chain A
Confidence level:very confident
Coverage over the Query: 2-66,95-119
View the alignment between query and template
View the model in PyMOL
Template: 2DA3, chain A
Confidence level:confident
Coverage over the Query: 87-142
View the alignment between query and template
View the model in PyMOL