BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy15457
         (71 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1Z6O|M Chain M, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
 pdb|1Z6O|N Chain N, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
 pdb|1Z6O|O Chain O, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
 pdb|1Z6O|P Chain P, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
 pdb|1Z6O|Q Chain Q, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
 pdb|1Z6O|R Chain R, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
 pdb|1Z6O|S Chain S, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
 pdb|1Z6O|T Chain T, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
 pdb|1Z6O|U Chain U, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
 pdb|1Z6O|V Chain V, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
 pdb|1Z6O|W Chain W, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
 pdb|1Z6O|X Chain X, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
          Length = 191

 Score = 80.9 bits (198), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 46/67 (68%)

Query: 3  EDGDSHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRGNLTDYHHHV 62
          E G S    A GAHFS+D VNRPGFA+ FF +ASEEREHA+K I YL MRG LT+    +
Sbjct: 32 EVGASLQYLAMGAHFSKDVVNRPGFAQLFFDAASEEREHAMKLIEYLLMRGELTNDVSSL 91

Query: 63 LSIIPST 69
          L + P T
Sbjct: 92 LQVRPPT 98


>pdb|3VNX|A Chain A, Crystal Structure Of Ferritin From Multicellular Green
           Algae, Ulva Pertusa
          Length = 204

 Score = 46.2 bits (108), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/39 (53%), Positives = 27/39 (69%)

Query: 15  AHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
           ++F+RD V  PGFAKFF  ++ EEREHA   + Y T RG
Sbjct: 63  SYFARDNVGLPGFAKFFKEASDEEREHAHMLMDYQTKRG 101


>pdb|3A9Q|A Chain A, Crystal Structure Analysis Of E173a Variant Of The Soybean
           Ferritin Sfer4
 pdb|3A9Q|B Chain B, Crystal Structure Analysis Of E173a Variant Of The Soybean
           Ferritin Sfer4
 pdb|3A9Q|C Chain C, Crystal Structure Analysis Of E173a Variant Of The Soybean
           Ferritin Sfer4
 pdb|3A9Q|D Chain D, Crystal Structure Analysis Of E173a Variant Of The Soybean
           Ferritin Sfer4
 pdb|3A9Q|E Chain E, Crystal Structure Analysis Of E173a Variant Of The Soybean
           Ferritin Sfer4
 pdb|3A9Q|F Chain F, Crystal Structure Analysis Of E173a Variant Of The Soybean
           Ferritin Sfer4
 pdb|3A9Q|G Chain G, Crystal Structure Analysis Of E173a Variant Of The Soybean
           Ferritin Sfer4
 pdb|3A9Q|H Chain H, Crystal Structure Analysis Of E173a Variant Of The Soybean
           Ferritin Sfer4
 pdb|3A9Q|I Chain I, Crystal Structure Analysis Of E173a Variant Of The Soybean
           Ferritin Sfer4
 pdb|3A9Q|J Chain J, Crystal Structure Analysis Of E173a Variant Of The Soybean
           Ferritin Sfer4
 pdb|3A9Q|K Chain K, Crystal Structure Analysis Of E173a Variant Of The Soybean
           Ferritin Sfer4
 pdb|3A9Q|L Chain L, Crystal Structure Analysis Of E173a Variant Of The Soybean
           Ferritin Sfer4
 pdb|3A9Q|M Chain M, Crystal Structure Analysis Of E173a Variant Of The Soybean
           Ferritin Sfer4
 pdb|3A9Q|N Chain N, Crystal Structure Analysis Of E173a Variant Of The Soybean
           Ferritin Sfer4
 pdb|3A9Q|O Chain O, Crystal Structure Analysis Of E173a Variant Of The Soybean
           Ferritin Sfer4
 pdb|3A9Q|P Chain P, Crystal Structure Analysis Of E173a Variant Of The Soybean
           Ferritin Sfer4
 pdb|3A9Q|Q Chain Q, Crystal Structure Analysis Of E173a Variant Of The Soybean
           Ferritin Sfer4
 pdb|3A9Q|R Chain R, Crystal Structure Analysis Of E173a Variant Of The Soybean
           Ferritin Sfer4
 pdb|3A9Q|S Chain S, Crystal Structure Analysis Of E173a Variant Of The Soybean
           Ferritin Sfer4
 pdb|3A9Q|T Chain T, Crystal Structure Analysis Of E173a Variant Of The Soybean
           Ferritin Sfer4
 pdb|3A9Q|U Chain U, Crystal Structure Analysis Of E173a Variant Of The Soybean
           Ferritin Sfer4
 pdb|3A9Q|V Chain V, Crystal Structure Analysis Of E173a Variant Of The Soybean
           Ferritin Sfer4
 pdb|3A9Q|W Chain W, Crystal Structure Analysis Of E173a Variant Of The Soybean
           Ferritin Sfer4
 pdb|3A9Q|X Chain X, Crystal Structure Analysis Of E173a Variant Of The Soybean
           Ferritin Sfer4
          Length = 212

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/39 (53%), Positives = 24/39 (61%)

Query: 15  AHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
           A+F RD V   G AKFF  S+ EEREHA K + Y   RG
Sbjct: 68  AYFDRDNVALRGLAKFFKESSEEEREHAEKLMEYQNKRG 106


>pdb|3A68|A Chain A, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
           Binding Site That Functions As A Transit Site For Metal
           Transfer In Ferritin
 pdb|3A68|B Chain B, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
           Binding Site That Functions As A Transit Site For Metal
           Transfer In Ferritin
 pdb|3A68|C Chain C, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
           Binding Site That Functions As A Transit Site For Metal
           Transfer In Ferritin
 pdb|3A68|D Chain D, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
           Binding Site That Functions As A Transit Site For Metal
           Transfer In Ferritin
 pdb|3A68|E Chain E, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
           Binding Site That Functions As A Transit Site For Metal
           Transfer In Ferritin
 pdb|3A68|F Chain F, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
           Binding Site That Functions As A Transit Site For Metal
           Transfer In Ferritin
 pdb|3A68|G Chain G, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
           Binding Site That Functions As A Transit Site For Metal
           Transfer In Ferritin
 pdb|3A68|H Chain H, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
           Binding Site That Functions As A Transit Site For Metal
           Transfer In Ferritin
 pdb|3A68|I Chain I, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
           Binding Site That Functions As A Transit Site For Metal
           Transfer In Ferritin
 pdb|3A68|J Chain J, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
           Binding Site That Functions As A Transit Site For Metal
           Transfer In Ferritin
 pdb|3A68|K Chain K, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
           Binding Site That Functions As A Transit Site For Metal
           Transfer In Ferritin
 pdb|3A68|L Chain L, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
           Binding Site That Functions As A Transit Site For Metal
           Transfer In Ferritin
 pdb|3A68|M Chain M, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
           Binding Site That Functions As A Transit Site For Metal
           Transfer In Ferritin
 pdb|3A68|N Chain N, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
           Binding Site That Functions As A Transit Site For Metal
           Transfer In Ferritin
 pdb|3A68|O Chain O, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
           Binding Site That Functions As A Transit Site For Metal
           Transfer In Ferritin
 pdb|3A68|P Chain P, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
           Binding Site That Functions As A Transit Site For Metal
           Transfer In Ferritin
 pdb|3A68|Q Chain Q, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
           Binding Site That Functions As A Transit Site For Metal
           Transfer In Ferritin
 pdb|3A68|R Chain R, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
           Binding Site That Functions As A Transit Site For Metal
           Transfer In Ferritin
 pdb|3A68|S Chain S, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
           Binding Site That Functions As A Transit Site For Metal
           Transfer In Ferritin
 pdb|3A68|T Chain T, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
           Binding Site That Functions As A Transit Site For Metal
           Transfer In Ferritin
 pdb|3A68|U Chain U, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
           Binding Site That Functions As A Transit Site For Metal
           Transfer In Ferritin
 pdb|3A68|V Chain V, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
           Binding Site That Functions As A Transit Site For Metal
           Transfer In Ferritin
 pdb|3A68|W Chain W, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
           Binding Site That Functions As A Transit Site For Metal
           Transfer In Ferritin
 pdb|3A68|X Chain X, Crystal Structure Of Plant Ferritin Reveals A Novel Metal
           Binding Site That Functions As A Transit Site For Metal
           Transfer In Ferritin
          Length = 212

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/39 (53%), Positives = 24/39 (61%)

