Diaphorina citri psyllid: psy15537


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MTTAQGTAVLVRRIDRDDITIAVDGSLYKYHPRLKHWLQKYIQLLVPNKTFRLLLAEDGSGKGAGLASAIALKLGAFQSK
ccHHHHHHHHHHHcccccEEEEEccccccccccHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHHHHHHcc
MTTAQGTAVLVRRIDRDDITIAVDGSLYKYHPRLKHWLQKYIQLLVPNKTFRLLLAEDGSGKGAGLASAIALKL******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTAQGTAVLVRRIDRDDITIAVDGSLYKYHPRLKHWLQKYIQLLVPNKTFRLLLAEDGSGKGAGLASAIALKLGAFQSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Hexokinase-2 confidentA2PYL6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050789 [BP]regulation of biological processprobableGO:0008150, GO:0065007
GO:0006796 [BP]phosphate-containing compound metabolic processprobableGO:0009987, GO:0008150, GO:0008152, GO:0044237, GO:0006793
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:1901135 [BP]carbohydrate derivative metabolic processprobableGO:0071704, GO:0008150, GO:0008152
GO:0019637 [BP]organophosphate metabolic processprobableGO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152, GO:0006793
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005741 [CC]mitochondrial outer membraneprobableGO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031968, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0019867, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0006007 [BP]glucose catabolic processprobableGO:0071704, GO:0019320, GO:1901575, GO:0005975, GO:0044238, GO:0046365, GO:0005996, GO:0019318, GO:0016052, GO:0008150, GO:0008152, GO:0044723, GO:0006006, GO:0009056, GO:0044724
GO:0004340 [MF]glucokinase activityprobableGO:0019200, GO:0016773, GO:0016772, GO:0016301, GO:0004396, GO:0003824, GO:0016740, GO:0003674
GO:0005536 [MF]glucose bindingprobableGO:0005488, GO:0003674, GO:0048029, GO:0030246
GO:0008637 [BP]apoptotic mitochondrial changesprobableGO:0006996, GO:0010259, GO:0009987, GO:0071840, GO:0006915, GO:0016043, GO:0012501, GO:0044763, GO:0044699, GO:0008150, GO:0007569, GO:0007005

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1CZA, chain N
Confidence level:very confident
Coverage over the Query: 1-78
View the alignment between query and template
View the model in PyMOL