Diaphorina citri psyllid: psy1546


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600----
MVVNLTTKCFAVSRKCDFLTLNPTQFLKFSNSGSSISNQCGSTTASRRNSLKVDPELIFTKQERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEIMVLSQCDSPYGTKLWIIMEYLGGGSALDLMKAGNFEEMHIAVILREVLKGLDYLHSERKLHRDIKAANVLLSEMGDVKLADFGVAGTLTNTTSKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPNSELHPMRVLFLIPKNNPPQLTGNYTKQFKEFVEACLNKDPENRPTAKELLKFPFIRKAKKNAYLIDLIDRYKKWKNSRNEESETESETSDNEDSIKTDGDLDEPWIMTVKGKMPNEYGSSPNKKSGGMNGADNIVNNNNLNNNNNHATFISSSEKSHSPARPLSIAPGPPSSAQEKRNSMTRSDSGEHKSNPTSPDREKHKIGSPEREKLKIGSPDREKLKSPDREKHKIGSPDREKNKIGSPDKKQQTRGSPVKASARSPCLSFLIYPLISELQRRHHYTSNNRTSNSGADSSHKADAIEELKNAFDLAERSAPGISGQFVKEVVHKLLPAMSEARVNSVVDKMIRSISSIFVPIKYKF
cEEccccccCEccccccccccccccCECccccccccccccccccccccccccccHHHHHEEEEECcccccCEEEEEEEcccccEEEEEEEEcccccHHHHHHHHHHHHHHHcccccccEEEEEEcccccccHHHHHccccccccHHHHHHHHHHHHHHHHHcccccccccccccEEccccccEEECccccccccccccccccccccccccccHHHHHHcccccccHHHHHHHHHHHHHccccccccccHHHHHHcccccccccccccccHHHHHHHHHHHcccccccccHHHHHcccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccc
**VNLTTKCF*********************************************ELIFTKQERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEIMVLSQCDSPYGTKLWIIMEYLGGGSALDLMKAGNFEEMHIAVILREVLKGLDYLHSERKLHRDIKAANVLLSEMGDVKLADFGVAGTLTNTTSKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPNSELHPMRVLFLIPKNNPPQLTGNYTKQFKEFVEACLNKDPENRPTAKELLKFPFIRKAKKNAYLIDLIDRYKKW********************************************************************************************************************************************************************************************L*FLIYPLISELQ*****************************************ISGQFVKEVVHKLLPAMSEARVNSVVDKMIRSISSIFVPIKYK*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVVNLTTKCFAVSRKCDFLTLNPTQFLKFSNSGSSISNQCGSTTASRRNSLKVDPELIFTKQERIGKGSFGEVFKGIDNRTQQVxxxxxxxxxxxxxxxxxxxxxxxxxxxxDSPYGTKLWIIMEYLGGGSALDLMKAGNFEEMHIAVILREVLKGLDYLHSERKLHRDIKAANVLLSEMGDVKLADFGVAGTLTNTTSKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPNSELHPMRVLFLIPKNNPPQLTGNYTKQFKEFVEACLNKDPENRPTAKELLKFPFIRKAKKNAYLIDLIDRYKKWKNSRNEESETESETSDNEDSIKTDGDLDEPWIMTVKGKMPNEYGSSPNKKSGGMNGADNIVNNNNLNNNNNHATFISSSEKSHSPARPLSIAPGPPSSAQEKRNSMTRSDSGEHKSNPTSPDREKHKIGSPEREKLKIGSPDREKLKSPDREKHKIGSPDREKNKIGSPDKKQQTRGSPVKASARSPCLSFLIYPLISELQRRHHYTSNNRTSNSGADSSHKADAIEELKNAFDLAERSAPGISGQFVKEVVHKLLPAMSEARVNSVVDKMIRSISSIFVPIKYKF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein kinase 24 Serine/threonine-protein kinase that acts on both serine and threonine residues and promotes apoptosis in response to stress stimuli and caspase activation. Mediates oxidative-stress-induced cell death by modulating phosphorylation of JNK1-JNK2 (MAPK8 and MAPK9), p38 (MAPK11, MAPK12, MAPK13 and MAPK14) during oxidative stress. Plays a role in a staurosporine-induced caspase-independent apoptotic pathway by regulating the nuclear translocation of AIFM1 and ENDOG and the DNase activity associated with ENDOG. Phosphorylates STK38L on 'Thr-442' and stimulates its kinase activity. Regulates cellular migration with alteration of PTPN12 activity and PXN phosphorylation: phosphorylates PTPN12 and inhibits its activity and may regulate PXN phosphorylation through PTPN12. Acts as a key regulator of axon regeneration in the optic nerve and radial nerve.confidentQ99KH8
Serine/threonine-protein kinase 25 Oxidant stress-activated serine/threonine kinase that may play a role in the response to environmental stress. Targets to the Golgi apparatus where it appears to regulate protein transport events, cell adhesion, and polarity complexes important for cell migration.confidentQ3SWY6