Query: 15  AHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
           A+F RD V   G AKFF  S+ EEREHA K + Y   RG
Sbjct: 68  AYFDRDNVALRGLAKFFKESSEEEREHAEKLMEYQNKRG 106


>pdb|1RCD|A Chain A, Bullfrog Red Cell L Ferritin TartrateMGPH 5.5
 pdb|1RCG|A Chain A, Bullfrog Red Cell L Ferritin SulfateMNPH 6.3
          Length = 173

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 24/40 (60%)

Query: 14 GAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
           ++F+RD V    FAKFF   + EE+EHA K I Y   RG
Sbjct: 35 ASYFNRDDVALSNFAKFFRERSEEEKEHAEKLIEYQNQRG 74


>pdb|1RCI|A Chain A, Bullfrog Red Cell L Ferritin TartrateMGPH 5.5
          Length = 173

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 27/47 (57%)

Query: 7  SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          S+   +  ++F+RD V    FAKFF   + EE+EHA K I Y   RG
Sbjct: 28 SYVYLSMASYFNRDDVALSNFAKFFRERSEEEKEHAEKLIEYQNQRG 74


>pdb|2CN7|A Chain A, Recombinant Human H Ferritin, K86q, E27d And E107d
          Mutant
 pdb|2IU2|A Chain A, Recombinant Human H Ferritin, K86q, E27d And E107d
          Mutant, Soaked With Zn Ions
          Length = 183

 Score = 37.4 bits (85), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 21/38 (55%)

Query: 16 HFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          +F RD V    FAK+F   + EEREHA K +     RG
Sbjct: 41 YFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78


>pdb|2CHI|A Chain A, Recombinant Human H Ferritin, K86q And E27d Mutant
 pdb|2CIH|A Chain A, Recombinant Human H Ferritin, K86q And E27d Mutant,
          Soaked With Zn
          Length = 183

 Score = 37.4 bits (85), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 21/38 (55%)

Query: 16 HFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          +F RD V    FAK+F   + EEREHA K +     RG
Sbjct: 41 YFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78


>pdb|2CLU|A Chain A, Recombinant Human H Ferritin, K86q And E107d Mutant
 pdb|2CN6|A Chain A, Recombinant Human H Ferritin, K86q And E107d Mutant,
          Soaked With Zn Ions
          Length = 183

 Score = 37.4 bits (85), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 21/38 (55%)

Query: 16 HFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          +F RD V    FAK+F   + EEREHA K +     RG
Sbjct: 41 YFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78


>pdb|2CEI|A Chain A, Recombinant Human H Ferritin, K86q Mutant, Soaked With
          Zn
 pdb|1FHA|A Chain A, Solving The Structure Of Human H Ferritin By Genetically
          Engineering Intermolecular Crystal Contacts
 pdb|2FHA|A Chain A, Human H Chain Ferritin
          Length = 183

 Score = 37.4 bits (85), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 21/38 (55%)

Query: 16 HFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          +F RD V    FAK+F   + EEREHA K +     RG
Sbjct: 41 YFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 78


>pdb|3AJQ|A Chain A, Crystal Structure Of Human H Ferritin E140q Mutant
          Length = 182

 Score = 37.4 bits (85), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 21/38 (55%)

Query: 16 HFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          +F RD V    FAK+F   + EEREHA K +     RG
Sbjct: 40 YFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 77


>pdb|3AJO|A Chain A, Crystal Structure Of Wild-Type Human Ferritin H Chain
          Length = 182

 Score = 37.4 bits (85), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 21/38 (55%)

Query: 16 HFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          +F RD V    FAK+F   + EEREHA K +     RG
Sbjct: 40 YFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 77


>pdb|3AJP|A Chain A, Crystal Structure Of Human H Ferritin E140a Mutant
          Length = 182

 Score = 37.4 bits (85), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 21/38 (55%)

Query: 16 HFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          +F RD V    FAK+F   + EEREHA K +     RG
Sbjct: 40 YFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG 77


>pdb|3KA9|A Chain A, Frog M-Ferritin, Eeh Mutant, With Cobalt
          Length = 176

 Score = 35.8 bits (81), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 22/39 (56%)

Query: 15 AHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          A F RD V     A+FF   + EEREHA KF+ Y   RG
Sbjct: 36 AFFDRDDVALHNVAEFFKEHSHEEREHAEKFMKYQNKRG 74


>pdb|3KA8|A Chain A, Frog M-Ferritin, Eqh Mutant, With Cobalt
          Length = 176

 Score = 35.8 bits (81), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 22/39 (56%)

Query: 15 AHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          A F RD V     A+FF   + EEREHA KF+ Y   RG
Sbjct: 36 AFFDRDDVALHNVAEFFKEHSHEEREHAEKFMKYQNKRG 74


