BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy15526
         (71 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4ANI|A Chain A, Structural Basis For The Intermolecular Communication
           Between Dnak And Grpe In The Dnak Chaperone System From
           Geobacillus Kaustophilus Hta426
 pdb|4ANI|B Chain B, Structural Basis For The Intermolecular Communication
           Between Dnak And Grpe In The Dnak Chaperone System From
           Geobacillus Kaustophilus Hta426
 pdb|4ANI|E Chain E, Structural Basis For The Intermolecular Communication
           Between Dnak And Grpe In The Dnak Chaperone System From
           Geobacillus Kaustophilus Hta426
 pdb|4ANI|F Chain F, Structural Basis For The Intermolecular Communication
           Between Dnak And Grpe In The Dnak Chaperone System From
           Geobacillus Kaustophilus Hta426
          Length = 213

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 45/70 (64%)

Query: 1   MTDGNLKKVFKRHGLEPINPLGEKFDPNFHEALFEQEVEGKEANTVVVVSKIGYKLYNRV 60
           M   +L    K+ G+E I  +G+ FDP  H+A+ + E EG E NTVV   + GYKL +RV
Sbjct: 144 MVYRSLVDALKKEGVEAIEAVGKPFDPYLHQAVMQAEAEGYEPNTVVEELQKGYKLKDRV 203

Query: 61  IRPALVGISK 70
           +RPA+V +S+
Sbjct: 204 LRPAMVKVSQ 213


>pdb|1DKG|A Chain A, Crystal Structure Of The Nucleotide Exchange Factor Grpe
           Bound To The Atpase Domain Of The Molecular Chaperone
           Dnak
 pdb|1DKG|B Chain B, Crystal Structure Of The Nucleotide Exchange Factor Grpe
           Bound To The Atpase Domain Of The Molecular Chaperone
           Dnak
          Length = 197

 Score = 37.7 bits (86), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 37/71 (52%)

Query: 1   MTDGNLKKVFKRHGLEPINPLGEKFDPNFHEALFEQEVEGKEANTVVVVSKIGYKLYNRV 60
           +T  ++  V ++ G+E I       DPN H+A+   E +      V+ + + GY L  R 
Sbjct: 125 LTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRT 184

Query: 61  IRPALVGISKS 71
           IR A+V ++K+
Sbjct: 185 IRAAMVTVAKA 195


>pdb|3A6M|A Chain A, Crystal Structure Of Grpe From Thermus Thermophilus Hb8
 pdb|3A6M|B Chain B, Crystal Structure Of Grpe From Thermus Thermophilus Hb8
          Length = 177

 Score = 32.0 bits (71), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 14  GLEPINPLGEKFDPNFHEALFEQEVEGKEANTVVVVSKIGYKLYNRVIRPALVGISKS 71
           G+E +   GE FDP +HEA+    +   E   V  V + G+++   ++RPA V + + 
Sbjct: 115 GVEEVPGEGEAFDPRYHEAVG---LLPGEPGKVAKVFQRGFRMGEALVRPARVAVGEE 169


>pdb|1YA0|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Smg7
 pdb|1YA0|B Chain B, Crystal Structure Of The N-Terminal Domain Of Human Smg7
          Length = 497

 Score = 29.3 bits (64), Expect = 0.56,   Method: Composition-based stats.
 Identities = 13/42 (30%), Positives = 23/42 (54%)

Query: 9   VFKRHGLEPINPLGEKFDPNFHEALFEQEVEGKEANTVVVVS 50
           V+    LE ++PL EK +  F E LF++    ++   V V++
Sbjct: 260 VYLSKSLEKLSPLREKLEEQFKELLFQKAFNSQQLVHVTVIN 301


