BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy1555
(271 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3AQ2|A Chain A, Molecular Insights Into Plant Cell Proliferation
Disturbance By Agrobacterium Protein 6b
pdb|3AQ2|B Chain B, Molecular Insights Into Plant Cell Proliferation
Disturbance By Agrobacterium Protein 6b
Length = 207
Score = 29.3 bits (64), Expect = 2.6, Method: Compositional matrix adjust.
Identities = 22/68 (32%), Positives = 40/68 (58%), Gaps = 7/68 (10%)
Query: 109 TFGISDAKRIIVVREPDGLLREANTNERHRMNN-IYFSRPGATYKHPDMFEEENLKALCD 167
T+ + D +RI+ V E LR+A T+ R ++ +YF+R + +P+ +++E L L D
Sbjct: 8 TWQVRDLRRILRVSELSQHLRQARTDFRSTLSQLVYFNR---SVVNPNEYDDEYL--LSD 62
Query: 168 -RKEYVFI 174
R YV++
Sbjct: 63 QRLTYVYV 70
>pdb|3AQ3|A Chain A, Molecular Insights Into Plant Cell Proliferation
Disturbance By Agrobacterium Protein 6b
pdb|3AQ3|B Chain B, Molecular Insights Into Plant Cell Proliferation
Disturbance By Agrobacterium Protein 6b
pdb|3AQ3|C Chain C, Molecular Insights Into Plant Cell Proliferation
Disturbance By Agrobacterium Protein 6b
Length = 211
Score = 29.3 bits (64), Expect = 2.7, Method: Compositional matrix adjust.
Identities = 22/68 (32%), Positives = 40/68 (58%), Gaps = 7/68 (10%)
Query: 109 TFGISDAKRIIVVREPDGLLREANTNERHRMNN-IYFSRPGATYKHPDMFEEENLKALCD 167
T+ + D +RI+ V E LR+A T+ R ++ +YF+R + +P+ +++E L L D
Sbjct: 8 TWQVRDLRRILRVSELRQHLRQARTDFRSTLSQFVYFNR---SVVNPNAYDDEYL--LSD 62
Query: 168 -RKEYVFI 174
R YV++
Sbjct: 63 QRLTYVYV 70
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.322 0.137 0.410
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,451,470
Number of Sequences: 62578
Number of extensions: 272772
Number of successful extensions: 521
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 521
Number of HSP's gapped (non-prelim): 2
length of query: 271
length of database: 14,973,337
effective HSP length: 97
effective length of query: 174
effective length of database: 8,903,271
effective search space: 1549169154
effective search space used: 1549169154
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 51 (24.3 bits)