>pdb|1MFR|A Chain A, Crystal Structure Of M Ferritin
 pdb|1MFR|B Chain B, Crystal Structure Of M Ferritin
 pdb|1MFR|C Chain C, Crystal Structure Of M Ferritin
 pdb|1MFR|D Chain D, Crystal Structure Of M Ferritin
 pdb|1MFR|E Chain E, Crystal Structure Of M Ferritin
 pdb|1MFR|F Chain F, Crystal Structure Of M Ferritin
 pdb|1MFR|G Chain G, Crystal Structure Of M Ferritin
 pdb|1MFR|H Chain H, Crystal Structure Of M Ferritin
 pdb|1MFR|I Chain I, Crystal Structure Of M Ferritin
 pdb|1MFR|J Chain J, Crystal Structure Of M Ferritin
 pdb|1MFR|K Chain K, Crystal Structure Of M Ferritin
 pdb|1MFR|L Chain L, Crystal Structure Of M Ferritin
 pdb|1MFR|M Chain M, Crystal Structure Of M Ferritin
 pdb|1MFR|N Chain N, Crystal Structure Of M Ferritin
 pdb|1MFR|O Chain O, Crystal Structure Of M Ferritin
 pdb|1MFR|P Chain P, Crystal Structure Of M Ferritin
 pdb|1MFR|Q Chain Q, Crystal Structure Of M Ferritin
 pdb|1MFR|R Chain R, Crystal Structure Of M Ferritin
 pdb|1MFR|S Chain S, Crystal Structure Of M Ferritin
 pdb|1MFR|T Chain T, Crystal Structure Of M Ferritin
 pdb|1MFR|U Chain U, Crystal Structure Of M Ferritin
 pdb|1MFR|V Chain V, Crystal Structure Of M Ferritin
 pdb|1MFR|W Chain W, Crystal Structure Of M Ferritin
 pdb|1MFR|X Chain X, Crystal Structure Of M Ferritin
 pdb|3KA3|A Chain A, Frog M-Ferritin With Magnesium
 pdb|3KA4|A Chain A, Frog M-Ferritin With Cobalt
 pdb|3RBC|A Chain A, Bullfrog M Ferritin With Iron(Iii) Bound To The
          Ferroxidase Site
 pdb|3RBC|B Chain B, Bullfrog M Ferritin With Iron(Iii) Bound To The
          Ferroxidase Site
 pdb|3RBC|C Chain C, Bullfrog M Ferritin With Iron(Iii) Bound To The
          Ferroxidase Site
 pdb|3RBC|D Chain D, Bullfrog M Ferritin With Iron(Iii) Bound To The
          Ferroxidase Site
 pdb|3RBC|E Chain E, Bullfrog M Ferritin With Iron(Iii) Bound To The
          Ferroxidase Site
 pdb|3RBC|F Chain F, Bullfrog M Ferritin With Iron(Iii) Bound To The
          Ferroxidase Site
 pdb|3RBC|G Chain G, Bullfrog M Ferritin With Iron(Iii) Bound To The
          Ferroxidase Site
 pdb|3RBC|H Chain H, Bullfrog M Ferritin With Iron(Iii) Bound To The
          Ferroxidase Site
 pdb|3RBC|I Chain I, Bullfrog M Ferritin With Iron(Iii) Bound To The
          Ferroxidase Site
 pdb|3RBC|J Chain J, Bullfrog M Ferritin With Iron(Iii) Bound To The
          Ferroxidase Site
 pdb|3RBC|K Chain K, Bullfrog M Ferritin With Iron(Iii) Bound To The
          Ferroxidase Site
 pdb|3RBC|L Chain L, Bullfrog M Ferritin With Iron(Iii) Bound To The
          Ferroxidase Site
 pdb|3RBC|M Chain M, Bullfrog M Ferritin With Iron(Iii) Bound To The
          Ferroxidase Site
 pdb|3RBC|N Chain N, Bullfrog M Ferritin With Iron(Iii) Bound To The
          Ferroxidase Site
 pdb|3RBC|O Chain O, Bullfrog M Ferritin With Iron(Iii) Bound To The
          Ferroxidase Site
 pdb|3RBC|P Chain P, Bullfrog M Ferritin With Iron(Iii) Bound To The
          Ferroxidase Site
 pdb|3RBC|Q Chain Q, Bullfrog M Ferritin With Iron(Iii) Bound To The
          Ferroxidase Site
 pdb|3RBC|R Chain R, Bullfrog M Ferritin With Iron(Iii) Bound To The
          Ferroxidase Site
 pdb|3RBC|S Chain S, Bullfrog M Ferritin With Iron(Iii) Bound To The
          Ferroxidase Site
 pdb|3RBC|T Chain T, Bullfrog M Ferritin With Iron(Iii) Bound To The
          Ferroxidase Site
 pdb|3RBC|U Chain U, Bullfrog M Ferritin With Iron(Iii) Bound To The
          Ferroxidase Site
 pdb|3RBC|V Chain V, Bullfrog M Ferritin With Iron(Iii) Bound To The
          Ferroxidase Site
 pdb|3RBC|W Chain W, Bullfrog M Ferritin With Iron(Iii) Bound To The
          Ferroxidase Site
 pdb|3RBC|X Chain X, Bullfrog M Ferritin With Iron(Iii) Bound To The
          Ferroxidase Site
 pdb|3RE7|A Chain A, Copper (Ii) Loaded Bullfrog Ferritin M Chain
 pdb|3RE7|B Chain B, Copper (Ii) Loaded Bullfrog Ferritin M Chain
 pdb|3RE7|C Chain C, Copper (Ii) Loaded Bullfrog Ferritin M Chain
 pdb|3RE7|D Chain D, Copper (Ii) Loaded Bullfrog Ferritin M Chain
 pdb|3RE7|E Chain E, Copper (Ii) Loaded Bullfrog Ferritin M Chain
 pdb|3RE7|F Chain F, Copper (Ii) Loaded Bullfrog Ferritin M Chain
 pdb|3RE7|G Chain G, Copper (Ii) Loaded Bullfrog Ferritin M Chain
 pdb|3RE7|H Chain H, Copper (Ii) Loaded Bullfrog Ferritin M Chain
 pdb|3RE7|I Chain I, Copper (Ii) Loaded Bullfrog Ferritin M Chain
 pdb|3RE7|J Chain J, Copper (Ii) Loaded Bullfrog Ferritin M Chain
 pdb|3RE7|K Chain K, Copper (Ii) Loaded Bullfrog Ferritin M Chain
 pdb|3RE7|L Chain L, Copper (Ii) Loaded Bullfrog Ferritin M Chain
 pdb|3RE7|M Chain M, Copper (Ii) Loaded Bullfrog Ferritin M Chain
 pdb|3RE7|N Chain N, Copper (Ii) Loaded Bullfrog Ferritin M Chain
 pdb|3RE7|O Chain O, Copper (Ii) Loaded Bullfrog Ferritin M Chain
 pdb|3RE7|P Chain P, Copper (Ii) Loaded Bullfrog Ferritin M Chain
 pdb|3RE7|Q Chain Q, Copper (Ii) Loaded Bullfrog Ferritin M Chain
 pdb|3RE7|R Chain R, Copper (Ii) Loaded Bullfrog Ferritin M Chain
 pdb|3RE7|S Chain S, Copper (Ii) Loaded Bullfrog Ferritin M Chain
 pdb|3RE7|T Chain T, Copper (Ii) Loaded Bullfrog Ferritin M Chain
 pdb|3RE7|U Chain U, Copper (Ii) Loaded Bullfrog Ferritin M Chain
 pdb|3RE7|V Chain V, Copper (Ii) Loaded Bullfrog Ferritin M Chain
 pdb|3RE7|W Chain W, Copper (Ii) Loaded Bullfrog Ferritin M Chain
 pdb|3RE7|X Chain X, Copper (Ii) Loaded Bullfrog Ferritin M Chain
 pdb|3RGD|A Chain A, Iron Loaded Frog M Ferritin. Short Soaking Time
 pdb|3RGD|B Chain B, Iron Loaded Frog M Ferritin. Short Soaking Time
 pdb|3RGD|C Chain C, Iron Loaded Frog M Ferritin. Short Soaking Time
 pdb|3RGD|D Chain D, Iron Loaded Frog M Ferritin. Short Soaking Time
 pdb|3RGD|E Chain E, Iron Loaded Frog M Ferritin. Short Soaking Time
 pdb|3RGD|F Chain F, Iron Loaded Frog M Ferritin. Short Soaking Time
 pdb|3RGD|G Chain G, Iron Loaded Frog M Ferritin. Short Soaking Time
 pdb|3RGD|H Chain H, Iron Loaded Frog M Ferritin. Short Soaking Time
 pdb|3RGD|I Chain I, Iron Loaded Frog M Ferritin. Short Soaking Time
 pdb|3RGD|J Chain J, Iron Loaded Frog M Ferritin. Short Soaking Time
 pdb|3RGD|K Chain K, Iron Loaded Frog M Ferritin. Short Soaking Time
 pdb|3RGD|L Chain L, Iron Loaded Frog M Ferritin. Short Soaking Time
 pdb|3RGD|M Chain M, Iron Loaded Frog M Ferritin. Short Soaking Time
 pdb|3RGD|N Chain N, Iron Loaded Frog M Ferritin. Short Soaking Time
 pdb|3RGD|O Chain O, Iron Loaded Frog M Ferritin. Short Soaking Time
 pdb|3RGD|P Chain P, Iron Loaded Frog M Ferritin. Short Soaking Time
 pdb|3RGD|Q Chain Q, Iron Loaded Frog M Ferritin. Short Soaking Time
 pdb|3RGD|R Chain R, Iron Loaded Frog M Ferritin. Short Soaking Time
 pdb|3RGD|S Chain S, Iron Loaded Frog M Ferritin. Short Soaking Time
 pdb|3RGD|T Chain T, Iron Loaded Frog M Ferritin. Short Soaking Time
 pdb|3RGD|U Chain U, Iron Loaded Frog M Ferritin. Short Soaking Time
 pdb|3RGD|V Chain V, Iron Loaded Frog M Ferritin. Short Soaking Time
 pdb|3RGD|W Chain W, Iron Loaded Frog M Ferritin. Short Soaking Time
 pdb|3RGD|X Chain X, Iron Loaded Frog M Ferritin. Short Soaking Time
 pdb|4DAS|A Chain A, Crystal Structure Of Bullfrog M Ferritin
 pdb|4DAS|B Chain B, Crystal Structure Of Bullfrog M Ferritin
 pdb|4DAS|C Chain C, Crystal Structure Of Bullfrog M Ferritin
 pdb|4DAS|D Chain D, Crystal Structure Of Bullfrog M Ferritin
 pdb|4DAS|E Chain E, Crystal Structure Of Bullfrog M Ferritin
 pdb|4DAS|F Chain F, Crystal Structure Of Bullfrog M Ferritin
 pdb|4DAS|G Chain G, Crystal Structure Of Bullfrog M Ferritin
 pdb|4DAS|H Chain H, Crystal Structure Of Bullfrog M Ferritin
 pdb|4DAS|I Chain I, Crystal Structure Of Bullfrog M Ferritin
 pdb|4DAS|J Chain J, Crystal Structure Of Bullfrog M Ferritin
 pdb|4DAS|K Chain K, Crystal Structure Of Bullfrog M Ferritin
 pdb|4DAS|L Chain L, Crystal Structure Of Bullfrog M Ferritin
 pdb|4DAS|M Chain M, Crystal Structure Of Bullfrog M Ferritin
 pdb|4DAS|N Chain N, Crystal Structure Of Bullfrog M Ferritin
 pdb|4DAS|O Chain O, Crystal Structure Of Bullfrog M Ferritin
 pdb|4DAS|P Chain P, Crystal Structure Of Bullfrog M Ferritin
 pdb|4DAS|Q Chain Q, Crystal Structure Of Bullfrog M Ferritin
 pdb|4DAS|R Chain R, Crystal Structure Of Bullfrog M Ferritin
 pdb|4DAS|S Chain S, Crystal Structure Of Bullfrog M Ferritin
 pdb|4DAS|T Chain T, Crystal Structure Of Bullfrog M Ferritin
 pdb|4DAS|U Chain U, Crystal Structure Of Bullfrog M Ferritin
 pdb|4DAS|V Chain V, Crystal Structure Of Bullfrog M Ferritin
 pdb|4DAS|X Chain X, Crystal Structure Of Bullfrog M Ferritin
 pdb|4DAS|W Chain W, Crystal Structure Of Bullfrog M Ferritin
          Length = 176

