BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy15443
         (73 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2W3C|A Chain A, Globular Head Region Of The Human General Vesicular
           Transport Factor P115
          Length = 577

 Score = 49.7 bits (117), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 34/55 (61%)

Query: 2   EMFLDKLSEVSRHEVYSRAAKKPQLDPERAHEPLLDYEFCKLYKALEAQSADWIY 56
           E F++KL  +S+HE+YSRA++KPQ +       + D+EF KL K LE      IY
Sbjct: 523 ENFIEKLGFISKHELYSRASQKPQPNFPSPEYMIFDHEFTKLVKELEGVITKAIY 577


>pdb|3GQ2|A Chain A, Crystal Structure Of The Dimer Of The P115 Tether Globular
           Head Domain
 pdb|3GQ2|B Chain B, Crystal Structure Of The Dimer Of The P115 Tether Globular
           Head Domain
 pdb|3GRL|A Chain A, Crystal Structure Of The Monomer Of The P115 Tether
           Globular Head Domain
          Length = 651

 Score = 49.7 bits (117), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 34/55 (61%)

Query: 2   EMFLDKLSEVSRHEVYSRAAKKPQLDPERAHEPLLDYEFCKLYKALEAQSADWIY 56
           E F++KL  +S+HE+YSRA++KPQ +       + D+EF KL K LE      IY
Sbjct: 575 ENFIEKLGFISKHELYSRASQKPQPNFPSPEYMIFDHEFTKLVKELEGVITKAIY 629


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.314    0.129    0.372 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,025,575
Number of Sequences: 62578
Number of extensions: 62779
Number of successful extensions: 93
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 91
Number of HSP's gapped (non-prelim): 2
length of query: 73
length of database: 14,973,337
effective HSP length: 43
effective length of query: 30
effective length of database: 12,282,483
effective search space: 368474490
effective search space used: 368474490
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 45 (21.9 bits)