BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy15457
(71 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1Z6O|M Chain M, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
pdb|1Z6O|N Chain N, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
pdb|1Z6O|O Chain O, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
pdb|1Z6O|P Chain P, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
pdb|1Z6O|Q Chain Q, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
pdb|1Z6O|R Chain R, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
pdb|1Z6O|S Chain S, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
pdb|1Z6O|T Chain T, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
pdb|1Z6O|U Chain U, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
pdb|1Z6O|V Chain V, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
pdb|1Z6O|W Chain W, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
pdb|1Z6O|X Chain X, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
Length = 191
Score = 80.9 bits (198), Expect = 2e-16, Method: Compositional matrix adjust.
Identities = 39/67 (58%), Positives = 46/67 (68%)
Query: 3 EDGDSHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRGNLTDYHHHV 62
E G S A GAHFS+D VNRPGFA+ FF +ASEEREHA+K I YL MRG LT+ +
Sbjct: 32 EVGASLQYLAMGAHFSKDVVNRPGFAQLFFDAASEEREHAMKLIEYLLMRGELTNDVSSL 91
Query: 63 LSIIPST 69
L + P T
Sbjct: 92 LQVRPPT 98
>pdb|3VNX|A Chain A, Crystal Structure Of Ferritin From Multicellular Green
Algae, Ulva Pertusa
Length = 204
Score = 46.2 bits (108), Expect = 4e-06, Method: Compositional matrix adjust.
Identities = 21/39 (53%), Positives = 27/39 (69%)
Query: 15 AHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
++F+RD V PGFAKFF ++ EEREHA + Y T RG
Sbjct: 63 SYFARDNVGLPGFAKFFKEASDEEREHAHMLMDYQTKRG 101
>pdb|3A9Q|A Chain A, Crystal Structure Analysis Of E173a Variant Of The Soybean
Ferritin Sfer4
pdb|3A9Q|B Chain B, Crystal Structure Analysis Of E173a Variant Of The Soybean
Ferritin Sfer4
pdb|3A9Q|C Chain C, Crystal Structure Analysis Of E173a Variant Of The Soybean
Ferritin Sfer4
pdb|3A9Q|D Chain D, Crystal Structure Analysis Of E173a Variant Of The Soybean
Ferritin Sfer4
pdb|3A9Q|E Chain E, Crystal Structure Analysis Of E173a Variant Of The Soybean
Ferritin Sfer4
pdb|3A9Q|F Chain F, Crystal Structure Analysis Of E173a Variant Of The Soybean
Ferritin Sfer4
pdb|3A9Q|G Chain G, Crystal Structure Analysis Of E173a Variant Of The Soybean
Ferritin Sfer4
pdb|3A9Q|H Chain H, Crystal Structure Analysis Of E173a Variant Of The Soybean
Ferritin Sfer4
pdb|3A9Q|I Chain I, Crystal Structure Analysis Of E173a Variant Of The Soybean
Ferritin Sfer4
pdb|3A9Q|J Chain J, Crystal Structure Analysis Of E173a Variant Of The Soybean
Ferritin Sfer4
pdb|3A9Q|K Chain K, Crystal Structure Analysis Of E173a Variant Of The Soybean
Ferritin Sfer4
pdb|3A9Q|L Chain L, Crystal Structure Analysis Of E173a Variant Of The Soybean
Ferritin Sfer4
pdb|3A9Q|M Chain M, Crystal Structure Analysis Of E173a Variant Of The Soybean
Ferritin Sfer4
pdb|3A9Q|N Chain N, Crystal Structure Analysis Of E173a Variant Of The Soybean
Ferritin Sfer4
pdb|3A9Q|O Chain O, Crystal Structure Analysis Of E173a Variant Of The Soybean
Ferritin Sfer4
pdb|3A9Q|P Chain P, Crystal Structure Analysis Of E173a Variant Of The Soybean
Ferritin Sfer4
pdb|3A9Q|Q Chain Q, Crystal Structure Analysis Of E173a Variant Of The Soybean
Ferritin Sfer4
pdb|3A9Q|R Chain R, Crystal Structure Analysis Of E173a Variant Of The Soybean
Ferritin Sfer4
pdb|3A9Q|S Chain S, Crystal Structure Analysis Of E173a Variant Of The Soybean
Ferritin Sfer4
pdb|3A9Q|T Chain T, Crystal Structure Analysis Of E173a Variant Of The Soybean
Ferritin Sfer4
pdb|3A9Q|U Chain U, Crystal Structure Analysis Of E173a Variant Of The Soybean
Ferritin Sfer4
pdb|3A9Q|V Chain V, Crystal Structure Analysis Of E173a Variant Of The Soybean
Ferritin Sfer4
pdb|3A9Q|W Chain W, Crystal Structure Analysis Of E173a Variant Of The Soybean
Ferritin Sfer4
pdb|3A9Q|X Chain X, Crystal Structure Analysis Of E173a Variant Of The Soybean
Ferritin Sfer4
Length = 212
Score = 44.3 bits (103), Expect = 2e-05, Method: Compositional matrix adjust.
Identities = 21/39 (53%), Positives = 24/39 (61%)
Query: 15 AHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
A+F RD V G AKFF S+ EEREHA K + Y RG
Sbjct: 68 AYFDRDNVALRGLAKFFKESSEEEREHAEKLMEYQNKRG 106
>pdb|3A68|A Chain A, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
Binding Site That Functions As A Transit Site For Metal
Transfer In Ferritin
pdb|3A68|B Chain B, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
Binding Site That Functions As A Transit Site For Metal
Transfer In Ferritin
pdb|3A68|C Chain C, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
Binding Site That Functions As A Transit Site For Metal
Transfer In Ferritin
pdb|3A68|D Chain D, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
Binding Site That Functions As A Transit Site For Metal
Transfer In Ferritin
pdb|3A68|E Chain E, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
Binding Site That Functions As A Transit Site For Metal
Transfer In Ferritin
pdb|3A68|F Chain F, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
Binding Site That Functions As A Transit Site For Metal
Transfer In Ferritin
pdb|3A68|G Chain G, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
Binding Site That Functions As A Transit Site For Metal
Transfer In Ferritin
pdb|3A68|H Chain H, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
Binding Site That Functions As A Transit Site For Metal
Transfer In Ferritin
pdb|3A68|I Chain I, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
Binding Site That Functions As A Transit Site For Metal
Transfer In Ferritin
pdb|3A68|J Chain J, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
Binding Site That Functions As A Transit Site For Metal
Transfer In Ferritin
pdb|3A68|K Chain K, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
Binding Site That Functions As A Transit Site For Metal
Transfer In Ferritin
pdb|3A68|L Chain L, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
Binding Site That Functions As A Transit Site For Metal
Transfer In Ferritin
pdb|3A68|M Chain M, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
Binding Site That Functions As A Transit Site For Metal
Transfer In Ferritin
pdb|3A68|N Chain N, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
Binding Site That Functions As A Transit Site For Metal
Transfer In Ferritin
pdb|3A68|O Chain O, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
Binding Site That Functions As A Transit Site For Metal
Transfer In Ferritin
pdb|3A68|P Chain P, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
Binding Site That Functions As A Transit Site For Metal
Transfer In Ferritin
pdb|3A68|Q Chain Q, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
Binding Site That Functions As A Transit Site For Metal
Transfer In Ferritin
pdb|3A68|R Chain R, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
Binding Site That Functions As A Transit Site For Metal
Transfer In Ferritin
pdb|3A68|S Chain S, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
Binding Site That Functions As A Transit Site For Metal
Transfer In Ferritin
pdb|3A68|T Chain T, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
Binding Site That Functions As A Transit Site For Metal
Transfer In Ferritin
pdb|3A68|U Chain U, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
Binding Site That Functions As A Transit Site For Metal
Transfer In Ferritin
pdb|3A68|V Chain V, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
Binding Site That Functions As A Transit Site For Metal
Transfer In Ferritin
pdb|3A68|W Chain W, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
Binding Site That Functions As A Transit Site For Metal
Transfer In Ferritin
pdb|3A68|X Chain X, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
Binding Site That Functions As A Transit Site For Metal
Transfer In Ferritin
Length = 212
Score = 44.3 bits (103), Expect = 2e-05, Method: Compositional matrix adjust.
Identities = 21/39 (53%), Positives = 24/39 (61%)
Query: 15 AHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
A+F RD V G AKFF S+ EEREHA K + Y RG
Sbjct: 68 AYFDRDNVALRGLAKFFKESSEEEREHAEKLMEYQNKRG 106
>pdb|1RCD|A Chain A, Bullfrog Red Cell L Ferritin TartrateMGPH 5.5
pdb|1RCG|A Chain A, Bullfrog Red Cell L Ferritin SulfateMNPH 6.3
Length = 173
Score = 41.6 bits (96), Expect = 1e-04, Method: Compositional matrix adjust.