 Score = 35.8 bits (81), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 22/39 (56%)

Query: 15 AHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          A F RD V     A+FF   + EEREHA KF+ Y   RG
Sbjct: 36 AFFDRDDVALHNVAEFFKEHSHEEREHAEKFMKYQNKRG 74


>pdb|3SHX|A Chain A, Frog M-Ferritin With Magnesium, L134p Mutant
          Length = 176

 Score = 35.8 bits (81), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 22/39 (56%)

Query: 15 AHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          A F RD V     A+FF   + EEREHA KF+ Y   RG
Sbjct: 36 AFFDRDDVALHNVAEFFKEHSHEEREHAEKFMKYQNKRG 74


>pdb|3KA6|A Chain A, Frog M-Ferritin, Eed Mutant, With Cobalt
          Length = 176

 Score = 35.8 bits (81), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 22/39 (56%)

Query: 15 AHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          A F RD V     A+FF   + EEREHA KF+ Y   RG
Sbjct: 36 AFFDRDDVALHNVAEFFKEHSHEEREHAEKFMKYQNKRG 74


>pdb|3SH6|A Chain A, Frog M-Ferritin, D122r Mutant, With Magnesium
          Length = 176

 Score = 35.8 bits (81), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 22/39 (56%)

Query: 15 AHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          A F RD V     A+FF   + EEREHA KF+ Y   RG
Sbjct: 36 AFFDRDDVALHNVAEFFKEHSHEEREHAEKFMKYQNKRG 74


>pdb|1RCC|A Chain A, Bullfrog Red Cell L Ferritin TartrateMGPH 5.5
 pdb|1RCE|A Chain A, Bullfrog Red Cell L Ferritin SulfateMNPH 6.3
          Length = 173

 Score = 34.3 bits (77), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 22/40 (55%)

Query: 14 GAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
           ++F+RD V    FAKFF   ++  + HA K I Y   RG
Sbjct: 35 ASYFNRDDVALSNFAKFFRERSAAAKAHAEKLIEYQNQRG 74


>pdb|3ES3|A Chain A, Directing Noble Metal Ion Chemistry Within A Designed
          Ferritin Protein. The Complex With Gold Ions. Ferritin
          H8-H9x Mutant
          Length = 183

 Score = 33.5 bits (75), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 20/38 (52%)

Query: 16 HFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          +F RD V    FAK+F   + EER HA K +     RG
Sbjct: 41 YFDRDDVALKNFAKYFLHQSHEERCHAEKLMKLQNQRG 78


>pdb|3ERZ|A Chain A, Directing Noble Metal Ion Chemistry Within A Designed
          Ferritin Protein. Mercury Ions On The Three-Fold
          Channel
 pdb|3ERZ|B Chain B, Directing Noble Metal Ion Chemistry Within A Designed
          Ferritin Protein. Mercury Ions On The Three-Fold
          Channel
 pdb|3ERZ|C Chain C, Directing Noble Metal Ion Chemistry Within A Designed
          Ferritin Protein. Mercury Ions On The Three-Fold
          Channel
 pdb|3ERZ|D Chain D, Directing Noble Metal Ion Chemistry Within A Designed
          Ferritin Protein. Mercury Ions On The Three-Fold
          Channel
 pdb|3ERZ|E Chain E, Directing Noble Metal Ion Chemistry Within A Designed
          Ferritin Protein. Mercury Ions On The Three-Fold
          Channel
 pdb|3ERZ|F Chain F, Directing Noble Metal Ion Chemistry Within A Designed
          Ferritin Protein. Mercury Ions On The Three-Fold
          Channel
 pdb|3ERZ|G Chain G, Directing Noble Metal Ion Chemistry Within A Designed
          Ferritin Protein. Mercury Ions On The Three-Fold
          Channel
 pdb|3ERZ|H Chain H, Directing Noble Metal Ion Chemistry Within A Designed
          Ferritin Protein. Mercury Ions On The Three-Fold
          Channel
 pdb|3ERZ|I Chain I, Directing Noble Metal Ion Chemistry Within A Designed
          Ferritin Protein. Mercury Ions On The Three-Fold
          Channel
 pdb|3ERZ|J Chain J, Directing Noble Metal Ion Chemistry Within A Designed
          Ferritin Protein. Mercury Ions On The Three-Fold
          Channel
 pdb|3ERZ|K Chain K, Directing Noble Metal Ion Chemistry Within A Designed
          Ferritin Protein. Mercury Ions On The Three-Fold
          Channel
 pdb|3ERZ|L Chain L, Directing Noble Metal Ion Chemistry Within A Designed
          Ferritin Protein. Mercury Ions On The Three-Fold
          Channel
          Length = 183

 Score = 33.5 bits (75), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 20/38 (52%)

Query: 16 HFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          +F RD V    FAK+F   + EER HA K +     RG
Sbjct: 41 YFDRDDVALKNFAKYFLHQSHEERCHAEKLMKLQNQRG 78


>pdb|2Z6M|A Chain A, Crystal Structure Of Human Ferritin H8 As Biotemplate
          For Noble Metal Nanoparticle Synthesis
 pdb|2Z6M|B Chain B, Crystal Structure Of Human Ferritin H8 As Biotemplate
          For Noble Metal Nanoparticle Synthesis
 pdb|2Z6M|C Chain C, Crystal Structure Of Human Ferritin H8 As Biotemplate
          For Noble Metal Nanoparticle Synthesis
 pdb|2Z6M|D Chain D, Crystal Structure Of Human Ferritin H8 As Biotemplate
          For Noble Metal Nanoparticle Synthesis
 pdb|2Z6M|E Chain E, Crystal Structure Of Human Ferritin H8 As Biotemplate
          For Noble Metal Nanoparticle Synthesis
 pdb|2Z6M|F Chain F, Crystal Structure Of Human Ferritin H8 As Biotemplate
          For Noble Metal Nanoparticle Synthesis
 pdb|2Z6M|G Chain G, Crystal Structure Of Human Ferritin H8 As Biotemplate
          For Noble Metal Nanoparticle Synthesis
 pdb|2Z6M|H Chain H, Crystal Structure Of Human Ferritin H8 As Biotemplate
          For Noble Metal Nanoparticle Synthesis
 pdb|2Z6M|I Chain I, Crystal Structure Of Human Ferritin H8 As Biotemplate
          For Noble Metal Nanoparticle Synthesis
 pdb|2Z6M|J Chain J, Crystal Structure Of Human Ferritin H8 As Biotemplate
          For Noble Metal Nanoparticle Synthesis
 pdb|2Z6M|K Chain K, Crystal Structure Of Human Ferritin H8 As Biotemplate
          For Noble Metal Nanoparticle Synthesis
 pdb|2Z6M|L Chain L, Crystal Structure Of Human Ferritin H8 As Biotemplate
          For Noble Metal Nanoparticle Synthesis
          Length = 176

 Score = 33.5 bits (75), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 20/38 (52%)

Query: 16 HFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          +F RD V    FAK+F   + EER HA K +     RG
Sbjct: 40 YFDRDDVALKNFAKYFLHQSHEERCHAEKLMKLQNQRG 77


>pdb|3SE1|A Chain A, Frog M-Ferritin With Magnesium, R72d Mutant
          Length = 176

 Score = 33.1 bits (74), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 21/39 (53%)

Query: 15 AHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          A F RD V     A+FF   + EEREHA KF+ Y    G
Sbjct: 36 AFFDRDDVALHNVAEFFKEHSHEEREHAEKFMKYQNKDG 74


>pdb|1R03|A Chain A, Crystal Structure Of A Human Mitochondrial Ferritin
          Length = 182

 Score = 33.1 bits (74), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%)

Query: 16 HFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          +FSRD V    F+++F   + EE EHA K +     RG
Sbjct: 40 YFSRDDVALNNFSRYFLHQSREETEHAEKLMRLQNQRG 77


