BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy15499
         (151 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3GAF|A Chain A, 2.2a Crystal Structure Of 7-Alpha-Hydroxysteroid
           Dehydrogenase From Brucella Melitensis
 pdb|3GAF|B Chain B, 2.2a Crystal Structure Of 7-Alpha-Hydroxysteroid
           Dehydrogenase From Brucella Melitensis
 pdb|3GAF|C Chain C, 2.2a Crystal Structure Of 7-Alpha-Hydroxysteroid
           Dehydrogenase From Brucella Melitensis
 pdb|3GAF|D Chain D, 2.2a Crystal Structure Of 7-Alpha-Hydroxysteroid
           Dehydrogenase From Brucella Melitensis
 pdb|3GAF|E Chain E, 2.2a Crystal Structure Of 7-Alpha-Hydroxysteroid
           Dehydrogenase From Brucella Melitensis
 pdb|3GAF|F Chain F, 2.2a Crystal Structure Of 7-Alpha-Hydroxysteroid
           Dehydrogenase From Brucella Melitensis
 pdb|3GAF|G Chain G, 2.2a Crystal Structure Of 7-Alpha-Hydroxysteroid
           Dehydrogenase From Brucella Melitensis
 pdb|3GAF|H Chain H, 2.2a Crystal Structure Of 7-Alpha-Hydroxysteroid
           Dehydrogenase From Brucella Melitensis
          Length = 256

 Score = 27.3 bits (59), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/58 (24%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query: 61  LQVLMGVLFLSLNLM--RDCRLHLIEYKSSALIINHIAMGMSFAVTAINLLISAFDPG 116
           +Q   G   L+++ M   +  + +  Y SS   +NH+   ++F V  + + ++A  PG
Sbjct: 134 MQKAGGGAILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPG 191


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.138    0.380 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,991,776
Number of Sequences: 62578
Number of extensions: 82139
Number of successful extensions: 218
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 217
Number of HSP's gapped (non-prelim): 1
length of query: 151
length of database: 14,973,337
effective HSP length: 90
effective length of query: 61
effective length of database: 9,341,317
effective search space: 569820337
effective search space used: 569820337
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 47 (22.7 bits)