Identities = 19/40 (47%), Positives = 24/40 (60%)
Query: 14 GAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
++F+RD V FAKFF + EE+EHA K I Y RG
Sbjct: 35 ASYFNRDDVALSNFAKFFRERSEEEKEHAEKLIEYQNQRG 74
>pdb|1RCI|A Chain A, Bullfrog Red Cell L Ferritin TartrateMGPH 5.5
Length = 173
Score = 41.6 bits (96), Expect = 1e-04, Method: Compositional matrix adjust.
Identities = 20/47 (42%), Positives = 27/47 (57%)
Query: 7 SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
S+ + ++F+RD V FAKFF + EE+EHA K I Y RG
Sbjct: 28 SYVYLSMASYFNRDDVALSNFAKFFRERSEEEKEHAEKLIEYQNQRG 74
>pdb|2CN7|A Chain A, Recombinant Human H Ferritin, K86q, E27d And E107d
Mutant
pdb|2IU2|A Chain A, Recombinant Human H Ferritin, K86q, E27d And E107d
Mutant, Soaked With Zn Ions
Length = 183
Score = 37.4 bits (85), Expect = 0.002, Method: Compositional matrix adjust.
Identities = 17/38 (44%), Positives = 21/38 (55%)
Query: 16 HFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
+F RD V FAK+F + EEREHA K + RG
Sbjct: 41 YFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78
>pdb|2CHI|A Chain A, Recombinant Human H Ferritin, K86q And E27d Mutant
pdb|2CIH|A Chain A, Recombinant Human H Ferritin, K86q And E27d Mutant,
Soaked With Zn
Length = 183
Score = 37.4 bits (85), Expect = 0.002, Method: Compositional matrix adjust.
Identities = 17/38 (44%), Positives = 21/38 (55%)
Query: 16 HFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
+F RD V FAK+F + EEREHA K + RG
Sbjct: 41 YFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78
>pdb|2CLU|A Chain A, Recombinant Human H Ferritin, K86q And E107d Mutant
pdb|2CN6|A Chain A, Recombinant Human H Ferritin, K86q And E107d Mutant,
Soaked With Zn Ions
Length = 183
Score = 37.4 bits (85), Expect = 0.002, Method: Compositional matrix adjust.
Identities = 17/38 (44%), Positives = 21/38 (55%)
Query: 16 HFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
+F RD V FAK+F + EEREHA K + RG
Sbjct: 41 YFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78
>pdb|2CEI|A Chain A, Recombinant Human H Ferritin, K86q Mutant, Soaked With
Zn
pdb|1FHA|A Chain A, Solving The Structure Of Human H Ferritin By Genetically
Engineering Intermolecular Crystal Contacts
pdb|2FHA|A Chain A, Human H Chain Ferritin
Length = 183
Score = 37.4 bits (85), Expect = 0.002, Method: Compositional matrix adjust.
Identities = 17/38 (44%), Positives = 21/38 (55%)
Query: 16 HFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
+F RD V FAK+F + EEREHA K + RG
Sbjct: 41 YFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78
>pdb|3AJQ|A Chain A, Crystal Structure Of Human H Ferritin E140q Mutant
Length = 182
Score = 37.4 bits (85), Expect = 0.002, Method: Compositional matrix adjust.
Identities = 17/38 (44%), Positives = 21/38 (55%)
Query: 16 HFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
+F RD V FAK+F + EEREHA K + RG
Sbjct: 40 YFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 77
>pdb|3AJO|A Chain A, Crystal Structure Of Wild-Type Human Ferritin H Chain
Length = 182
Score = 37.4 bits (85), Expect = 0.002, Method: Compositional matrix adjust.
Identities = 17/38 (44%), Positives = 21/38 (55%)
Query: 16 HFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
+F RD V FAK+F + EEREHA K + RG
Sbjct: 40 YFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 77
>pdb|3AJP|A Chain A, Crystal Structure Of Human H Ferritin E140a Mutant
Length = 182
Score = 37.4 bits (85), Expect = 0.002, Method: Compositional matrix adjust.
Identities = 17/38 (44%), Positives = 21/38 (55%)
Query: 16 HFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
+F RD V FAK+F + EEREHA K + RG
Sbjct: 40 YFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 77
>pdb|3KA9|A Chain A, Frog M-Ferritin, Eeh Mutant, With Cobalt
Length = 176
Score = 35.8 bits (81), Expect = 0.006, Method: Compositional matrix adjust.
Identities = 19/39 (48%), Positives = 22/39 (56%)
Query: 15 AHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
A F RD V A+FF + EEREHA KF+ Y RG
Sbjct: 36 AFFDRDDVALHNVAEFFKEHSHEEREHAEKFMKYQNKRG 74
>pdb|3KA8|A Chain A, Frog M-Ferritin, Eqh Mutant, With Cobalt
Length = 176
Score = 35.8 bits (81), Expect = 0.006, Method: Compositional matrix adjust.
Identities = 19/39 (48%), Positives = 22/39 (56%)
Query: 15 AHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
A F RD V A+FF + EEREHA KF+ Y RG
Sbjct: 36 AFFDRDDVALHNVAEFFKEHSHEEREHAEKFMKYQNKRG 74
>pdb|1MFR|A Chain A, Crystal Structure Of M Ferritin
pdb|1MFR|B Chain B, Crystal Structure Of M Ferritin
pdb|1MFR|C Chain C, Crystal Structure Of M Ferritin
pdb|1MFR|D Chain D, Crystal Structure Of M Ferritin
pdb|1MFR|E Chain E, Crystal Structure Of M Ferritin
pdb|1MFR|F Chain F, Crystal Structure Of M Ferritin
pdb|1MFR|G Chain G, Crystal Structure Of M Ferritin
pdb|1MFR|H Chain H, Crystal Structure Of M Ferritin
pdb|1MFR|I Chain I, Crystal Structure Of M Ferritin
pdb|1MFR|J Chain J, Crystal Structure Of M Ferritin
pdb|1MFR|K Chain K, Crystal Structure Of M Ferritin
pdb|1MFR|L Chain L, Crystal Structure Of M Ferritin
pdb|1MFR|M Chain M, Crystal Structure Of M Ferritin
pdb|1MFR|N Chain N, Crystal Structure Of M Ferritin
pdb|1MFR|O Chain O, Crystal Structure Of M Ferritin
pdb|1MFR|P Chain P, Crystal Structure Of M Ferritin
pdb|1MFR|Q Chain Q, Crystal Structure Of M Ferritin
pdb|1MFR|R Chain R, Crystal Structure Of M Ferritin
pdb|1MFR|S Chain S, Crystal Structure Of M Ferritin
pdb|1MFR|T Chain T, Crystal Structure Of M Ferritin
pdb|1MFR|U Chain U, Crystal Structure Of M Ferritin
pdb|1MFR|V Chain V, Crystal Structure Of M Ferritin
pdb|1MFR|W Chain W, Crystal Structure Of M Ferritin
pdb|1MFR|X Chain X, Crystal Structure Of M Ferritin
pdb|3KA3|A Chain A, Frog M-Ferritin With Magnesium
pdb|3KA4|A Chain A, Frog M-Ferritin With Cobalt
pdb|3RBC|A Chain A, Bullfrog M Ferritin With Iron(Iii) Bound To The
Ferroxidase Site
pdb|3RBC|B Chain B, Bullfrog M Ferritin With Iron(Iii) Bound To The
Ferroxidase Site
pdb|3RBC|C Chain C, Bullfrog M Ferritin With Iron(Iii) Bound To The
Ferroxidase Site
pdb|3RBC|D Chain D, Bullfrog M Ferritin With Iron(Iii) Bound To The
Ferroxidase Site
pdb|3RBC|E Chain E, Bullfrog M Ferritin With Iron(Iii) Bound To The
Ferroxidase Site
pdb|3RBC|F Chain F, Bullfrog M Ferritin With Iron(Iii) Bound To The
Ferroxidase Site