>pdb|1BG7|A Chain A, Localized Unfolding At The Junction Of Three Ferritin
          Subunits. A Mechanism For Iron Release?
          Length = 176

 Score = 32.3 bits (72), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 20/38 (52%)

Query: 16 HFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          +F RD +     AKFF   + EEREHA K +     RG
Sbjct: 37 YFDRDDIALHNVAKFFKEQSHEEREHAEKLMKDQNKRG 74


>pdb|1Z6O|A Chain A, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
 pdb|1Z6O|B Chain B, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
 pdb|1Z6O|C Chain C, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
 pdb|1Z6O|D Chain D, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
 pdb|1Z6O|E Chain E, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
 pdb|1Z6O|F Chain F, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
 pdb|1Z6O|G Chain G, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
 pdb|1Z6O|H Chain H, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
 pdb|1Z6O|I Chain I, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
 pdb|1Z6O|J Chain J, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
 pdb|1Z6O|K Chain K, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
 pdb|1Z6O|L Chain L, Crystal Structure Of Trichoplusia Ni Secreted Ferritin
          Length = 212

 Score = 32.3 bits (72), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 26/55 (47%)

Query: 7   SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRGNLTDYHHH 61
           S+      A+F+    NR GF+K F   + E     I  I ++T RG+  ++  H
Sbjct: 52  SYDYLLSAAYFNNYQTNRAGFSKLFKKLSDEAWSKTIDIIKHVTKRGDKMNFDQH 106


>pdb|3AF9|X Chain X, Crystal Structure Of Pd(Allyl)APO-C48afr
          Length = 174

 Score = 31.2 bits (69), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 23/47 (48%)

Query: 7  SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          S+   + G +F RD V   G A FF   A E+RE A + +     RG
Sbjct: 27 SYTYLSLGFYFDRDDVALEGVAHFFRELAEEKREGAERLLKMQNQRG 73


>pdb|3QD8|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
 pdb|3QD8|B Chain B, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
 pdb|3QD8|C Chain C, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
 pdb|3QD8|D Chain D, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
 pdb|3QD8|E Chain E, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
 pdb|3QD8|F Chain F, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
 pdb|3QD8|G Chain G, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
 pdb|3QD8|H Chain H, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
 pdb|3QD8|I Chain I, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
 pdb|3QD8|J Chain J, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
 pdb|3QD8|K Chain K, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
 pdb|3QD8|L Chain L, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
 pdb|3QD8|M Chain M, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
 pdb|3QD8|N Chain N, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
 pdb|3QD8|O Chain O, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
 pdb|3QD8|P Chain P, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
 pdb|3QD8|Q Chain Q, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
 pdb|3QD8|R Chain R, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
 pdb|3QD8|S Chain S, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
 pdb|3QD8|T Chain T, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
 pdb|3QD8|U Chain U, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
 pdb|3QD8|V Chain V, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
 pdb|3QD8|W Chain W, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
 pdb|3QD8|X Chain X, Crystal Structure Of Mycobacterium Tuberculosis Bfrb
          Length = 181

 Score = 30.8 bits (68), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (57%)

Query: 20 DCVNRPGFAKFFFTSASEEREHAIKFISYLTMR 52
          D  + P  AK F++ A EER HA+  + +L  R
Sbjct: 37 DSEDLPQLAKHFYSQAVEERNHAMMLVQHLLDR 69


>pdb|3OJ5|A Chain A, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3OJ5|B Chain B, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3OJ5|C Chain C, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3OJ5|D Chain D, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3OJ5|E Chain E, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3OJ5|F Chain F, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3OJ5|G Chain G, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3OJ5|H Chain H, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3OJ5|I Chain I, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3OJ5|J Chain J, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3OJ5|K Chain K, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3OJ5|L Chain L, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3OJ5|M Chain M, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3OJ5|N Chain N, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3OJ5|O Chain O, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3OJ5|P Chain P, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3OJ5|Q Chain Q, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3OJ5|R Chain R, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3OJ5|S Chain S, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3OJ5|T Chain T, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3OJ5|U Chain U, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3OJ5|V Chain V, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3OJ5|W Chain W, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3OJ5|X Chain X, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3UNO|A Chain A, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3UNO|B Chain B, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3UNO|C Chain C, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3UNO|D Chain D, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3UNO|E Chain E, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3UNO|F Chain F, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3UNO|G Chain G, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3UNO|H Chain H, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3UNO|I Chain I, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3UNO|J Chain J, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3UNO|K Chain K, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3UNO|L Chain L, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3UNO|M Chain M, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3UNO|N Chain N, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3UNO|O Chain O, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3UNO|P Chain P, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3UNO|Q Chain Q, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3UNO|R Chain R, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3UNO|S Chain S, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3UNO|T Chain T, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3UNO|U Chain U, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3UNO|V Chain V, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3UNO|W Chain W, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
 pdb|3UNO|X Chain X, Mycobacterium Tuberculosis Ferritin Homolog, Bfrb
          Length = 189

 Score = 30.8 bits (68), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (57%)

Query: 20 DCVNRPGFAKFFFTSASEEREHAIKFISYLTMR 52
          D  + P  AK F++ A EER HA+  + +L  R
Sbjct: 37 DSEDLPQLAKHFYSQAVEERNHAMMLVQHLLDR 69


>pdb|3NP2|X Chain X, Crystal Structure Of Pd(Allyl)APO-E45cC48A-Rhlfr
          Length = 174

 Score = 30.0 bits (66), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 23/47 (48%)

Query: 7  SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          S+   + G +F RD V   G A FF   A E+RE A + +     RG
Sbjct: 27 SYTYLSLGFYFDRDDVALCGVAHFFRELAEEKREGAERLLKMQNQRG 73


>pdb|2ZG8|X Chain X, Crystal Structure Of Pd(Allyl)APO-H49afr
 pdb|3FI6|A Chain A, Apo-H49afr With High Content Of Pd Ions
 pdb|3O7R|A Chain A, Crystal Structure Of Ru(P-Cymene)APO-H49afr
          Length = 174

 Score = 29.6 bits (65), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (46%)

Query: 7  SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          S+   + G +F RD V   G   FF   A E+RE A + +     RG
Sbjct: 27 SYTYLSLGFYFDRDDVALEGVCAFFRELAEEKREGAERLLKMQNQRG 73


>pdb|3NP0|X Chain X, Crystal Structure Of Pd(Allyl)APO-E45cH49AR52H-Rhlfr
          Length = 174

 Score = 29.3 bits (64), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (46%)

Query: 7  SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          S+   + G +F RD V   G   FF   A E+RE A + +     RG
Sbjct: 27 SYTYLSLGFYFDRDDVALCGVCAFFHELAEEKREGAERLLKMQNQRG 73


>pdb|1KRQ|A Chain A, Crystal Structure Analysis Of Campylobacter Jejuni
          Ferritin
          Length = 167

 Score = 29.3 bits (64), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 19/34 (55%), Gaps = 4/34 (11%)

Query: 26 GFAKFFFTSASEEREHAIKFISYLTMRGNLTDYH 59
          G   F F  ASEE +HA K I+YL    N TD H
Sbjct: 38 GAGAFLFAHASEESDHAKKLITYL----NETDSH 67


