BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy1555
         (271 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3AQ2|A Chain A, Molecular Insights Into Plant Cell Proliferation
           Disturbance By Agrobacterium Protein 6b
 pdb|3AQ2|B Chain B, Molecular Insights Into Plant Cell Proliferation
           Disturbance By Agrobacterium Protein 6b
          Length = 207

 Score = 29.3 bits (64), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 40/68 (58%), Gaps = 7/68 (10%)

Query: 109 TFGISDAKRIIVVREPDGLLREANTNERHRMNN-IYFSRPGATYKHPDMFEEENLKALCD 167
           T+ + D +RI+ V E    LR+A T+ R  ++  +YF+R   +  +P+ +++E L  L D
Sbjct: 8   TWQVRDLRRILRVSELSQHLRQARTDFRSTLSQLVYFNR---SVVNPNEYDDEYL--LSD 62

Query: 168 -RKEYVFI 174
            R  YV++
Sbjct: 63  QRLTYVYV 70


>pdb|3AQ3|A Chain A, Molecular Insights Into Plant Cell Proliferation
           Disturbance By Agrobacterium Protein 6b
 pdb|3AQ3|B Chain B, Molecular Insights Into Plant Cell Proliferation
           Disturbance By Agrobacterium Protein 6b
 pdb|3AQ3|C Chain C, Molecular Insights Into Plant Cell Proliferation
           Disturbance By Agrobacterium Protein 6b
          Length = 211

 Score = 29.3 bits (64), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 40/68 (58%), Gaps = 7/68 (10%)

Query: 109 TFGISDAKRIIVVREPDGLLREANTNERHRMNN-IYFSRPGATYKHPDMFEEENLKALCD 167
           T+ + D +RI+ V E    LR+A T+ R  ++  +YF+R   +  +P+ +++E L  L D
Sbjct: 8   TWQVRDLRRILRVSELRQHLRQARTDFRSTLSQFVYFNR---SVVNPNAYDDEYL--LSD 62

Query: 168 -RKEYVFI 174
            R  YV++
Sbjct: 63  QRLTYVYV 70


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.137    0.410 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,451,470
Number of Sequences: 62578
Number of extensions: 272772
Number of successful extensions: 521
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 521
Number of HSP's gapped (non-prelim): 2
length of query: 271
length of database: 14,973,337
effective HSP length: 97
effective length of query: 174
effective length of database: 8,903,271
effective search space: 1549169154
effective search space used: 1549169154
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 51 (24.3 bits)