pdb|3RBC|G Chain G, Bullfrog M Ferritin With Iron(Iii) Bound To The
Ferroxidase Site
pdb|3RBC|H Chain H, Bullfrog M Ferritin With Iron(Iii) Bound To The
Ferroxidase Site
pdb|3RBC|I Chain I, Bullfrog M Ferritin With Iron(Iii) Bound To The
Ferroxidase Site
pdb|3RBC|J Chain J, Bullfrog M Ferritin With Iron(Iii) Bound To The
Ferroxidase Site
pdb|3RBC|K Chain K, Bullfrog M Ferritin With Iron(Iii) Bound To The
Ferroxidase Site
pdb|3RBC|L Chain L, Bullfrog M Ferritin With Iron(Iii) Bound To The
Ferroxidase Site
pdb|3RBC|M Chain M, Bullfrog M Ferritin With Iron(Iii) Bound To The
Ferroxidase Site
pdb|3RBC|N Chain N, Bullfrog M Ferritin With Iron(Iii) Bound To The
Ferroxidase Site
pdb|3RBC|O Chain O, Bullfrog M Ferritin With Iron(Iii) Bound To The
Ferroxidase Site
pdb|3RBC|P Chain P, Bullfrog M Ferritin With Iron(Iii) Bound To The
Ferroxidase Site
pdb|3RBC|Q Chain Q, Bullfrog M Ferritin With Iron(Iii) Bound To The
Ferroxidase Site
pdb|3RBC|R Chain R, Bullfrog M Ferritin With Iron(Iii) Bound To The
Ferroxidase Site
pdb|3RBC|S Chain S, Bullfrog M Ferritin With Iron(Iii) Bound To The
Ferroxidase Site
pdb|3RBC|T Chain T, Bullfrog M Ferritin With Iron(Iii) Bound To The
Ferroxidase Site
pdb|3RBC|U Chain U, Bullfrog M Ferritin With Iron(Iii) Bound To The
Ferroxidase Site
pdb|3RBC|V Chain V, Bullfrog M Ferritin With Iron(Iii) Bound To The
Ferroxidase Site
pdb|3RBC|W Chain W, Bullfrog M Ferritin With Iron(Iii) Bound To The
Ferroxidase Site
pdb|3RBC|X Chain X, Bullfrog M Ferritin With Iron(Iii) Bound To The
Ferroxidase Site
pdb|3RE7|A Chain A, Copper (Ii) Loaded Bullfrog Ferritin M Chain
pdb|3RE7|B Chain B, Copper (Ii) Loaded Bullfrog Ferritin M Chain
pdb|3RE7|C Chain C, Copper (Ii) Loaded Bullfrog Ferritin M Chain
pdb|3RE7|D Chain D, Copper (Ii) Loaded Bullfrog Ferritin M Chain
pdb|3RE7|E Chain E, Copper (Ii) Loaded Bullfrog Ferritin M Chain
pdb|3RE7|F Chain F, Copper (Ii) Loaded Bullfrog Ferritin M Chain
pdb|3RE7|G Chain G, Copper (Ii) Loaded Bullfrog Ferritin M Chain
pdb|3RE7|H Chain H, Copper (Ii) Loaded Bullfrog Ferritin M Chain
pdb|3RE7|I Chain I, Copper (Ii) Loaded Bullfrog Ferritin M Chain
pdb|3RE7|J Chain J, Copper (Ii) Loaded Bullfrog Ferritin M Chain
pdb|3RE7|K Chain K, Copper (Ii) Loaded Bullfrog Ferritin M Chain
pdb|3RE7|L Chain L, Copper (Ii) Loaded Bullfrog Ferritin M Chain
pdb|3RE7|M Chain M, Copper (Ii) Loaded Bullfrog Ferritin M Chain
pdb|3RE7|N Chain N, Copper (Ii) Loaded Bullfrog Ferritin M Chain
pdb|3RE7|O Chain O, Copper (Ii) Loaded Bullfrog Ferritin M Chain
pdb|3RE7|P Chain P, Copper (Ii) Loaded Bullfrog Ferritin M Chain
pdb|3RE7|Q Chain Q, Copper (Ii) Loaded Bullfrog Ferritin M Chain
pdb|3RE7|R Chain R, Copper (Ii) Loaded Bullfrog Ferritin M Chain
pdb|3RE7|S Chain S, Copper (Ii) Loaded Bullfrog Ferritin M Chain
pdb|3RE7|T Chain T, Copper (Ii) Loaded Bullfrog Ferritin M Chain
pdb|3RE7|U Chain U, Copper (Ii) Loaded Bullfrog Ferritin M Chain
pdb|3RE7|V Chain V, Copper (Ii) Loaded Bullfrog Ferritin M Chain
pdb|3RE7|W Chain W, Copper (Ii) Loaded Bullfrog Ferritin M Chain
pdb|3RE7|X Chain X, Copper (Ii) Loaded Bullfrog Ferritin M Chain
pdb|3RGD|A Chain A, Iron Loaded Frog M Ferritin. Short Soaking Time
pdb|3RGD|B Chain B, Iron Loaded Frog M Ferritin. Short Soaking Time
pdb|3RGD|C Chain C, Iron Loaded Frog M Ferritin. Short Soaking Time
pdb|3RGD|D Chain D, Iron Loaded Frog M Ferritin. Short Soaking Time
pdb|3RGD|E Chain E, Iron Loaded Frog M Ferritin. Short Soaking Time
pdb|3RGD|F Chain F, Iron Loaded Frog M Ferritin. Short Soaking Time
pdb|3RGD|G Chain G, Iron Loaded Frog M Ferritin. Short Soaking Time
pdb|3RGD|H Chain H, Iron Loaded Frog M Ferritin. Short Soaking Time
pdb|3RGD|I Chain I, Iron Loaded Frog M Ferritin. Short Soaking Time
pdb|3RGD|J Chain J, Iron Loaded Frog M Ferritin. Short Soaking Time
pdb|3RGD|K Chain K, Iron Loaded Frog M Ferritin. Short Soaking Time
pdb|3RGD|L Chain L, Iron Loaded Frog M Ferritin. Short Soaking Time
pdb|3RGD|M Chain M, Iron Loaded Frog M Ferritin. Short Soaking Time
pdb|3RGD|N Chain N, Iron Loaded Frog M Ferritin. Short Soaking Time
pdb|3RGD|O Chain O, Iron Loaded Frog M Ferritin. Short Soaking Time
pdb|3RGD|P Chain P, Iron Loaded Frog M Ferritin. Short Soaking Time
pdb|3RGD|Q Chain Q, Iron Loaded Frog M Ferritin. Short Soaking Time
pdb|3RGD|R Chain R, Iron Loaded Frog M Ferritin. Short Soaking Time
pdb|3RGD|S Chain S, Iron Loaded Frog M Ferritin. Short Soaking Time
pdb|3RGD|T Chain T, Iron Loaded Frog M Ferritin. Short Soaking Time
pdb|3RGD|U Chain U, Iron Loaded Frog M Ferritin. Short Soaking Time
pdb|3RGD|V Chain V, Iron Loaded Frog M Ferritin. Short Soaking Time
pdb|3RGD|W Chain W, Iron Loaded Frog M Ferritin. Short Soaking Time
pdb|3RGD|X Chain X, Iron Loaded Frog M Ferritin. Short Soaking Time
pdb|4DAS|A Chain A, Crystal Structure Of Bullfrog M Ferritin
pdb|4DAS|B Chain B, Crystal Structure Of Bullfrog M Ferritin
pdb|4DAS|C Chain C, Crystal Structure Of Bullfrog M Ferritin
pdb|4DAS|D Chain D, Crystal Structure Of Bullfrog M Ferritin
pdb|4DAS|E Chain E, Crystal Structure Of Bullfrog M Ferritin
pdb|4DAS|F Chain F, Crystal Structure Of Bullfrog M Ferritin
pdb|4DAS|G Chain G, Crystal Structure Of Bullfrog M Ferritin
pdb|4DAS|H Chain H, Crystal Structure Of Bullfrog M Ferritin
pdb|4DAS|I Chain I, Crystal Structure Of Bullfrog M Ferritin
pdb|4DAS|J Chain J, Crystal Structure Of Bullfrog M Ferritin
pdb|4DAS|K Chain K, Crystal Structure Of Bullfrog M Ferritin
pdb|4DAS|L Chain L, Crystal Structure Of Bullfrog M Ferritin
pdb|4DAS|M Chain M, Crystal Structure Of Bullfrog M Ferritin
pdb|4DAS|N Chain N, Crystal Structure Of Bullfrog M Ferritin
pdb|4DAS|O Chain O, Crystal Structure Of Bullfrog M Ferritin
pdb|4DAS|P Chain P, Crystal Structure Of Bullfrog M Ferritin
pdb|4DAS|Q Chain Q, Crystal Structure Of Bullfrog M Ferritin
pdb|4DAS|R Chain R, Crystal Structure Of Bullfrog M Ferritin
pdb|4DAS|S Chain S, Crystal Structure Of Bullfrog M Ferritin
pdb|4DAS|T Chain T, Crystal Structure Of Bullfrog M Ferritin
pdb|4DAS|U Chain U, Crystal Structure Of Bullfrog M Ferritin
pdb|4DAS|V Chain V, Crystal Structure Of Bullfrog M Ferritin
pdb|4DAS|X Chain X, Crystal Structure Of Bullfrog M Ferritin
pdb|4DAS|W Chain W, Crystal Structure Of Bullfrog M Ferritin
Length = 176
Score = 35.8 bits (81), Expect = 0.006, Method: Compositional matrix adjust.