>pdb|1IES|A Chain A, Tetragonal Crystal Structure Of Native Horse Spleen
          Ferritin
 pdb|1IES|B Chain B, Tetragonal Crystal Structure Of Native Horse Spleen
          Ferritin
 pdb|1IES|C Chain C, Tetragonal Crystal Structure Of Native Horse Spleen
          Ferritin
 pdb|1IES|D Chain D, Tetragonal Crystal Structure Of Native Horse Spleen
          Ferritin
 pdb|1IES|E Chain E, Tetragonal Crystal Structure Of Native Horse Spleen
          Ferritin
 pdb|1IES|F Chain F, Tetragonal Crystal Structure Of Native Horse Spleen
          Ferritin
 pdb|1GWG|A Chain A, Tri-Iodide Derivative Of Apoferritin
 pdb|1XZ1|A Chain A, Complex Of Halothane With Apoferritin
 pdb|1XZ3|A Chain A, Complex Of Apoferritin With Isoflurane
 pdb|1HRS|A Chain A, A Crystallographic Study Of Haem Binding To Ferritin
 pdb|1IER|A Chain A, Cubic Crystal Structure Of Native Horse Spleen Ferritin
 pdb|2Z5Q|A Chain A, Apo-Fr With Intermediate Content Of Pd Ion
 pdb|2Z5R|A Chain A, Apo-Fr With High Content Of Pd Ions
 pdb|2W0O|A Chain A, Horse Spleen Apoferritin
 pdb|2ZG7|X Chain X, Crystal Structure Of Pd(Allyl)APO-Fr
 pdb|3F32|A Chain A, Horse Spleen Apoferritin
 pdb|3F33|A Chain A, Apoferritin: Complex With Propofol
 pdb|3F34|A Chain A, Apoferritin: Complex With 2,6-Diethylphenol
 pdb|3F35|A Chain A, Apoferritin: Complex With 2,6-Diethylphenol
 pdb|3F36|A Chain A, Apoferritin: Complex With 2-Isopropylphenol
 pdb|3F37|A Chain A, Apoferritin: Complex With 2,6-Dimethylphenol
 pdb|3F38|A Chain A, Apoferritin: Complex With 2,6-Dimethylphenol
 pdb|3F39|A Chain A, Apoferritin: Complex With Phenol
 pdb|3AF7|X Chain X, Crystal Structure Of 25pd(Allyl)APO-Fr
 pdb|3O7S|A Chain A, Crystal Structure Of Ru(P-Cymene)APO-Fr
 pdb|3RAV|A Chain A, Horse Spleen Apo-Ferritin With Bound Pentobarbital
 pdb|3RD0|A Chain A, Horse Spleen Apo-Ferritin With Bound Thiopental
 pdb|4DE6|A Chain A, Horse Spleen Apo-Ferritin Complex With Arachidonic Acid
 pdb|3U90|A Chain A, Apoferritin: Complex With Sds
          Length = 174

 Score = 29.3 bits (64), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (46%)

Query: 7  SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          S+   + G +F RD V   G   FF   A E+RE A + +     RG
Sbjct: 27 SYTYLSLGFYFDRDDVALEGVCHFFRELAEEKREGAERLLKMQNQRG 73


>pdb|2GYD|A Chain A, Complex Of Equine Apoferritin With The H-Diaziflurane
          Photolabeling Reagent
          Length = 170

 Score = 29.3 bits (64), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (46%)

Query: 7  SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          S+   + G +F RD V   G   FF   A E+RE A + +     RG
Sbjct: 26 SYTYLSLGFYFDRDDVALEGVCHFFRELAEEKREGAERLLKMQNQRG 72


>pdb|2ZA8|A Chain A, Recombinant Horse L-Chain Apoferritin N-Terminal
          Deletion Mutant (Residues 1-8)
          Length = 167

 Score = 29.3 bits (64), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (46%)

Query: 7  SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          S+   + G +F RD V   G   FF   A E+RE A + +     RG
Sbjct: 20 SYTYLSLGFYFDRDDVALEGVCHFFRELAEEKREGAERLLKMQNQRG 66


>pdb|2ZA7|A Chain A, Recombinant Horse L-Chain Apoferritin N-Terminal
          Deletion Mutant (Residues 1-4)
          Length = 171

 Score = 29.3 bits (64), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (46%)

Query: 7  SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          S+   + G +F RD V   G   FF   A E+RE A + +     RG
Sbjct: 24 SYTYLSLGFYFDRDDVALEGVCHFFRELAEEKREGAERLLKMQNQRG 70


>pdb|3AF8|X Chain X, Crystal Structure Of Pd(Ally)APO-C126afr
          Length = 174

 Score = 29.3 bits (64), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (46%)

Query: 7  SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          S+   + G +F RD V   G   FF   A E+RE A + +     RG
Sbjct: 27 SYTYLSLGFYFDRDDVALEGVCHFFRELAEEKREGAERLLKMQNQRG 73


>pdb|2ZUR|X Chain X, Crystal Structure Of Rh(Nbd)APO-Fr
          Length = 174

 Score = 29.3 bits (64), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (46%)

Query: 7  SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          S+   + G +F RD V   G   FF   A E+RE A + +     RG
Sbjct: 27 SYTYLSLGFYFDRDDVALEGVXHFFRELAEEKREGAERLLKMQNQRG 73


>pdb|2ZA6|A Chain A, Recombinant Horse L-Chain Apoferritin
 pdb|2V2I|A Chain A, Wild Type Recombinant Horse Spleen Apoferritin
          Cocrystallized With Haemin In Acidic Conditions
 pdb|2V2J|A Chain A, Wild Type Recombinant Horse Spleen Apoferritin
          Cocrystallized With Haemin In Basic Conditions
          Length = 175

 Score = 29.3 bits (64), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (46%)

Query: 7  SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          S+   + G +F RD V   G   FF   A E+RE A + +     RG
Sbjct: 28 SYTYLSLGFYFDRDDVALEGVCHFFRELAEEKREGAERLLKMQNQRG 74


>pdb|2G4H|A Chain A, Anomalous Substructure Of Apoferritin
 pdb|1AEW|A Chain A, L-Chain Horse Apoferritin
 pdb|1DAT|A Chain A, Cubic Crystal Structure Recombinant Horse L Apoferritin
 pdb|2Z5P|A Chain A, Apo-fr With Low Content Of Pd Ions
 pdb|3H7G|A Chain A, Apo-Fr With Au Ions
          Length = 174

 Score = 29.3 bits (64), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (46%)

Query: 7  SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          S+   + G +F RD V   G   FF   A E+RE A + +     RG
Sbjct: 27 SYTYLSLGFYFDRDDVALEGVCHFFRELAEEKREGAERLLKMQNQRG 73


>pdb|2ZG9|X Chain X, Crystal Structure Of Pd(Allyl)APO-H114afr
          Length = 174

 Score = 28.9 bits (63), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (46%)

Query: 7  SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          S+   + G +F RD V   G   FF   A E+RE A + +     RG
Sbjct: 27 SYTYLSLGFYFDRDDVALEGVCHFFRELAEEKREGAERLLKMQNQRG 73


>pdb|3NOZ|X Chain X, Crystal Structure Of Pd(Allyl)APO-E45cR52H-Rhlfr
          Length = 174

 Score = 28.9 bits (63), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (46%)

Query: 7  SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          S+   + G +F RD V   G   FF   A E+RE A + +     RG
Sbjct: 27 SYTYLSLGFYFDRDDVALCGVCHFFHELAEEKREGAERLLKMQNQRG 73


>pdb|1VLG|A Chain A, Crystal Structure Of Ferritin (Tm1128) From Thermotoga
          Maritima At 2.00 A Resolution
 pdb|1VLG|B Chain B, Crystal Structure Of Ferritin (Tm1128) From Thermotoga
          Maritima At 2.00 A Resolution
 pdb|1VLG|C Chain C, Crystal Structure Of Ferritin (Tm1128) From Thermotoga
          Maritima At 2.00 A Resolution
 pdb|1VLG|D Chain D, Crystal Structure Of Ferritin (Tm1128) From Thermotoga
          Maritima At 2.00 A Resolution
 pdb|1VLG|E Chain E, Crystal Structure Of Ferritin (Tm1128) From Thermotoga
          Maritima At 2.00 A Resolution
 pdb|1VLG|F Chain F, Crystal Structure Of Ferritin (Tm1128) From Thermotoga
          Maritima At 2.00 A Resolution
 pdb|1VLG|G Chain G, Crystal Structure Of Ferritin (Tm1128) From Thermotoga
          Maritima At 2.00 A Resolution
 pdb|1VLG|H Chain H, Crystal Structure Of Ferritin (Tm1128) From Thermotoga
          Maritima At 2.00 A Resolution
          Length = 176

 Score = 28.1 bits (61), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 16/29 (55%)

Query: 25 PGFAKFFFTSASEEREHAIKFISYLTMRG 53
           GFA +    A EE  HA+KF  Y+  RG
Sbjct: 51 KGFAHWMKKQAQEELTHAMKFYEYIYERG 79


>pdb|1Z4A|A Chain A, Ferritin From T. Maritima
 pdb|1Z4A|B Chain B, Ferritin From T. Maritima
 pdb|1Z4A|C Chain C, Ferritin From T. Maritima
 pdb|1Z4A|D Chain D, Ferritin From T. Maritima
 pdb|1Z4A|E Chain E, Ferritin From T. Maritima
 pdb|1Z4A|F Chain F, Ferritin From T. Maritima
 pdb|1Z4A|G Chain G, Ferritin From T. Maritima
 pdb|1Z4A|H Chain H, Ferritin From T. Maritima
          Length = 164

