BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy15518
(195 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4I1M|A Chain A, Crystal Structure Of The Legionella Pneumophila Gap Domain
Of Lepb
pdb|4I1M|B Chain B, Crystal Structure Of The Legionella Pneumophila Gap Domain
Of Lepb
pdb|4I1M|C Chain C, Crystal Structure Of The Legionella Pneumophila Gap Domain
Of Lepb
pdb|4I1O|B Chain B, Crystal Structure Of The Legionella Pneumophila Gap Domain
Of Lepb In Complex With Rab1b Bound To Gdp And Bef3
pdb|4I1O|D Chain D, Crystal Structure Of The Legionella Pneumophila Gap Domain
Of Lepb In Complex With Rab1b Bound To Gdp And Bef3
pdb|4I1O|F Chain F, Crystal Structure Of The Legionella Pneumophila Gap Domain
Of Lepb In Complex With Rab1b Bound To Gdp And Bef3
pdb|4I1O|H Chain H, Crystal Structure Of The Legionella Pneumophila Gap Domain
Of Lepb In Complex With Rab1b Bound To Gdp And Bef3
Length = 302
Score = 28.1 bits (61), Expect = 3.1, Method: Compositional matrix adjust.
Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 4/72 (5%)
Query: 74 RTRNIRRYS---DPIVFVDLIVDVTFIVD-IAINFRTTYVNANDEVVSNPGLIALHYLRG 129
+T ++ ++S +PI ++L+ VD +AI V A + + S P L AL+ G
Sbjct: 35 KTTDMEKFSFDSNPINLLELVKQFNLYVDELAITCEANNVWAKERIDSTPNLFALYDNSG 94
Query: 130 WFIIDLVAAIPF 141
I A +P+
Sbjct: 95 GEAIHGHAFVPY 106
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.329 0.143 0.442
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,615,508
Number of Sequences: 62578
Number of extensions: 218843
Number of successful extensions: 511
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 511
Number of HSP's gapped (non-prelim): 1
length of query: 195
length of database: 14,973,337
effective HSP length: 94
effective length of query: 101
effective length of database: 9,091,005
effective search space: 918191505
effective search space used: 918191505
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 49 (23.5 bits)