Identities = 19/39 (48%), Positives = 22/39 (56%)
Query: 15 AHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
A F RD V A+FF + EEREHA KF+ Y RG
Sbjct: 36 AFFDRDDVALHNVAEFFKEHSHEEREHAEKFMKYQNKRG 74
>pdb|3SHX|A Chain A, Frog M-Ferritin With Magnesium, L134p Mutant
Length = 176
Score = 35.8 bits (81), Expect = 0.006, Method: Compositional matrix adjust.
Identities = 19/39 (48%), Positives = 22/39 (56%)
Query: 15 AHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
A F RD V A+FF + EEREHA KF+ Y RG
Sbjct: 36 AFFDRDDVALHNVAEFFKEHSHEEREHAEKFMKYQNKRG 74
>pdb|3KA6|A Chain A, Frog M-Ferritin, Eed Mutant, With Cobalt
Length = 176
Score = 35.8 bits (81), Expect = 0.006, Method: Compositional matrix adjust.
Identities = 19/39 (48%), Positives = 22/39 (56%)
Query: 15 AHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
A F RD V A+FF + EEREHA KF+ Y RG
Sbjct: 36 AFFDRDDVALHNVAEFFKEHSHEEREHAEKFMKYQNKRG 74
>pdb|3SH6|A Chain A, Frog M-Ferritin, D122r Mutant, With Magnesium
Length = 176
Score = 35.8 bits (81), Expect = 0.007, Method: Compositional matrix adjust.
Identities = 19/39 (48%), Positives = 22/39 (56%)
Query: 15 AHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
A F RD V A+FF + EEREHA KF+ Y RG
Sbjct: 36 AFFDRDDVALHNVAEFFKEHSHEEREHAEKFMKYQNKRG 74
>pdb|1RCC|A Chain A, Bullfrog Red Cell L Ferritin TartrateMGPH 5.5
pdb|1RCE|A Chain A, Bullfrog Red Cell L Ferritin SulfateMNPH 6.3
Length = 173
Score = 34.3 bits (77), Expect = 0.018, Method: Compositional matrix adjust.
Identities = 16/40 (40%), Positives = 22/40 (55%)
Query: 14 GAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
++F+RD V FAKFF ++ + HA K I Y RG
Sbjct: 35 ASYFNRDDVALSNFAKFFRERSAAAKAHAEKLIEYQNQRG 74
>pdb|3ES3|A Chain A, Directing Noble Metal Ion Chemistry Within A Designed
Ferritin Protein. The Complex With Gold Ions. Ferritin
H8-H9x Mutant
Length = 183
Score = 33.5 bits (75), Expect = 0.028, Method: Compositional matrix adjust.
Identities = 16/38 (42%), Positives = 20/38 (52%)
Query: 16 HFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
+F RD V FAK+F + EER HA K + RG
Sbjct: 41 YFDRDDVALKNFAKYFLHQSHEERCHAEKLMKLQNQRG 78
>pdb|3ERZ|A Chain A, Directing Noble Metal Ion Chemistry Within A Designed
Ferritin Protein. Mercury Ions On The Three-Fold
Channel
pdb|3ERZ|B Chain B, Directing Noble Metal Ion Chemistry Within A Designed
Ferritin Protein. Mercury Ions On The Three-Fold
Channel
pdb|3ERZ|C Chain C, Directing Noble Metal Ion Chemistry Within A Designed
Ferritin Protein. Mercury Ions On The Three-Fold
Channel
pdb|3ERZ|D Chain D, Directing Noble Metal Ion Chemistry Within A Designed
Ferritin Protein. Mercury Ions On The Three-Fold
Channel
pdb|3ERZ|E Chain E, Directing Noble Metal Ion Chemistry Within A Designed
Ferritin Protein. Mercury Ions On The Three-Fold
Channel
pdb|3ERZ|F Chain F, Directing Noble Metal Ion Chemistry Within A Designed
Ferritin Protein. Mercury Ions On The Three-Fold
Channel
pdb|3ERZ|G Chain G, Directing Noble Metal Ion Chemistry Within A Designed
Ferritin Protein. Mercury Ions On The Three-Fold
Channel
pdb|3ERZ|H Chain H, Directing Noble Metal Ion Chemistry Within A Designed
Ferritin Protein. Mercury Ions On The Three-Fold
Channel
pdb|3ERZ|I Chain I, Directing Noble Metal Ion Chemistry Within A Designed
Ferritin Protein. Mercury Ions On The Three-Fold
Channel
pdb|3ERZ|J Chain J, Directing Noble Metal Ion Chemistry Within A Designed
Ferritin Protein. Mercury Ions On The Three-Fold
Channel
pdb|3ERZ|K Chain K, Directing Noble Metal Ion Chemistry Within A Designed
Ferritin Protein. Mercury Ions On The Three-Fold
Channel
pdb|3ERZ|L Chain L, Directing Noble Metal Ion Chemistry Within A Designed
Ferritin Protein. Mercury Ions On The Three-Fold
Channel
Length = 183
Score = 33.5 bits (75), Expect = 0.029, Method: Compositional matrix adjust.
Identities = 16/38 (42%), Positives = 20/38 (52%)
Query: 16 HFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
+F RD V FAK+F + EER HA K + RG
Sbjct: 41 YFDRDDVALKNFAKYFLHQSHEERCHAEKLMKLQNQRG 78
>pdb|2Z6M|A Chain A, Crystal Structure Of Human Ferritin H8 As Biotemplate
For Noble Metal Nanoparticle Synthesis
pdb|2Z6M|B Chain B, Crystal Structure Of Human Ferritin H8 As Biotemplate
For Noble Metal Nanoparticle Synthesis
pdb|2Z6M|C Chain C, Crystal Structure Of Human Ferritin H8 As Biotemplate
For Noble Metal Nanoparticle Synthesis
pdb|2Z6M|D Chain D, Crystal Structure Of Human Ferritin H8 As Biotemplate
For Noble Metal Nanoparticle Synthesis
pdb|2Z6M|E Chain E, Crystal Structure Of Human Ferritin H8 As Biotemplate
For Noble Metal Nanoparticle Synthesis
pdb|2Z6M|F Chain F, Crystal Structure Of Human Ferritin H8 As Biotemplate
For Noble Metal Nanoparticle Synthesis
pdb|2Z6M|G Chain G, Crystal Structure Of Human Ferritin H8 As Biotemplate
For Noble Metal Nanoparticle Synthesis
pdb|2Z6M|H Chain H, Crystal Structure Of Human Ferritin H8 As Biotemplate
For Noble Metal Nanoparticle Synthesis
pdb|2Z6M|I Chain I, Crystal Structure Of Human Ferritin H8 As Biotemplate
For Noble Metal Nanoparticle Synthesis
pdb|2Z6M|J Chain J, Crystal Structure Of Human Ferritin H8 As Biotemplate
For Noble Metal Nanoparticle Synthesis
pdb|2Z6M|K Chain K, Crystal Structure Of Human Ferritin H8 As Biotemplate
For Noble Metal Nanoparticle Synthesis
pdb|2Z6M|L Chain L, Crystal Structure Of Human Ferritin H8 As Biotemplate
For Noble Metal Nanoparticle Synthesis
Length = 176
Score = 33.5 bits (75), Expect = 0.033, Method: Compositional matrix adjust.
Identities = 16/38 (42%), Positives = 20/38 (52%)
Query: 16 HFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
+F RD V FAK+F + EER HA K + RG
Sbjct: 40 YFDRDDVALKNFAKYFLHQSHEERCHAEKLMKLQNQRG 77
>pdb|3SE1|A Chain A, Frog M-Ferritin With Magnesium, R72d Mutant
Length = 176
Score = 33.1 bits (74), Expect = 0.038, Method: Compositional matrix adjust.
Identities = 18/39 (46%), Positives = 21/39 (53%)
Query: 15 AHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
A F RD V A+FF + EEREHA KF+ Y G
Sbjct: 36 AFFDRDDVALHNVAEFFKEHSHEEREHAEKFMKYQNKDG 74
>pdb|1R03|A Chain A, Crystal Structure Of A Human Mitochondrial Ferritin
Length = 182
Score = 33.1 bits (74), Expect = 0.040, Method: Compositional matrix adjust.
Identities = 15/38 (39%), Positives = 21/38 (55%)
Query: 16 HFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
+FSRD V F+++F + EE EHA K + RG
Sbjct: 40 YFSRDDVALNNFSRYFLHQSREETEHAEKLMRLQNQRG 77
>pdb|1BG7|A Chain A, Localized Unfolding At The Junction Of Three Ferritin
Subunits. A Mechanism For Iron Release?
Length = 176
Score = 32.3 bits (72), Expect = 0.068, Method: Compositional matrix adjust.