 Score = 28.1 bits (61), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 16/29 (55%)

Query: 25 PGFAKFFFTSASEEREHAIKFISYLTMRG 53
           GFA +    A EE  HA+KF  Y+  RG
Sbjct: 39 KGFAHWMKKQAQEELTHAMKFYEYIYERG 67


>pdb|1CLY|H Chain H, Igg Fab (Human Igg1, Kappa) Chimeric Fragment (Cbr96)
          Complexed With Lewis Y Nonoate Methyl Ester
 pdb|1UCB|H Chain H, Structure Of Uncomplexed Fab Compared To Complex (1cly,
          1clz)
          Length = 219

 Score = 28.1 bits (61), Expect = 1.3,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 25/51 (49%), Gaps = 1/51 (1%)

Query: 9  GRFAPGAHFSRDCVNRP-GFAKFFFTSASEEREHAIKFISYLTMRGNLTDY 58
          G   PG      CV     F+ ++     +  E  +++++Y++  G++TDY
Sbjct: 10 GLVQPGGSLKVSCVTSGFTFSDYYMYWVRQTPEKRLEWVAYISQGGDITDY 60


>pdb|1CLZ|H Chain H, Igg Fab (Igg3, Kappa) Fragment (Mbr96) Complexed With
          Lewis Y Nonoate Methyl Ester
          Length = 218

 Score = 28.1 bits (61), Expect = 1.3,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 25/51 (49%), Gaps = 1/51 (1%)

Query: 9  GRFAPGAHFSRDCVNRP-GFAKFFFTSASEEREHAIKFISYLTMRGNLTDY 58
          G   PG      CV     F+ ++     +  E  +++++Y++  G++TDY
Sbjct: 10 GLVQPGGSLKVSCVTSGFTFSDYYMYWVRQTPEKRLEWVAYISQGGDITDY 60


>pdb|1H96|A Chain A, Recombinant Mouse L-Chain Ferritin
 pdb|1LB3|A Chain A, Structure Of Recombinant Mouse L Chain Ferritin At 1.2 A
          Resolution
          Length = 182

 Score = 27.3 bits (59), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (46%)

Query: 7  SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          S+   + G  F RD V   G   FF   A E+RE A + + +   RG
Sbjct: 27 SYTYLSLGFFFDRDDVALEGVGHFFRELAEEKREGAERLLEFQNDRG 73


>pdb|2V2L|A Chain A, Mutant (E53,56,57,60q) Recombinant Horse Spleen
          Apoferritin Cocrystallized With Haemin In Acidic
          Conditions
 pdb|2V2M|A Chain A, Mutant (E53,56,57,60q) Recombinant Horse Spleen
          Apoferritin Cocrystallized With Haemin In Basic
          Conditions
          Length = 174

 Score = 27.3 bits (59), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 22/47 (46%)

Query: 7  SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          S+   + G +F RD V   G   FF   A ++R+ A + +     RG
Sbjct: 27 SYTYLSLGFYFDRDDVALEGVCHFFRQLAQQKRQGAERLLKMQNQRG 73


>pdb|2FG4|A Chain A, Structure Of Human Ferritin L Chain
 pdb|2FG8|A Chain A, Structure Of Human Ferritin L Chain
 pdb|2FG8|B Chain B, Structure Of Human Ferritin L Chain
 pdb|2FG8|C Chain C, Structure Of Human Ferritin L Chain
 pdb|2FG8|D Chain D, Structure Of Human Ferritin L Chain
 pdb|2FG8|E Chain E, Structure Of Human Ferritin L Chain
 pdb|2FG8|F Chain F, Structure Of Human Ferritin L Chain
 pdb|2FG8|G Chain G, Structure Of Human Ferritin L Chain
 pdb|2FG8|H Chain H, Structure Of Human Ferritin L Chain
          Length = 174

 Score = 26.9 bits (58), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 22/47 (46%)

Query: 7  SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          S+   + G +F RD V   G + FF   A E+RE   + +     RG
Sbjct: 27 SYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRG 73


>pdb|2FFX|J Chain J, Structure Of Human Ferritin L. Chain
          Length = 173

 Score = 26.9 bits (58), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 22/47 (46%)

Query: 7  SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          S+   + G +F RD V   G + FF   A E+RE   + +     RG
Sbjct: 27 SYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRG 73


>pdb|3HX2|A Chain A, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|AA Chain a, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|B Chain B, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|BB Chain b, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|C Chain C, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|CC Chain c, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|D Chain D, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|DD Chain d, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|E Chain E, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|EE Chain e, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|F Chain F, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|FF Chain f, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|G Chain G, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|GG Chain g, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|H Chain H, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|HH Chain h, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|I Chain I, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|II Chain i, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|J Chain J, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|JJ Chain j, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|K Chain K, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|KK Chain k, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|L Chain L, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|LL Chain l, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|M Chain M, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|MM Chain m, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|N Chain N, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|NN Chain n, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|O Chain O, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|OO Chain o, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|P Chain P, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|PP Chain p, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|Q Chain Q, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|QQ Chain q, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|R Chain R, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|RR Chain r, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|S Chain S, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|SS Chain s, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|T Chain T, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|TT Chain t, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|U Chain U, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|UU Chain u, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|V Chain V, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|VV Chain v, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|W Chain W, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|WW Chain w, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|X Chain X, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX2|XX Chain x, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 13 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 1 And 2 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|A Chain A, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|AA Chain a, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|B Chain B, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|BB Chain b, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|C Chain C, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|CC Chain c, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|D Chain D, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|DD Chain d, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|E Chain E, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|EE Chain e, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|F Chain F, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|FF Chain f, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|G Chain G, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|GG Chain g, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|H Chain H, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|HH Chain h, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|I Chain I, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|II Chain i, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|J Chain J, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|JJ Chain j, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|K Chain K, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|KK Chain k, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|L Chain L, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|LL Chain l, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|M Chain M, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|MM Chain m, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|N Chain N, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|NN Chain n, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|O Chain O, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|OO Chain o, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|P Chain P, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|PP Chain p, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|Q Chain Q, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|QQ Chain q, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|R Chain R, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|RR Chain r, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|S Chain S, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|SS Chain s, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|T Chain T, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|TT Chain t, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|U Chain U, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|UU Chain u, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|V Chain V, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|VV Chain v, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|W Chain W, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|WW Chain w, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|X Chain X, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX5|XX Chain x, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 23 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 3 And 4 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|A Chain A, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|AA Chain a, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|B Chain B, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|BB Chain b, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|C Chain C, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|CC Chain c, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|D Chain D, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|DD Chain d, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|E Chain E, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|EE Chain e, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|F Chain F, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|FF Chain f, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|G Chain G, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|GG Chain g, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|H Chain H, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|HH Chain h, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|I Chain I, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|II Chain i, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|J Chain J, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|JJ Chain j, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|K Chain K, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|KK Chain k, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|L Chain L, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|LL Chain l, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|M Chain M, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|MM Chain m, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|N Chain N, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|NN Chain n, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|O Chain O, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|OO Chain o, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|P Chain P, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|PP Chain p, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|Q Chain Q, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|QQ Chain q, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|R Chain R, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|RR Chain r, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|S Chain S, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|SS Chain s, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|T Chain T, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|TT Chain t, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|U Chain U, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|UU Chain u, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|V Chain V, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|VV Chain v, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|W Chain W, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|WW Chain w, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|X Chain X, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
 pdb|3HX7|XX Chain x, Crystal Structure Of Human Ferritin Phe167serfsx26
          Mutant. This File Is A Part 33 OF THE SPLIT ENTRY AND
          CONTAINS THE Copies 5 And 6 Of The Total Six Copies Of
          The Biological Unit That Are Present In The
          Crystallographic Asymmetric Unit. The Entire Structure
          Contains Six Copies Of The Biological Unit In The
          Crystallographic Asymmetric Unit And Is Described In
          Remark 400
          Length = 192

 Score = 26.6 bits (57), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 22/47 (46%)

Query: 7  SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          S+   + G +F RD V   G + FF   A E+RE   + +     RG
Sbjct: 29 SYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRG 75


>pdb|3KXU|A Chain A, Crystal Structure Of Human Ferritin Ftl498instc
          Pathogenic M
          Length = 191

 Score = 26.6 bits (57), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 22/47 (46%)

Query: 7  SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          S+   + G +F RD V   G + FF   A E+RE   + +     RG
Sbjct: 28 SYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRG 74