Serine/threonine-protein kinase 24 Serine/threonine-protein kinase that acts on both serine and threonine residues and promotes apoptosis in response to stress stimuli and caspase activation. Mediates oxidative-stress-induced cell death by modulating phosphorylation of JNK1-JNK2 (MAPK8 and MAPK9), p38 (MAPK11, MAPK12, MAPK13 and MAPK14) during oxidative stress. Plays a role in a staurosporine-induced caspase-independent apoptotic pathway by regulating the nuclear translocation of AIFM1 and ENDOG and the DNase activity associated with ENDOG. Phosphorylates STK38L on 'Thr-442' and stimulates its kinase activity. Regulates cellular migration with alteration of PTPN12 activity and PXN phosphorylation: phosphorylates PTPN12 and inhibits its activity and may regulate PXN phosphorylation through PTPN12. May act as a key regulator of axon regeneration in the optic nerve and radial nerve.confidentQ9Y6E0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000287 [MF]magnesium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0051493 [BP]regulation of cytoskeleton organizationprobableGO:0033043, GO:0051128, GO:0008150, GO:0065007, GO:0050794, GO:0050789
GO:0030295 [MF]protein kinase activator activityprobableGO:0019207, GO:0019887, GO:0030234, GO:0019209, GO:0003674, GO:0008047
GO:0071902 [BP]positive regulation of protein serine/threonine kinase activityprobableGO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0031323, GO:0045860, GO:0071900, GO:0050789, GO:0043085, GO:0080090, GO:0051347, GO:0010604, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0050790, GO:0045937, GO:0060255, GO:0045859, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0051338, GO:0001932, GO:0001934, GO:0048522
GO:0043410 [BP]positive regulation of MAPK cascadeprobableGO:0023051, GO:0010646, GO:0009966, GO:0010740, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0009967, GO:0048518, GO:0008150, GO:0010647, GO:0048522, GO:0010627, GO:0050789, GO:0043408
GO:0000165 [BP]MAPK cascadeprobableGO:0044700, GO:0051716, GO:0007243, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0032154 [CC]cleavage furrowprobableGO:0005575, GO:0044464, GO:0032153, GO:0032155, GO:0005623
GO:0048679 [BP]regulation of axon regenerationprobableGO:0022604, GO:0048856, GO:0051239, GO:0032101, GO:0030154, GO:0048583, GO:0051128, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0022603, GO:0060284, GO:0031344, GO:0045664, GO:0010769, GO:0065007, GO:0070570, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0008150, GO:0010975, GO:0022008, GO:0044707, GO:0048699, GO:0050770, GO:0007399, GO:0080134, GO:0080135, GO:0044763, GO:0051960, GO:2000026, GO:0007275, GO:0048731
GO:0007163 [BP]establishment or maintenance of cell polarityprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0030336 [BP]negative regulation of cell migrationprobableGO:0040013, GO:0051270, GO:0065007, GO:0051271, GO:0040012, GO:0008150, GO:0030334, GO:2000145, GO:2000146, GO:0048519, GO:0032879, GO:0050794, GO:0050789, GO:0048523