Identities = 16/38 (42%), Positives = 20/38 (52%)
Query: 16 HFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
+F RD + AKFF + EEREHA K + RG
Sbjct: 37 YFDRDDIALHNVAKFFKEQSHEEREHAEKLMKDQNKRG 74
>pdb|1Z6O|A Chain A, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
pdb|1Z6O|B Chain B, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
pdb|1Z6O|C Chain C, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
pdb|1Z6O|D Chain D, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
pdb|1Z6O|E Chain E, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
pdb|1Z6O|F Chain F, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
pdb|1Z6O|G Chain G, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
pdb|1Z6O|H Chain H, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
pdb|1Z6O|I Chain I, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
pdb|1Z6O|J Chain J, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
pdb|1Z6O|K Chain K, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
pdb|1Z6O|L Chain L, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
Length = 212
Score = 32.3 bits (72), Expect = 0.074, Method: Compositional matrix adjust.
Identities = 16/55 (29%), Positives = 26/55 (47%)
Query: 7 SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRGNLTDYHHH 61
S+ A+F+ NR GF+K F + E I I ++T RG+ ++ H
Sbjct: 52 SYDYLLSAAYFNNYQTNRAGFSKLFKKLSDEAWSKTIDIIKHVTKRGDKMNFDQH 106
>pdb|3AF9|X Chain X, Crystal Structure Of Pd(Allyl)APO-C48afr
Length = 174
Score = 31.2 bits (69), Expect = 0.17, Method: Compositional matrix adjust.
Identities = 17/47 (36%), Positives = 23/47 (48%)
Query: 7 SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
S+ + G +F RD V G A FF A E+RE A + + RG
Sbjct: 27 SYTYLSLGFYFDRDDVALEGVAHFFRELAEEKREGAERLLKMQNQRG 73
>pdb|3QD8|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
pdb|3QD8|B Chain B, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
pdb|3QD8|C Chain C, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
pdb|3QD8|D Chain D, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
pdb|3QD8|E Chain E, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
pdb|3QD8|F Chain F, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
pdb|3QD8|G Chain G, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
pdb|3QD8|H Chain H, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
pdb|3QD8|I Chain I, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
pdb|3QD8|J Chain J, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
pdb|3QD8|K Chain K, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
pdb|3QD8|L Chain L, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
pdb|3QD8|M Chain M, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
pdb|3QD8|N Chain N, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
pdb|3QD8|O Chain O, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
pdb|3QD8|P Chain P, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
pdb|3QD8|Q Chain Q, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
pdb|3QD8|R Chain R, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
pdb|3QD8|S Chain S, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
pdb|3QD8|T Chain T, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
pdb|3QD8|U Chain U, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
pdb|3QD8|V Chain V, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
pdb|3QD8|W Chain W, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
pdb|3QD8|X Chain X, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
Length = 181
Score = 30.8 bits (68), Expect = 0.20, Method: Compositional matrix adjust.
Identities = 13/33 (39%), Positives = 19/33 (57%)
Query: 20 DCVNRPGFAKFFFTSASEEREHAIKFISYLTMR 52
D + P AK F++ A EER HA+ + +L R
Sbjct: 37 DSEDLPQLAKHFYSQAVEERNHAMMLVQHLLDR 69
>pdb|3OJ5|A Chain A, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3OJ5|B Chain B, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3OJ5|C Chain C, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3OJ5|D Chain D, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3OJ5|E Chain E, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3OJ5|F Chain F, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3OJ5|G Chain G, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3OJ5|H Chain H, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3OJ5|I Chain I, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3OJ5|J Chain J, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3OJ5|K Chain K, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3OJ5|L Chain L, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3OJ5|M Chain M, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3OJ5|N Chain N, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3OJ5|O Chain O, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3OJ5|P Chain P, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3OJ5|Q Chain Q, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3OJ5|R Chain R, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3OJ5|S Chain S, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3OJ5|T Chain T, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3OJ5|U Chain U, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3OJ5|V Chain V, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3OJ5|W Chain W, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3OJ5|X Chain X, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3UNO|A Chain A, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3UNO|B Chain B, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3UNO|C Chain C, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3UNO|D Chain D, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3UNO|E Chain E, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3UNO|F Chain F, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3UNO|G Chain G, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3UNO|H Chain H, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3UNO|I Chain I, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3UNO|J Chain J, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3UNO|K Chain K, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3UNO|L Chain L, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3UNO|M Chain M, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3UNO|N Chain N, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3UNO|O Chain O, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3UNO|P Chain P, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3UNO|Q Chain Q, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3UNO|R Chain R, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3UNO|S Chain S, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3UNO|T Chain T, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3UNO|U Chain U, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3UNO|V Chain V, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3UNO|W Chain W, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
pdb|3UNO|X Chain X, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
Length = 189
Score = 30.8 bits (68), Expect = 0.20, Method: Compositional matrix adjust.
Identities = 13/33 (39%), Positives = 19/33 (57%)
Query: 20 DCVNRPGFAKFFFTSASEEREHAIKFISYLTMR 52
D + P AK F++ A EER HA+ + +L R
Sbjct: 37 DSEDLPQLAKHFYSQAVEERNHAMMLVQHLLDR 69
>pdb|3NP2|X Chain X, Crystal Structure Of Pd(Allyl)APO-E45cC48A-Rhlfr
Length = 174
Score = 30.0 bits (66), Expect = 0.30, Method: Compositional matrix adjust.
Identities = 17/47 (36%), Positives = 23/47 (48%)
Query: 7 SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
S+ + G +F RD V G A FF A E+RE A + + RG
Sbjct: 27 SYTYLSLGFYFDRDDVALCGVAHFFRELAEEKREGAERLLKMQNQRG 73
>pdb|2ZG8|X Chain X, Crystal Structure Of Pd(Allyl)APO-H49afr
pdb|3FI6|A Chain A, Apo-H49afr With High Content Of Pd Ions
pdb|3O7R|A Chain A, Crystal Structure Of Ru(P-Cymene)APO-H49afr
Length = 174
Score = 29.6 bits (65), Expect = 0.45, Method: Compositional matrix adjust.
Identities = 16/47 (34%), Positives = 22/47 (46%)
Query: 7 SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
S+ + G +F RD V G FF A E+RE A + + RG
Sbjct: 27 SYTYLSLGFYFDRDDVALEGVCAFFRELAEEKREGAERLLKMQNQRG 73
>pdb|3NP0|X Chain X, Crystal Structure Of Pd(Allyl)APO-E45cH49AR52H-Rhlfr
Length = 174
Score = 29.3 bits (64), Expect = 0.57, Method: Compositional matrix adjust.
Identities = 16/47 (34%), Positives = 22/47 (46%)
Query: 7 SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
S+ + G +F RD V G FF A E+RE A + + RG
Sbjct: 27 SYTYLSLGFYFDRDDVALCGVCAFFHELAEEKREGAERLLKMQNQRG 73
>pdb|1KRQ|A Chain A, Crystal Structure Analysis Of Campylobacter Jejuni
Ferritin
Length = 167
Score = 29.3 bits (64), Expect = 0.57, Method: Compositional matrix adjust.
Identities = 17/34 (50%), Positives = 19/34 (55%), Gaps = 4/34 (11%)
Query: 26 GFAKFFFTSASEEREHAIKFISYLTMRGNLTDYH 59
G F F ASEE +HA K I+YL N TD H
Sbjct: 38 GAGAFLFAHASEESDHAKKLITYL----NETDSH 67
>pdb|1IES|A Chain A, Tetragonal Crystal Structure Of Native Horse Spleen
Ferritin
pdb|1IES|B Chain B, Tetragonal Crystal Structure Of Native Horse Spleen
Ferritin
pdb|1IES|C Chain C, Tetragonal Crystal Structure Of Native Horse Spleen
Ferritin
pdb|1IES|D Chain D, Tetragonal Crystal Structure Of Native Horse Spleen
Ferritin
pdb|1IES|E Chain E, Tetragonal Crystal Structure Of Native Horse Spleen
Ferritin
pdb|1IES|F Chain F, Tetragonal Crystal Structure Of Native Horse Spleen
Ferritin
pdb|1GWG|A Chain A, Tri-Iodide Derivative Of Apoferritin
pdb|1XZ1|A Chain A, Complex Of Halothane With Apoferritin
pdb|1XZ3|A Chain A, Complex Of Apoferritin With Isoflurane
pdb|1HRS|A Chain A, A Crystallographic Study Of Haem Binding To Ferritin
pdb|1IER|A Chain A, Cubic Crystal Structure Of Native Horse Spleen Ferritin
pdb|2Z5Q|A Chain A, Apo-Fr With Intermediate Content Of Pd Ion
pdb|2Z5R|A Chain A, Apo-Fr With High Content Of Pd Ions
pdb|2W0O|A Chain A, Horse Spleen Apoferritin
pdb|2ZG7|X Chain X, Crystal Structure Of Pd(Allyl)APO-Fr
pdb|3F32|A Chain A, Horse Spleen Apoferritin
pdb|3F33|A Chain A, Apoferritin: Complex With Propofol
pdb|3F34|A Chain A, Apoferritin: Complex With 2,6-Diethylphenol
pdb|3F35|A Chain A, Apoferritin: Complex With 2,6-Diethylphenol
pdb|3F36|A Chain A, Apoferritin: Complex With 2-Isopropylphenol
pdb|3F37|A Chain A, Apoferritin: Complex With 2,6-Dimethylphenol
pdb|3F38|A Chain A, Apoferritin: Complex With 2,6-Dimethylphenol
pdb|3F39|A Chain A, Apoferritin: Complex With Phenol
pdb|3AF7|X Chain X, Crystal Structure Of 25pd(Allyl)APO-Fr
pdb|3O7S|A Chain A, Crystal Structure Of Ru(P-Cymene)APO-Fr
pdb|3RAV|A Chain A, Horse Spleen Apo-Ferritin With Bound Pentobarbital
pdb|3RD0|A Chain A, Horse Spleen Apo-Ferritin With Bound Thiopental
pdb|4DE6|A Chain A, Horse Spleen Apo-Ferritin Complex With Arachidonic Acid
pdb|3U90|A Chain A, Apoferritin: Complex With Sds
Length = 174
Score = 29.3 bits (64), Expect = 0.58, Method: Compositional matrix adjust.
