BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy15526
(71 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4ANI|A Chain A, Structural Basis For The Intermolecular Communication
Between Dnak And Grpe In The Dnak Chaperone System From
Geobacillus Kaustophilus Hta426
pdb|4ANI|B Chain B, Structural Basis For The Intermolecular Communication
Between Dnak And Grpe In The Dnak Chaperone System From
Geobacillus Kaustophilus Hta426
pdb|4ANI|E Chain E, Structural Basis For The Intermolecular Communication
Between Dnak And Grpe In The Dnak Chaperone System From
Geobacillus Kaustophilus Hta426
pdb|4ANI|F Chain F, Structural Basis For The Intermolecular Communication
Between Dnak And Grpe In The Dnak Chaperone System From
Geobacillus Kaustophilus Hta426
Length = 213
Score = 64.7 bits (156), Expect = 1e-11, Method: Compositional matrix adjust.
Identities = 31/70 (44%), Positives = 45/70 (64%)
Query: 1 MTDGNLKKVFKRHGLEPINPLGEKFDPNFHEALFEQEVEGKEANTVVVVSKIGYKLYNRV 60
M +L K+ G+E I +G+ FDP H+A+ + E EG E NTVV + GYKL +RV
Sbjct: 144 MVYRSLVDALKKEGVEAIEAVGKPFDPYLHQAVMQAEAEGYEPNTVVEELQKGYKLKDRV 203
Query: 61 IRPALVGISK 70
+RPA+V +S+
Sbjct: 204 LRPAMVKVSQ 213
>pdb|1DKG|A Chain A, Crystal Structure Of The Nucleotide Exchange Factor Grpe
Bound To The Atpase Domain Of The Molecular Chaperone
Dnak
pdb|1DKG|B Chain B, Crystal Structure Of The Nucleotide Exchange Factor Grpe
Bound To The Atpase Domain Of The Molecular Chaperone
Dnak
Length = 197
Score = 37.7 bits (86), Expect = 0.001, Method: Compositional matrix adjust.
Identities = 21/71 (29%), Positives = 37/71 (52%)
Query: 1 MTDGNLKKVFKRHGLEPINPLGEKFDPNFHEALFEQEVEGKEANTVVVVSKIGYKLYNRV 60
+T ++ V ++ G+E I DPN H+A+ E + V+ + + GY L R
Sbjct: 125 LTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRT 184
Query: 61 IRPALVGISKS 71
IR A+V ++K+
Sbjct: 185 IRAAMVTVAKA 195
>pdb|3A6M|A Chain A, Crystal Structure Of Grpe From Thermus Thermophilus Hb8
pdb|3A6M|B Chain B, Crystal Structure Of Grpe From Thermus Thermophilus Hb8
Length = 177
Score = 32.0 bits (71), Expect = 0.083, Method: Compositional matrix adjust.
Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 3/58 (5%)
Query: 14 GLEPINPLGEKFDPNFHEALFEQEVEGKEANTVVVVSKIGYKLYNRVIRPALVGISKS 71
G+E + GE FDP +HEA+ + E V V + G+++ ++RPA V + +
Sbjct: 115 GVEEVPGEGEAFDPRYHEAVG---LLPGEPGKVAKVFQRGFRMGEALVRPARVAVGEE 169
>pdb|1YA0|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Smg7
pdb|1YA0|B Chain B, Crystal Structure Of The N-Terminal Domain Of Human Smg7
Length = 497
Score = 29.3 bits (64), Expect = 0.56, Method: Composition-based stats.
