BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy15540
         (87 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For
           Poly-Specific Drug Binding
 pdb|3G5U|B Chain B, Structure Of P-Glycoprotein Reveals A Molecular Basis For
           Poly-Specific Drug Binding
          Length = 1284

 Score = 25.4 bits (54), Expect = 9.2,   Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 26/45 (57%), Gaps = 3/45 (6%)

Query: 37  ALGAVFGSPVVGNLVDTVGRKNTMLLLAVPTLVGWGLIIWSQSVS 81
           A+   FG  ++G    T G K T+++LA+  ++G    IW++ +S
Sbjct: 192 AMATFFGGFIIGF---TRGWKLTLVILAISPVLGLSAGIWAKILS 233


>pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For
           Poly-Specific Drug Binding
 pdb|3G60|B Chain B, Structure Of P-Glycoprotein Reveals A Molecular Basis For
           Poly-Specific Drug Binding
 pdb|3G61|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For
           Poly-Specific Drug Binding
 pdb|3G61|B Chain B, Structure Of P-Glycoprotein Reveals A Molecular Basis For
           Poly-Specific Drug Binding
          Length = 1284

 Score = 25.4 bits (54), Expect = 9.3,   Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 26/45 (57%), Gaps = 3/45 (6%)

Query: 37  ALGAVFGSPVVGNLVDTVGRKNTMLLLAVPTLVGWGLIIWSQSVS 81
           A+   FG  ++G    T G K T+++LA+  ++G    IW++ +S
Sbjct: 192 AMATFFGGFIIGF---TRGWKLTLVILAISPVLGLSAGIWAKILS 233


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.138    0.430 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,677,096
Number of Sequences: 62578
Number of extensions: 90548
Number of successful extensions: 154
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 154
Number of HSP's gapped (non-prelim): 2
length of query: 87
length of database: 14,973,337
effective HSP length: 55
effective length of query: 32
effective length of database: 11,531,547
effective search space: 369009504
effective search space used: 369009504
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)