Identities = 16/47 (34%), Positives = 22/47 (46%)
Query: 7 SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
S+ + G +F RD V G FF A E+RE A + + RG
Sbjct: 27 SYTYLSLGFYFDRDDVALEGVCHFFRELAEEKREGAERLLKMQNQRG 73
>pdb|2GYD|A Chain A, Complex Of Equine Apoferritin With The H-Diaziflurane
Photolabeling Reagent
Length = 170
Score = 29.3 bits (64), Expect = 0.60, Method: Compositional matrix adjust.
Identities = 16/47 (34%), Positives = 22/47 (46%)
Query: 7 SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
S+ + G +F RD V G FF A E+RE A + + RG
Sbjct: 26 SYTYLSLGFYFDRDDVALEGVCHFFRELAEEKREGAERLLKMQNQRG 72
>pdb|2ZA8|A Chain A, Recombinant Horse L-Chain Apoferritin N-Terminal
Deletion Mutant (Residues 1-8)
Length = 167
Score = 29.3 bits (64), Expect = 0.61, Method: Compositional matrix adjust.
Identities = 16/47 (34%), Positives = 22/47 (46%)
Query: 7 SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
S+ + G +F RD V G FF A E+RE A + + RG
Sbjct: 20 SYTYLSLGFYFDRDDVALEGVCHFFRELAEEKREGAERLLKMQNQRG 66
>pdb|2ZA7|A Chain A, Recombinant Horse L-Chain Apoferritin N-Terminal
Deletion Mutant (Residues 1-4)
Length = 171
Score = 29.3 bits (64), Expect = 0.61, Method: Compositional matrix adjust.
Identities = 16/47 (34%), Positives = 22/47 (46%)
Query: 7 SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
S+ + G +F RD V G FF A E+RE A + + RG
Sbjct: 24 SYTYLSLGFYFDRDDVALEGVCHFFRELAEEKREGAERLLKMQNQRG 70
>pdb|3AF8|X Chain X, Crystal Structure Of Pd(Ally)APO-C126afr
Length = 174
Score = 29.3 bits (64), Expect = 0.62, Method: Compositional matrix adjust.
Identities = 16/47 (34%), Positives = 22/47 (46%)
Query: 7 SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
S+ + G +F RD V G FF A E+RE A + + RG
Sbjct: 27 SYTYLSLGFYFDRDDVALEGVCHFFRELAEEKREGAERLLKMQNQRG 73
>pdb|2ZUR|X Chain X, Crystal Structure Of Rh(Nbd)APO-Fr
Length = 174
Score = 29.3 bits (64), Expect = 0.62, Method: Compositional matrix adjust.
Identities = 16/47 (34%), Positives = 22/47 (46%)
Query: 7 SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
S+ + G +F RD V G FF A E+RE A + + RG
Sbjct: 27 SYTYLSLGFYFDRDDVALEGVXHFFRELAEEKREGAERLLKMQNQRG 73
>pdb|2ZA6|A Chain A, Recombinant Horse L-Chain Apoferritin
pdb|2V2I|A Chain A, Wild Type Recombinant Horse Spleen Apoferritin
Cocrystallized With Haemin In Acidic Conditions
pdb|2V2J|A Chain A, Wild Type Recombinant Horse Spleen Apoferritin
Cocrystallized With Haemin In Basic Conditions
Length = 175
Score = 29.3 bits (64), Expect = 0.64, Method: Compositional matrix adjust.
Identities = 16/47 (34%), Positives = 22/47 (46%)
Query: 7 SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
S+ + G +F RD V G FF A E+RE A + + RG
Sbjct: 28 SYTYLSLGFYFDRDDVALEGVCHFFRELAEEKREGAERLLKMQNQRG 74
>pdb|2G4H|A Chain A, Anomalous Substructure Of Apoferritin
pdb|1AEW|A Chain A, L-Chain Horse Apoferritin
pdb|1DAT|A Chain A, Cubic Crystal Structure Recombinant Horse L Apoferritin
pdb|2Z5P|A Chain A, Apo-fr With Low Content Of Pd Ions
pdb|3H7G|A Chain A, Apo-Fr With Au Ions
Length = 174
Score = 29.3 bits (64), Expect = 0.66, Method: Compositional matrix adjust.
Identities = 16/47 (34%), Positives = 22/47 (46%)
Query: 7 SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
S+ + G +F RD V G FF A E+RE A + + RG
Sbjct: 27 SYTYLSLGFYFDRDDVALEGVCHFFRELAEEKREGAERLLKMQNQRG 73
>pdb|2ZG9|X Chain X, Crystal Structure Of Pd(Allyl)APO-H114afr
Length = 174
Score = 28.9 bits (63), Expect = 0.69, Method: Compositional matrix adjust.
Identities = 16/47 (34%), Positives = 22/47 (46%)
Query: 7 SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
S+ + G +F RD V G FF A E+RE A + + RG
Sbjct: 27 SYTYLSLGFYFDRDDVALEGVCHFFRELAEEKREGAERLLKMQNQRG 73
>pdb|3NOZ|X Chain X, Crystal Structure Of Pd(Allyl)APO-E45cR52H-Rhlfr
Length = 174
Score = 28.9 bits (63), Expect = 0.84, Method: Compositional matrix adjust.
Identities = 16/47 (34%), Positives = 22/47 (46%)
Query: 7 SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
S+ + G +F RD V G FF A E+RE A + + RG
Sbjct: 27 SYTYLSLGFYFDRDDVALCGVCHFFHELAEEKREGAERLLKMQNQRG 73
>pdb|1VLG|A Chain A, Crystal Structure Of Ferritin (Tm1128) From Thermotoga
Maritima At 2.00 A Resolution
pdb|1VLG|B Chain B, Crystal Structure Of Ferritin (Tm1128) From Thermotoga
Maritima At 2.00 A Resolution
pdb|1VLG|C Chain C, Crystal Structure Of Ferritin (Tm1128) From Thermotoga
Maritima At 2.00 A Resolution
pdb|1VLG|D Chain D, Crystal Structure Of Ferritin (Tm1128) From Thermotoga
Maritima At 2.00 A Resolution
pdb|1VLG|E Chain E, Crystal Structure Of Ferritin (Tm1128) From Thermotoga
Maritima At 2.00 A Resolution
pdb|1VLG|F Chain F, Crystal Structure Of Ferritin (Tm1128) From Thermotoga
Maritima At 2.00 A Resolution
pdb|1VLG|G Chain G, Crystal Structure Of Ferritin (Tm1128) From Thermotoga
Maritima At 2.00 A Resolution
pdb|1VLG|H Chain H, Crystal Structure Of Ferritin (Tm1128) From Thermotoga
Maritima At 2.00 A Resolution
Length = 176
Score = 28.1 bits (61), Expect = 1.2, Method: Compositional matrix adjust.