GO:0019899 [MF]enzyme bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0043405 [BP]regulation of MAP kinase activityprobableGO:0019220, GO:0080090, GO:0019222, GO:0031323, GO:0023051, GO:0071900, GO:0010627, GO:0050789, GO:0043408, GO:0010646, GO:0009966, GO:0043549, GO:0051246, GO:0065007, GO:0031399, GO:0065009, GO:0045859, GO:0060255, GO:0048583, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0032268, GO:0051338, GO:0001932
GO:0010564 [BP]regulation of cell cycle processprobableGO:0008150, GO:0050794, GO:0065007, GO:0050789, GO:0051726
GO:0004674 [MF]protein serine/threonine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0033554 [BP]cellular response to stressprobableGO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0008150, GO:0044699
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0050772 [BP]positive regulation of axonogenesisprobableGO:0022604, GO:0032502, GO:0044707, GO:0051239, GO:0022603, GO:0030154, GO:0051128, GO:0031344, GO:0044699, GO:0031346, GO:0050767, GO:0048869, GO:0060284, GO:0050769, GO:0045664, GO:0010769, GO:0065007, GO:0010720, GO:0048518, GO:0051130, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045597, GO:0045595, GO:0008150, GO:0010975, GO:0022008, GO:0048699, GO:0050770, GO:0007399, GO:0051094, GO:0048856, GO:0044763, GO:0050789, GO:0051960, GO:2000026, GO:0007275, GO:0048731, GO:0048522
GO:0015629 [CC]actin cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0006917 [BP]induction of apoptosisprobableGO:0050789, GO:0043067, GO:0050794, GO:0043065, GO:0048518, GO:0012502, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0051645 [BP]Golgi localizationprobableGO:0009987, GO:0044763, GO:0051640, GO:0008150, GO:0051179, GO:0044699, GO:0051641
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0005816 [CC]spindle pole bodyprobableGO:0043234, GO:0005575, GO:0005819, GO:0032991, GO:0005622, GO:0043232, GO:0005856, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0000922, GO:0043226, GO:0015630
GO:0051285 [CC]cell cortex of cell tipprobableGO:0005737, GO:0060187, GO:0051286, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424, GO:0044448
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0007507 [BP]heart developmentprobableGO:0032502, GO:0048513, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0008631 [BP]intrinsic apoptotic signaling pathway in response to oxidative stressprobableGO:0097190, GO:0097193, GO:0023052, GO:0007165, GO:0035556, GO:0007569, GO:0050789, GO:0044699, GO:0051716, GO:0065007, GO:0010259, GO:0006915, GO:0009987, GO:0050794, GO:0012501, GO:0006950, GO:0008150, GO:0007154, GO:0006979, GO:0044700, GO:0050896, GO:0044763
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0007015 [BP]actin filament organizationprobableGO:0006996, GO:0007010, GO:0071822, GO:0030029, GO:0043933, GO:0071840, GO:0009987, GO:0030036, GO:0044763, GO:0016043, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3A7I, chain A
Confidence level:very confident
Coverage over the Query: 51-323
View the alignment between query and template
View the model in PyMOL
Template: 4APC, chain A
Confidence level:very confident
Coverage over the Query: 59-321
View the alignment between query and template
View the model in PyMOL
Template: 2YJR, chain A
Confidence level:probable
Coverage over the Query: 44-190,205-295
View the alignment between query and template
View the model in PyMOL
Template: 3AJM, chain A
Confidence level:probable
Coverage over the Query: 507-521,540-573
View the alignment between query and template
View the model in PyMOL