Diaphorina citri psyllid: psy15544

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----
MSSYVLSPPIRSPCVLYAVPGLSAFRIHSRLLFTDIDYLKETLPPCVEEEFYEFLRSVTADQVTLYAIQEGSVVFPRVPLLRVEGPLIIVQLLETTLLTLVNFASWHNDILSTSMISSQLNRSYR
cccccccccccccEEEEcHHHHHHHHHcccccHHHHHHHHHHccccccHHHHHHHHcccccccEEEEEEccEEEcccccEEEEEccHHHHHHHHHHHHHHHHccccccccccHHHHHHccccccc
MSSYVLSPPIRSPCVLYAVPGLSAFRIHSRLLFTDIDYLKETLPPCVEEEFYEFLRSVTADQVTLYAIQEGSVVFPRVPLLRVEGPLIIVQLLETTLLTLVNFASWHNDILSTSMISSQLNRS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSYVLSPPIRSPCVLYAVPGLSAFRIHSRLLFTDIDYLKETLPPCVEEEFYEFLRSVTADQVTLYAIQEGSVVFPRVPLLRVEGPLIIVQLLETTLLTLVNFASWHNDILSTSMISSQLNRSYR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nicotinate phosphoribosyltransferase Catalyzes the conversion of nicotinic acid (NA) to NA mononucleotide (NaMN).confidentQ55G10
Nicotinate phosphoribosyltransferase Catalyzes the conversion of nicotinic acid (NA) to NA mononucleotide (NaMN).confidentQ6P3H4
Nicotinate phosphoribosyltransferase Catalyzes the conversion of nicotinic acid (NA) to NA mononucleotide (NaMN).confidentQ95XX1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2F7F, chain A
Confidence level:very confident
Coverage over the Query: 8-119
View the alignment between query and template
View the model in PyMOL