Identities = 13/29 (44%), Positives = 16/29 (55%)
Query: 25 PGFAKFFFTSASEEREHAIKFISYLTMRG 53
GFA + A EE HA+KF Y+ RG
Sbjct: 51 KGFAHWMKKQAQEELTHAMKFYEYIYERG 79
>pdb|1Z4A|A Chain A, Ferritin From T. Maritima
pdb|1Z4A|B Chain B, Ferritin From T. Maritima
pdb|1Z4A|C Chain C, Ferritin From T. Maritima
pdb|1Z4A|D Chain D, Ferritin From T. Maritima
pdb|1Z4A|E Chain E, Ferritin From T. Maritima
pdb|1Z4A|F Chain F, Ferritin From T. Maritima
pdb|1Z4A|G Chain G, Ferritin From T. Maritima
pdb|1Z4A|H Chain H, Ferritin From T. Maritima
Length = 164
Score = 28.1 bits (61), Expect = 1.2, Method: Compositional matrix adjust.
Identities = 13/29 (44%), Positives = 16/29 (55%)
Query: 25 PGFAKFFFTSASEEREHAIKFISYLTMRG 53
GFA + A EE HA+KF Y+ RG
Sbjct: 39 KGFAHWMKKQAQEELTHAMKFYEYIYERG 67
>pdb|1CLY|H Chain H, Igg Fab (Human Igg1, Kappa) Chimeric Fragment (Cbr96)
Complexed With Lewis Y Nonoate Methyl Ester
pdb|1UCB|H Chain H, Structure Of Uncomplexed Fab Compared To Complex (1cly,
1clz)
Length = 219
Score = 28.1 bits (61), Expect = 1.3, Method: Composition-based stats.
Identities = 12/51 (23%), Positives = 25/51 (49%), Gaps = 1/51 (1%)
Query: 9 GRFAPGAHFSRDCVNRP-GFAKFFFTSASEEREHAIKFISYLTMRGNLTDY 58
G PG CV F+ ++ + E +++++Y++ G++TDY
Sbjct: 10 GLVQPGGSLKVSCVTSGFTFSDYYMYWVRQTPEKRLEWVAYISQGGDITDY 60
>pdb|1CLZ|H Chain H, Igg Fab (Igg3, Kappa) Fragment (Mbr96) Complexed With
Lewis Y Nonoate Methyl Ester
Length = 218
Score = 28.1 bits (61), Expect = 1.3, Method: Composition-based stats.
Identities = 12/51 (23%), Positives = 25/51 (49%), Gaps = 1/51 (1%)
Query: 9 GRFAPGAHFSRDCVNRP-GFAKFFFTSASEEREHAIKFISYLTMRGNLTDY 58
G PG CV F+ ++ + E +++++Y++ G++TDY
Sbjct: 10 GLVQPGGSLKVSCVTSGFTFSDYYMYWVRQTPEKRLEWVAYISQGGDITDY 60
>pdb|1H96|A Chain A, Recombinant Mouse L-Chain Ferritin
pdb|1LB3|A Chain A, Structure Of Recombinant Mouse L Chain Ferritin At 1.2 A
Resolution
Length = 182
Score = 27.3 bits (59), Expect = 2.3, Method: Compositional matrix adjust.
Identities = 16/47 (34%), Positives = 22/47 (46%)
Query: 7 SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
S+ + G F RD V G FF A E+RE A + + + RG
Sbjct: 27 SYTYLSLGFFFDRDDVALEGVGHFFRELAEEKREGAERLLEFQNDRG 73
>pdb|2V2L|A Chain A, Mutant (E53,56,57,60q) Recombinant Horse Spleen
Apoferritin Cocrystallized With Haemin In Acidic
Conditions
pdb|2V2M|A Chain A, Mutant (E53,56,57,60q) Recombinant Horse Spleen
Apoferritin Cocrystallized With Haemin In Basic
Conditions
Length = 174
Score = 27.3 bits (59), Expect = 2.5, Method: Compositional matrix adjust.
Identities = 14/47 (29%), Positives = 22/47 (46%)
Query: 7 SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
S+ + G +F RD V G FF A ++R+ A + + RG
Sbjct: 27 SYTYLSLGFYFDRDDVALEGVCHFFRQLAQQKRQGAERLLKMQNQRG 73
>pdb|2FG4|A Chain A, Structure Of Human Ferritin L Chain
pdb|2FG8|A Chain A, Structure Of Human Ferritin L Chain
pdb|2FG8|B Chain B, Structure Of Human Ferritin L Chain
pdb|2FG8|C Chain C, Structure Of Human Ferritin L Chain
pdb|2FG8|D Chain D, Structure Of Human Ferritin L Chain
pdb|2FG8|E Chain E, Structure Of Human Ferritin L Chain
pdb|2FG8|F Chain F, Structure Of Human Ferritin L Chain
pdb|2FG8|G Chain G, Structure Of Human Ferritin L Chain
pdb|2FG8|H Chain H, Structure Of Human Ferritin L Chain
Length = 174
Score = 26.9 bits (58), Expect = 2.6, Method: Compositional matrix adjust.
Identities = 15/47 (31%), Positives = 22/47 (46%)
Query: 7 SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
S+ + G +F RD V G + FF A E+RE + + RG
Sbjct: 27 SYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRG 73
>pdb|2FFX|J Chain J, Structure Of Human Ferritin L. Chain
Length = 173
Score = 26.9 bits (58), Expect = 2.7, Method: Compositional matrix adjust.
Identities = 15/47 (31%), Positives = 22/47 (46%)
Query: 7 SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
S+ + G +F RD V G + FF A E+RE + + RG
Sbjct: 27 SYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRG 73
>pdb|3HX2|A Chain A, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|AA Chain a, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|B Chain B, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|BB Chain b, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|C Chain C, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|CC Chain c, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|D Chain D, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|DD Chain d, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|E Chain E, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|EE Chain e, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|F Chain F, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|FF Chain f, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|G Chain G, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|GG Chain g, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|H Chain H, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|HH Chain h, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|I Chain I, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|II Chain i, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|J Chain J, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|JJ Chain j, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|K Chain K, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|KK Chain k, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|L Chain L, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|LL Chain l, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|M Chain M, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|MM Chain m, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|N Chain N, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|NN Chain n, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|O Chain O, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|OO Chain o, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|P Chain P, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|PP Chain p, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|Q Chain Q, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|QQ Chain q, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|R Chain R, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|RR Chain r, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|S Chain S, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|SS Chain s, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|T Chain T, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|TT Chain t, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|U Chain U, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|UU Chain u, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|V Chain V, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|VV Chain v, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|W Chain W, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|WW Chain w, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|X Chain X, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX2|XX Chain x, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|A Chain A, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|AA Chain a, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|B Chain B, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|BB Chain b, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|C Chain C, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|CC Chain c, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|D Chain D, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|DD Chain d, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|E Chain E, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|EE Chain e, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|F Chain F, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|FF Chain f, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|G Chain G, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|GG Chain g, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|H Chain H, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|HH Chain h, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|I Chain I, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|II Chain i, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|J Chain J, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|JJ Chain j, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|K Chain K, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|KK Chain k, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|L Chain L, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|LL Chain l, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|M Chain M, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|MM Chain m, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|N Chain N, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|NN Chain n, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|O Chain O, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|OO Chain o, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|P Chain P, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|PP Chain p, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|Q Chain Q, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|QQ Chain q, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|R Chain R, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|RR Chain r, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|S Chain S, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|SS Chain s, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|T Chain T, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|TT Chain t, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|U Chain U, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|UU Chain u, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|V Chain V, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|VV Chain v, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|W Chain W, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|WW Chain w, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|X Chain X, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX5|XX Chain x, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|A Chain A, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|AA Chain a, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|B Chain B, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|BB Chain b, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|C Chain C, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|CC Chain c, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|D Chain D, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|DD Chain d, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|E Chain E, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|EE Chain e, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|F Chain F, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|FF Chain f, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|G Chain G, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|GG Chain g, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|H Chain H, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|HH Chain h, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|I Chain I, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|II Chain i, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|J Chain J, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|JJ Chain j, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|K Chain K, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|KK Chain k, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|L Chain L, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|LL Chain l, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|M Chain M, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|MM Chain m, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|N Chain N, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|NN Chain n, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|O Chain O, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|OO Chain o, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|P Chain P, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|PP Chain p, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|Q Chain Q, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|QQ Chain q, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|R Chain R, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|RR Chain r, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|S Chain S, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|SS Chain s, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|T Chain T, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|TT Chain t, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|U Chain U, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|UU Chain u, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|V Chain V, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|VV Chain v, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|W Chain W, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|WW Chain w, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|X Chain X, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
pdb|3HX7|XX Chain x, Crystal Structure Of Human Ferritin Phe167serfsx26
Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
The Biological Unit That Are Present In The
Crystallographic Asymmetric Unit. The Entire Structure
Contains Six Copies Of The Biological Unit In The
Crystallographic Asymmetric Unit And Is Described In
Remark 400
Length = 192
Score = 26.6 bits (57), Expect = 3.7, Method: Compositional matrix adjust.
