BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy15557
         (207 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2UXQ|A Chain A, Isocitrate Dehydrogenase From The Psychrophilic Bacterium
           Desulfotalea Psychrophila: Biochemical Properties And
           Crystal Structure Analysis
 pdb|2UXQ|B Chain B, Isocitrate Dehydrogenase From The Psychrophilic Bacterium
           Desulfotalea Psychrophila: Biochemical Properties And
           Crystal Structure Analysis
 pdb|2UXQ|C Chain C, Isocitrate Dehydrogenase From The Psychrophilic Bacterium
           Desulfotalea Psychrophila: Biochemical Properties And
           Crystal Structure Analysis
 pdb|2UXQ|D Chain D, Isocitrate Dehydrogenase From The Psychrophilic Bacterium
           Desulfotalea Psychrophila: Biochemical Properties And
           Crystal Structure Analysis
 pdb|2UXR|A Chain A, Complex With Isocitrate And The Protein Isocitrate
           Dehydrogenase From The Psychrophilic Bacterium
           Desulfotalea Psychrophila
 pdb|2UXR|B Chain B, Complex With Isocitrate And The Protein Isocitrate
           Dehydrogenase From The Psychrophilic Bacterium
           Desulfotalea Psychrophila
 pdb|4AOV|A Chain A, Dpidh-Nadp. The Complex Structures Of Isocitrate
           Dehydrogenase From Clostridium Thermocellum And
           Desulfotalea Psychrophila, Support A New Active Site
           Locking Mechanism
          Length = 402

 Score = 31.6 bits (70), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 36/79 (45%), Gaps = 7/79 (8%)

Query: 97  ASPSEIIKRAHQRFNIVLPEQAINFVYLYRRKFVEASLYPYFTLLGQSIGSMILGVEALL 156
           A+   I K+  QRF I+  E    F   Y+ KF  A +  ++TL+   +  M+     +L
Sbjct: 207 ATKDTISKQYDQRFKIIFEEI---FAQEYKEKFAAAGIEYFYTLIDDVVARMMKTEGGML 263

Query: 157 ----SFQPDIYIDTMGYAF 171
               ++  D+  D +  AF
Sbjct: 264 WACKNYDGDVMSDMVASAF 282


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.328    0.142    0.453 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,684,568
Number of Sequences: 62578
Number of extensions: 215364
Number of successful extensions: 487
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 487
Number of HSP's gapped (non-prelim): 1
length of query: 207
length of database: 14,973,337
effective HSP length: 94
effective length of query: 113
effective length of database: 9,091,005
effective search space: 1027283565
effective search space used: 1027283565
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 49 (23.5 bits)