>pdb|3HDQ|A Chain A, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
           Form) In Complex With Substrate
 pdb|3HDQ|B Chain B, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
           Form) In Complex With Substrate
 pdb|3HDQ|C Chain C, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
           Form) In Complex With Substrate
 pdb|3HDQ|D Chain D, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
           Form) In Complex With Substrate
 pdb|3HDQ|E Chain E, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
           Form) In Complex With Substrate
 pdb|3HDQ|F Chain F, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
           Form) In Complex With Substrate
 pdb|3HDQ|G Chain G, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
           Form) In Complex With Substrate
 pdb|3HDQ|H Chain H, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
           Form) In Complex With Substrate
 pdb|3HDQ|I Chain I, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
           Form) In Complex With Substrate
 pdb|3HDQ|J Chain J, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
           Form) In Complex With Substrate
 pdb|3HDY|A Chain A, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
           Form) In Complex With Substrate
 pdb|3HDY|B Chain B, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
           Form) In Complex With Substrate
 pdb|3HDY|C Chain C, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
           Form) In Complex With Substrate
 pdb|3HDY|D Chain D, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
           Form) In Complex With Substrate
 pdb|3HDY|E Chain E, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
           Form) In Complex With Substrate
 pdb|3HDY|F Chain F, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
           Form) In Complex With Substrate
 pdb|3HDY|G Chain G, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
           Form) In Complex With Substrate
 pdb|3HDY|H Chain H, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
           Form) In Complex With Substrate
 pdb|3HDY|I Chain I, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
           Form) In Complex With Substrate
 pdb|3HDY|J Chain J, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
           Form) In Complex With Substrate
 pdb|3HE3|A Chain A, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Udp
 pdb|3HE3|B Chain B, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Udp
 pdb|3HE3|C Chain C, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Udp
 pdb|3HE3|D Chain D, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Udp
 pdb|3HE3|E Chain E, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Udp
 pdb|3HE3|F Chain F, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Udp
 pdb|3HE3|G Chain G, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Udp
 pdb|3HE3|H Chain H, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Udp
 pdb|3HE3|I Chain I, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Udp
 pdb|3HE3|J Chain J, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Udp
 pdb|3MJ4|A Chain A, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Phosphonate Analog Of Udp-Galactopyranose
 pdb|3MJ4|B Chain B, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Phosphonate Analog Of Udp-Galactopyranose
 pdb|3MJ4|C Chain C, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Phosphonate Analog Of Udp-Galactopyranose
 pdb|3MJ4|D Chain D, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Phosphonate Analog Of Udp-Galactopyranose
 pdb|3MJ4|E Chain E, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Phosphonate Analog Of Udp-Galactopyranose
 pdb|3MJ4|F Chain F, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Phosphonate Analog Of Udp-Galactopyranose
 pdb|3MJ4|G Chain G, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Phosphonate Analog Of Udp-Galactopyranose
 pdb|3MJ4|H Chain H, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Phosphonate Analog Of Udp-Galactopyranose
 pdb|3MJ4|I Chain I, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Phosphonate Analog Of Udp-Galactopyranose
 pdb|3MJ4|J Chain J, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
           With Phosphonate Analog Of Udp-Galactopyranose
          Length = 397

 Score = 26.2 bits (56), Expect = 4.4,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 5/58 (8%)

Query: 5   NLKKVFKRHGLEPINPLGEKFDPNFHEALFEQEVEGKEANTVVVVSKIGYKLYNRVIR 62
           NL  V + +GL   +   E+F  +  E     +VE    +  VVVSK+G  LYN+  R
Sbjct: 125 NLDTVNRLYGLNLTSFQVEEFFASVAE-----KVEQVRTSEDVVVSKVGRDLYNKFFR 177


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.138    0.392 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,194,402
Number of Sequences: 62578
Number of extensions: 72792
Number of successful extensions: 178
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 173
Number of HSP's gapped (non-prelim): 7
length of query: 71
length of database: 14,973,337
effective HSP length: 41
effective length of query: 30
effective length of database: 12,407,639
effective search space: 372229170
effective search space used: 372229170
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 45 (21.9 bits)