BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy15499
(151 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3GAF|A Chain A, 2.2a Crystal Structure Of 7-Alpha-Hydroxysteroid
Dehydrogenase From Brucella Melitensis
pdb|3GAF|B Chain B, 2.2a Crystal Structure Of 7-Alpha-Hydroxysteroid
Dehydrogenase From Brucella Melitensis
pdb|3GAF|C Chain C, 2.2a Crystal Structure Of 7-Alpha-Hydroxysteroid
Dehydrogenase From Brucella Melitensis
pdb|3GAF|D Chain D, 2.2a Crystal Structure Of 7-Alpha-Hydroxysteroid
Dehydrogenase From Brucella Melitensis
pdb|3GAF|E Chain E, 2.2a Crystal Structure Of 7-Alpha-Hydroxysteroid
Dehydrogenase From Brucella Melitensis
pdb|3GAF|F Chain F, 2.2a Crystal Structure Of 7-Alpha-Hydroxysteroid
Dehydrogenase From Brucella Melitensis
pdb|3GAF|G Chain G, 2.2a Crystal Structure Of 7-Alpha-Hydroxysteroid
Dehydrogenase From Brucella Melitensis
pdb|3GAF|H Chain H, 2.2a Crystal Structure Of 7-Alpha-Hydroxysteroid
Dehydrogenase From Brucella Melitensis
Length = 256
Score = 27.3 bits (59), Expect = 3.1, Method: Compositional matrix adjust.
Identities = 14/58 (24%), Positives = 29/58 (50%), Gaps = 2/58 (3%)
Query: 61 LQVLMGVLFLSLNLM--RDCRLHLIEYKSSALIINHIAMGMSFAVTAINLLISAFDPG 116
+Q G L+++ M + + + Y SS +NH+ ++F V + + ++A PG
Sbjct: 134 MQKAGGGAILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPG 191
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.138 0.380
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,991,776
Number of Sequences: 62578
Number of extensions: 82139
Number of successful extensions: 218
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 217
Number of HSP's gapped (non-prelim): 1
length of query: 151
length of database: 14,973,337
effective HSP length: 90
effective length of query: 61
effective length of database: 9,341,317
effective search space: 569820337
effective search space used: 569820337
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 47 (22.7 bits)