Identities = 15/47 (31%), Positives = 22/47 (46%)
Query: 7 SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
S+ + G +F RD V G + FF A E+RE + + RG
Sbjct: 29 SYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRG 75
>pdb|3KXU|A Chain A, Crystal Structure Of Human Ferritin Ftl498instc
Pathogenic M
Length = 191
Score = 26.6 bits (57), Expect = 3.7, Method: Compositional matrix adjust.
Identities = 15/47 (31%), Positives = 22/47 (46%)
Query: 7 SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
S+ + G +F RD V G + FF A E+RE + + RG
Sbjct: 28 SYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRG 74
>pdb|3E6R|A Chain A, Crystal Structure Of Apo-Ferritin From Pseudo-Nitzschia
Multiseries
pdb|3E6R|B Chain B, Crystal Structure Of Apo-Ferritin From Pseudo-Nitzschia
Multiseries
pdb|3E6R|C Chain C, Crystal Structure Of Apo-Ferritin From Pseudo-Nitzschia
Multiseries
pdb|3E6R|D Chain D, Crystal Structure Of Apo-Ferritin From Pseudo-Nitzschia
Multiseries
pdb|3E6R|E Chain E, Crystal Structure Of Apo-Ferritin From Pseudo-Nitzschia
Multiseries
pdb|3E6R|F Chain F, Crystal Structure Of Apo-Ferritin From Pseudo-Nitzschia
Multiseries
pdb|3E6S|A Chain A, Crystal Structure Of Ferritin Soaked With Iron From
Pseudo- Nitzschia Multiseries
pdb|3E6S|B Chain B, Crystal Structure Of Ferritin Soaked With Iron From
Pseudo- Nitzschia Multiseries
pdb|3E6S|C Chain C, Crystal Structure Of Ferritin Soaked With Iron From
Pseudo- Nitzschia Multiseries
pdb|3E6S|D Chain D, Crystal Structure Of Ferritin Soaked With Iron From
Pseudo- Nitzschia Multiseries
pdb|3E6S|E Chain E, Crystal Structure Of Ferritin Soaked With Iron From
Pseudo- Nitzschia Multiseries
pdb|3E6S|F Chain F, Crystal Structure Of Ferritin Soaked With Iron From
Pseudo- Nitzschia Multiseries
Length = 168
Score = 26.6 bits (57), Expect = 3.7, Method: Compositional matrix adjust.
Identities = 9/28 (32%), Positives = 15/28 (53%)
Query: 26 GFAKFFFTSASEEREHAIKFISYLTMRG 53
G A + ++EEREH + F+ + R
Sbjct: 37 GMAAYMLAESAEEREHGLGFVDFANKRN 64
>pdb|2V2N|A Chain A, Mutant R59m Recombinant Horse Spleen Apoferritin
Cocrystallized With Haemin In Acidic Conditions
pdb|2V2O|A Chain A, Mutant R59m Recombinant Horse Spleen Apoferritin
Cocrystallized With Haemin In Basic Conditions
pdb|2V2S|A Chain A, Mutant R59m Recombinant Horse Spleen Apoferritin
Crystallized In Acidic Conditions
Length = 174
Score = 26.2 bits (56), Expect = 4.5, Method: Compositional matrix adjust.
Identities = 15/47 (31%), Positives = 21/47 (44%)
Query: 7 SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
S+ + G +F RD V G FF A E+ E A + + RG
Sbjct: 27 SYTYLSLGFYFDRDDVALEGVCHFFRELAEEKMEGAERLLKMQNQRG 73
>pdb|2JD6|0 Chain 0, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|1 Chain 1, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|2 Chain 2, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|3 Chain 3, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|4 Chain 4, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|5 Chain 5, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|6 Chain 6, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|7 Chain 7, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|8 Chain 8, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|9 Chain 9, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|A Chain A, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|B Chain B, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|C Chain C, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|D Chain D, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|E Chain E, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|F Chain F, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|G Chain G, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|H Chain H, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|I Chain I, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|J Chain J, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|K Chain K, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|L Chain L, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|M Chain M, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|N Chain N, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|O Chain O, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|P Chain P, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|Q Chain Q, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|R Chain R, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|S Chain S, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|T Chain T, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|U Chain U, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|V Chain V, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|W Chain W, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|X Chain X, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|Y Chain Y, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD6|Z Chain Z, Crystal Structure Of The As Isolated Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|0 Chain 0, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|1 Chain 1, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|2 Chain 2, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|3 Chain 3, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|4 Chain 4, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|5 Chain 5, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|6 Chain 6, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|7 Chain 7, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|8 Chain 8, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|9 Chain 9, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|A Chain A, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|B Chain B, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|C Chain C, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|D Chain D, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|E Chain E, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|F Chain F, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|G Chain G, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|H Chain H, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|I Chain I, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|J Chain J, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|K Chain K, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|L Chain L, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|M Chain M, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|N Chain N, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|O Chain O, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|P Chain P, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|Q Chain Q, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|R Chain R, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|S Chain S, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|T Chain T, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|U Chain U, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|V Chain V, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|W Chain W, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|X Chain X, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|Y Chain Y, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD7|Z Chain Z, Crystal Structure Of The Fe-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|0 Chain 0, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|1 Chain 1, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|2 Chain 2, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|3 Chain 3, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|4 Chain 4, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|5 Chain 5, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|6 Chain 6, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|7 Chain 7, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|8 Chain 8, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|9 Chain 9, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|A Chain A, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|B Chain B, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|C Chain C, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|D Chain D, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|E Chain E, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|F Chain F, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|G Chain G, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|H Chain H, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|I Chain I, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|J Chain J, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|K Chain K, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|L Chain L, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|M Chain M, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|N Chain N, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|O Chain O, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|P Chain P, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|Q Chain Q, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|R Chain R, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|S Chain S, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|T Chain T, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|U Chain U, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|V Chain V, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|W Chain W, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|X Chain X, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|Y Chain Y, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
pdb|2JD8|Z Chain Z, Crystal Structure Of The Zn-Soaked Ferritin From The
Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
Length = 174
Score = 25.8 bits (55), Expect = 6.8, Method: Compositional matrix adjust.
Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 2/43 (4%)
Query: 11 FAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
FA A+F + + GFA + A EE HA++F +Y+ R
Sbjct: 25 FAMAAYF--EDLGLEGFANWMKAQAEEEIGHALRFYNYIYDRN 65
>pdb|2X17|0 Chain 0, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
Loaded With Ag(I)
pdb|2X17|1 Chain 1, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
Loaded With Ag(I)
pdb|2X17|2 Chain 2, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
Loaded With Ag(I)
pdb|2X17|3 Chain 3, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
Loaded With Ag(I)
pdb|2X17|4 Chain 4, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
Loaded With Ag(I)
pdb|2X17|5 Chain 5, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
Loaded With Ag(I)
pdb|2X17|6 Chain 6, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
Loaded With Ag(I)
pdb|2X17|7 Chain 7, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
Loaded With Ag(I)
pdb|2X17|8 Chain 8, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
Loaded With Ag(I)
pdb|2X17|9 Chain 9, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
Loaded With Ag(I)
pdb|2X17|G Chain G, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
Loaded With Ag(I)
pdb|2X17|H Chain H, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
Loaded With Ag(I)
pdb|2X17|I Chain I, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
Loaded With Ag(I)
pdb|2X17|J Chain J, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
Loaded With Ag(I)
pdb|2X17|K Chain K, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
Loaded With Ag(I)
pdb|2X17|L Chain L, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
Loaded With Ag(I)
pdb|2X17|M Chain M, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
Loaded With Ag(I)
pdb|2X17|N Chain N, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
Loaded With Ag(I)
pdb|2X17|O Chain O, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
Loaded With Ag(I)
pdb|2X17|P Chain P, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
Loaded With Ag(I)
pdb|2X17|Q Chain Q, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
Loaded With Ag(I)
pdb|2X17|R Chain R, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
Loaded With Ag(I)
pdb|2X17|Y Chain Y, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
Loaded With Ag(I)
pdb|2X17|Z Chain Z, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
Loaded With Ag(I)
Length = 173
Score = 25.8 bits (55), Expect = 7.0, Method: Compositional matrix adjust.
Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 2/43 (4%)
Query: 11 FAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
FA A+F + + GFA + A EE HA++F +Y+ R
Sbjct: 25 FAMAAYF--EDLGLEGFANWMKAQAEEEIGHALRFYNYIYDRN 65
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.139 0.434
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,382,224
Number of Sequences: 62578
Number of extensions: 71755
Number of successful extensions: 388
Number of sequences better than 100.0: 63
Number of HSP's better than 100.0 without gapping: 60
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 328
Number of HSP's gapped (non-prelim): 63
length of query: 71
length of database: 14,973,337
effective HSP length: 41
effective length of query: 30
effective length of database: 12,407,639
effective search space: 372229170
effective search space used: 372229170
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 45 (21.9 bits)