>pdb|3E6R|A Chain A, Crystal Structure Of Apo-Ferritin From Pseudo-Nitzschia
          Multiseries
 pdb|3E6R|B Chain B, Crystal Structure Of Apo-Ferritin From Pseudo-Nitzschia
          Multiseries
 pdb|3E6R|C Chain C, Crystal Structure Of Apo-Ferritin From Pseudo-Nitzschia
          Multiseries
 pdb|3E6R|D Chain D, Crystal Structure Of Apo-Ferritin From Pseudo-Nitzschia
          Multiseries
 pdb|3E6R|E Chain E, Crystal Structure Of Apo-Ferritin From Pseudo-Nitzschia
          Multiseries
 pdb|3E6R|F Chain F, Crystal Structure Of Apo-Ferritin From Pseudo-Nitzschia
          Multiseries
 pdb|3E6S|A Chain A, Crystal Structure Of Ferritin Soaked With Iron From
          Pseudo- Nitzschia Multiseries
 pdb|3E6S|B Chain B, Crystal Structure Of Ferritin Soaked With Iron From
          Pseudo- Nitzschia Multiseries
 pdb|3E6S|C Chain C, Crystal Structure Of Ferritin Soaked With Iron From
          Pseudo- Nitzschia Multiseries
 pdb|3E6S|D Chain D, Crystal Structure Of Ferritin Soaked With Iron From
          Pseudo- Nitzschia Multiseries
 pdb|3E6S|E Chain E, Crystal Structure Of Ferritin Soaked With Iron From
          Pseudo- Nitzschia Multiseries
 pdb|3E6S|F Chain F, Crystal Structure Of Ferritin Soaked With Iron From
          Pseudo- Nitzschia Multiseries
          Length = 168

 Score = 26.6 bits (57), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 9/28 (32%), Positives = 15/28 (53%)

Query: 26 GFAKFFFTSASEEREHAIKFISYLTMRG 53
          G A +    ++EEREH + F+ +   R 
Sbjct: 37 GMAAYMLAESAEEREHGLGFVDFANKRN 64


>pdb|2V2N|A Chain A, Mutant R59m Recombinant Horse Spleen Apoferritin
          Cocrystallized With Haemin In Acidic Conditions
 pdb|2V2O|A Chain A, Mutant R59m Recombinant Horse Spleen Apoferritin
          Cocrystallized With Haemin In Basic Conditions
 pdb|2V2S|A Chain A, Mutant R59m Recombinant Horse Spleen Apoferritin
          Crystallized In Acidic Conditions
          Length = 174

 Score = 26.2 bits (56), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 21/47 (44%)

Query: 7  SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          S+   + G +F RD V   G   FF   A E+ E A + +     RG
Sbjct: 27 SYTYLSLGFYFDRDDVALEGVCHFFRELAEEKMEGAERLLKMQNQRG 73


>pdb|2JD6|0 Chain 0, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|1 Chain 1, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|2 Chain 2, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|3 Chain 3, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|4 Chain 4, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|5 Chain 5, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|6 Chain 6, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|7 Chain 7, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|8 Chain 8, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|9 Chain 9, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|A Chain A, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|B Chain B, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|C Chain C, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|D Chain D, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|E Chain E, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|F Chain F, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|G Chain G, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|H Chain H, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|I Chain I, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|J Chain J, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|K Chain K, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|L Chain L, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|M Chain M, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|N Chain N, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|O Chain O, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|P Chain P, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|Q Chain Q, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|R Chain R, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|S Chain S, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|T Chain T, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|U Chain U, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|V Chain V, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|W Chain W, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|X Chain X, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|Y Chain Y, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD6|Z Chain Z, Crystal Structure Of The As Isolated Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|0 Chain 0, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|1 Chain 1, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|2 Chain 2, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|3 Chain 3, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|4 Chain 4, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|5 Chain 5, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|6 Chain 6, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|7 Chain 7, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|8 Chain 8, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|9 Chain 9, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|A Chain A, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|B Chain B, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|C Chain C, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|D Chain D, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|E Chain E, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|F Chain F, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|G Chain G, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|H Chain H, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|I Chain I, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|J Chain J, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|K Chain K, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|L Chain L, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|M Chain M, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|N Chain N, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|O Chain O, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|P Chain P, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|Q Chain Q, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|R Chain R, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|S Chain S, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|T Chain T, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|U Chain U, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|V Chain V, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|W Chain W, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|X Chain X, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|Y Chain Y, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD7|Z Chain Z, Crystal Structure Of The Fe-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|0 Chain 0, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|1 Chain 1, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|2 Chain 2, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|3 Chain 3, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|4 Chain 4, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|5 Chain 5, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|6 Chain 6, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|7 Chain 7, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|8 Chain 8, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|9 Chain 9, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|A Chain A, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|B Chain B, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|C Chain C, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|D Chain D, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|E Chain E, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|F Chain F, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|G Chain G, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|H Chain H, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|I Chain I, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|J Chain J, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|K Chain K, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|L Chain L, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|M Chain M, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|N Chain N, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|O Chain O, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|P Chain P, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|Q Chain Q, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|R Chain R, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|S Chain S, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|T Chain T, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|U Chain U, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|V Chain V, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|W Chain W, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|X Chain X, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|Y Chain Y, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
 pdb|2JD8|Z Chain Z, Crystal Structure Of The Zn-Soaked Ferritin From The
          Hyperthermophilic Archaeal Anaerobe Pyrococcus Furiosus
          Length = 174

 Score = 25.8 bits (55), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 2/43 (4%)

Query: 11 FAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          FA  A+F  + +   GFA +    A EE  HA++F +Y+  R 
Sbjct: 25 FAMAAYF--EDLGLEGFANWMKAQAEEEIGHALRFYNYIYDRN 65


>pdb|2X17|0 Chain 0, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
          Loaded With Ag(I)
 pdb|2X17|1 Chain 1, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
          Loaded With Ag(I)
 pdb|2X17|2 Chain 2, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
          Loaded With Ag(I)
 pdb|2X17|3 Chain 3, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
          Loaded With Ag(I)
 pdb|2X17|4 Chain 4, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
          Loaded With Ag(I)
 pdb|2X17|5 Chain 5, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
          Loaded With Ag(I)
 pdb|2X17|6 Chain 6, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
          Loaded With Ag(I)
 pdb|2X17|7 Chain 7, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
          Loaded With Ag(I)
 pdb|2X17|8 Chain 8, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
          Loaded With Ag(I)
 pdb|2X17|9 Chain 9, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
          Loaded With Ag(I)
 pdb|2X17|G Chain G, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
          Loaded With Ag(I)
 pdb|2X17|H Chain H, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
          Loaded With Ag(I)
 pdb|2X17|I Chain I, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
          Loaded With Ag(I)
 pdb|2X17|J Chain J, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
          Loaded With Ag(I)
 pdb|2X17|K Chain K, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
          Loaded With Ag(I)
 pdb|2X17|L Chain L, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
          Loaded With Ag(I)
 pdb|2X17|M Chain M, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
          Loaded With Ag(I)
 pdb|2X17|N Chain N, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
          Loaded With Ag(I)
 pdb|2X17|O Chain O, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
          Loaded With Ag(I)
 pdb|2X17|P Chain P, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
          Loaded With Ag(I)
 pdb|2X17|Q Chain Q, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
          Loaded With Ag(I)
 pdb|2X17|R Chain R, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
          Loaded With Ag(I)
 pdb|2X17|Y Chain Y, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
          Loaded With Ag(I)
 pdb|2X17|Z Chain Z, The X-Ray Structure Of Ferritin From Pyrococcus Furiosus
          Loaded With Ag(I)
          Length = 173

 Score = 25.8 bits (55), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 2/43 (4%)

Query: 11 FAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRG 53
          FA  A+F  + +   GFA +    A EE  HA++F +Y+  R 
Sbjct: 25 FAMAAYF--EDLGLEGFANWMKAQAEEEIGHALRFYNYIYDRN 65


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.139    0.434 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,382,224
Number of Sequences: 62578
Number of extensions: 71755
Number of successful extensions: 388
Number of sequences better than 100.0: 63
Number of HSP's better than 100.0 without gapping: 60
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 328
Number of HSP's gapped (non-prelim): 63
length of query: 71
length of database: 14,973,337
effective HSP length: 41
effective length of query: 30
effective length of database: 12,407,639
effective search space: 372229170
effective search space used: 372229170
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 45 (21.9 bits)