Identities = 13/42 (30%), Positives = 23/42 (54%)
Query: 9 VFKRHGLEPINPLGEKFDPNFHEALFEQEVEGKEANTVVVVS 50
V+ LE ++PL EK + F E LF++ ++ V V++
Sbjct: 260 VYLSKSLEKLSPLREKLEEQFKELLFQKAFNSQQLVHVTVIN 301
>pdb|3HDQ|A Chain A, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
Form) In Complex With Substrate
pdb|3HDQ|B Chain B, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
Form) In Complex With Substrate
pdb|3HDQ|C Chain C, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
Form) In Complex With Substrate
pdb|3HDQ|D Chain D, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
Form) In Complex With Substrate
pdb|3HDQ|E Chain E, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
Form) In Complex With Substrate
pdb|3HDQ|F Chain F, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
Form) In Complex With Substrate
pdb|3HDQ|G Chain G, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
Form) In Complex With Substrate
pdb|3HDQ|H Chain H, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
Form) In Complex With Substrate
pdb|3HDQ|I Chain I, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
Form) In Complex With Substrate
pdb|3HDQ|J Chain J, Crystal Structure Of Udp-Galactopyranose Mutase (Oxidized
Form) In Complex With Substrate
pdb|3HDY|A Chain A, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
Form) In Complex With Substrate
pdb|3HDY|B Chain B, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
Form) In Complex With Substrate
pdb|3HDY|C Chain C, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
Form) In Complex With Substrate
pdb|3HDY|D Chain D, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
Form) In Complex With Substrate
pdb|3HDY|E Chain E, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
Form) In Complex With Substrate
pdb|3HDY|F Chain F, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
Form) In Complex With Substrate
pdb|3HDY|G Chain G, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
Form) In Complex With Substrate
pdb|3HDY|H Chain H, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
Form) In Complex With Substrate
pdb|3HDY|I Chain I, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
Form) In Complex With Substrate
pdb|3HDY|J Chain J, Crystal Structure Of Udp-Galactopyranose Mutase (Reduced
Form) In Complex With Substrate
pdb|3HE3|A Chain A, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Udp
pdb|3HE3|B Chain B, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Udp
pdb|3HE3|C Chain C, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Udp
pdb|3HE3|D Chain D, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Udp
pdb|3HE3|E Chain E, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Udp
pdb|3HE3|F Chain F, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Udp
pdb|3HE3|G Chain G, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Udp
pdb|3HE3|H Chain H, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Udp
pdb|3HE3|I Chain I, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Udp
pdb|3HE3|J Chain J, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Udp
pdb|3MJ4|A Chain A, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Phosphonate Analog Of Udp-Galactopyranose
pdb|3MJ4|B Chain B, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Phosphonate Analog Of Udp-Galactopyranose
pdb|3MJ4|C Chain C, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Phosphonate Analog Of Udp-Galactopyranose
pdb|3MJ4|D Chain D, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Phosphonate Analog Of Udp-Galactopyranose
pdb|3MJ4|E Chain E, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Phosphonate Analog Of Udp-Galactopyranose
pdb|3MJ4|F Chain F, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Phosphonate Analog Of Udp-Galactopyranose
pdb|3MJ4|G Chain G, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Phosphonate Analog Of Udp-Galactopyranose
pdb|3MJ4|H Chain H, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Phosphonate Analog Of Udp-Galactopyranose
pdb|3MJ4|I Chain I, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Phosphonate Analog Of Udp-Galactopyranose
pdb|3MJ4|J Chain J, Crystal Structure Of Udp-Galactopyranose Mutase In Complex
With Phosphonate Analog Of Udp-Galactopyranose
Length = 397
Score = 26.2 bits (56), Expect = 4.4, Method: Composition-based stats.
Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 5/58 (8%)
Query: 5 NLKKVFKRHGLEPINPLGEKFDPNFHEALFEQEVEGKEANTVVVVSKIGYKLYNRVIR 62
NL V + +GL + E+F + E +VE + VVVSK+G LYN+ R
Sbjct: 125 NLDTVNRLYGLNLTSFQVEEFFASVAE-----KVEQVRTSEDVVVSKVGRDLYNKFFR 177
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.316 0.138 0.392
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,194,402
Number of Sequences: 62578
Number of extensions: 72792
Number of successful extensions: 178
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 173
Number of HSP's gapped (non-prelim): 7
length of query: 71
length of database: 14,973,337
effective HSP length: 41
effective length of query: 30
effective length of database: 12,407,639
effective search space: 372229170
effective search space used: 372229170
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 45 (21.9 bits)