Diaphorina citri psyllid: psy15515


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240--
MSGAHPSEGSSNPSSPSSTQNNAFFNYQAAVNNNAPKYGTVVPKRVFVGGITSTTTEDELCELFSQYGIVKQVKIVVDRAGISKGYGFITFDSEEEAKRLQKDSDNIMFKEKRLNIAPAIKKQGFTGTYDSLPTVTSPVPPVPTSNMYYHNGLPYTYHNGMAFFPSNGQSMVPTSPPTVPTQVKILLPPGVLLCGICLIFLITLALAPTIKRPSLKPLNSSQCKIKQSRGRLLSRACSSSSQ
ccccccccccccccccccccccccccHHHHcccccccccccccccEEEccccccccHHHHHHHHcccccEEEEEEEEccccccccEEEEEEccHHHHHHHHHHccccEEccEEEEECcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccHHHHHHHHccccccccccccc
********************************NNAPKYGTVVPKRVFVGGITSTTTEDELCELFSQYGIVKQVKIVVDRAGISKGYGFITFDSEEEAKRLQKDSDNIMFKEKRLNIAPAIKKQGFTGTYDSLPTVTSPVPPVPTSNMYYHNGLPYTYHNGMAFFP*************VPTQVKILLPPGVLLCGICLIFLITLALAPTI********************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGAHPSEGSSNPSSPSSTQNNAFFNYQAAVNNNAPKYGTVVPKRVFVGGITSTTTEDELCELFSQYGIVKQVKIVVDRAGISKGYGFITFDSEEEAKRLQKDSDNIMFKEKRLNIAPAIKKQGFTGTYDSLPTVTSPVPPVPTSNMYYHNGLPYTYHNGMAFFPSNGQSMVPTSPPTVPTQVKILLPPGVLLCGICLIFLITLALAPTIKRPSLKPLNSSQCKIKQSRGRLLSRACSSSSQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein boule RNA-binding protein that plays a central role in spermatogenesis. Required for meiotic entry and germline differentiation, at the transition between G2 and M phases of meiosis I. Acts by regulating translation of specific mRNAs, possibly by binding to their 3'-UTR. Essential for translation of twine (twe) mRNA. Required for the expression of various genes such as CG6784, CG17210, CG15841 scpr-B, scpr-C, and rho-6.confidentQ24207

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0008494 [MF]translation activator activityprobableGO:0090079, GO:0045182, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0003723 [MF]RNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0045948 [BP]positive regulation of translational initiationprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010608, GO:0009891, GO:2000112, GO:0051247, GO:0051246, GO:0032270, GO:0048518, GO:0065007, GO:0045727, GO:0010468, GO:0060255, GO:0006446, GO:0009889, GO:0050794, GO:0008150, GO:0032268, GO:0010557, GO:0010556, GO:0006417, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1L3K, chain A
Confidence level:very confident
Coverage over the Query: 42-120
View the alignment between query and template
View the model in PyMOL