Diaphorina citri psyllid: psy15563

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610----

MNIMNGTNGHHENGNGELNGVGFSSKGVWTIGLINAQFKYLTAETFGFKINANGASLKKKQFKYLTAETFGFKINANGASLKKKQDGVWILEPANGGDTLSVYLRSHLGKYLAVDSFGNVTCEADEKEPGSLFQIHVSDEGKWAFKNKTRGYFLGASSDKLICTAKIPANPEYWLAHLAARPQLRSCGSPPCASIGLPSSRGLPCRYISSSPSTKAVHKPPPLLKRSVFPLIMNIMNGTNGHHENGNGELNGVGFSSKGVWTIGLINAQFKYLTAETFGFKINANGASLKKKQVWILEPANGGDTLSVYLRSHLGKYLAVDSFGNVTCEADEKEPGSLFQIHVSDEGKWAFKNKTRGYFLGASSDKLICTAKIPANPEYWLAHLAARPQVNLRSVGRKRFAHLSENLDEIHVDANIPWGEDTLFTLEFRAEDSGKYAVHTCNNKYLSREGKLVDTCNANCLFSLEYHAGEFCFLYLFIWLRPIRSPATGQIALRDNSGAYLSPIGSKAILKTRSNTVTKDELFTLEDSLPQASFIAALNSKYVSVKQGQIALRDNSGAYLSPIGSKAILKTRSNTVTKDELFTLEDSLPQASFIAALNSKYVSVKQAALAFAKW

ccccccccccccccccccccccccCEEEEEEEEEEcccccEEcccccCEEcccccccccccccEEccccccCEEEEccccccccccEEEEEECccccccEEEEEEEccccEEEEcccccEEEECcccccccEEEEEEcccccEEEEEcccccECcccccEEEEECccccccccEEEEEEcccccccccccccEECcccccccccCEEccccccEEEECcccccccccEEEEEEEEccccccccccccccEEcccccccccEEEEEEEccccEEEEECcccEEEEccccccccEEEEEECccccccEEEEEEEccccEEEEcccccEEECccccccccEEEEEEccccEEEEEEcccccEEEccccEEEEEEcccccccEEEEEEccccEEEEEEcccEEEEEEcccccEEEEccccccccccEEEEEEEEcccccEEEEcccccEECcccCEEcccccccEEEEEEEcccccEEEEEEcccccccccccEEEEEcccccEEECccccCEEECccccccccccEEEECccccEEEEEEcccEEEEEEccEEEEEcccccEEEEcccccEEECccccccccccEEEECccccEEEEEEcccEEEEEccccEEEEEc

******************NGVGFSSKGVWTIGLINAQFKYLTAETFGFKINANGASLKKKQFKYLTAETFGFKINANGASLKKKQDGVWILEPANGGDTLSVYLRSHLGKYLAVDSFGNVTCEADEKEPGSLFQIHVSDEGKWAFKNKTRGYFLGASSDKLICTAKIPANPEYWLAHLAARPQLRSCGSPPCASIGLPSSRGLPCRYISSSPSTKAVHKPPPLLKRSVFPLIMNIMNGTNGHHENGNGELNGVGFSSKGVWTIGLINAQFKYLTAETFGFKINANGASLKKKQVWILEPANGGDTLSVYLRSHLGKYLAVDSFGNVTCEADEKEPGSLFQIHVSDEGKWAFKNKTRGYFLGASSDKLICTAKIPANPEYWLAHLAARPQVNLRSVGRKRFAHLSENLDEIHVDANIPWGEDTLFTLEFRAEDSGKYAVHTCNNKYLSREGKLVDTCNANCLFSLEYHAGEFCFLYLFIWLRPIRSPATGQIALRDNSGAYLSPIGSKAILKTRSNTVTKDELFTLEDSLPQASFIAALNSKYVSVKQGQIALRDNSGAYLSPIGSKAILKTRSNTVTKDELFTLEDSLPQASFIAALNSKYVSVKQAALAF**W

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein singed	Probably acts as an actin bundling protein. May have a role in the asymmetric organization and/or movement of cytoplasmic components. It has a role in somatic cells during the formation of adult bristles and hairs, and in the female germline during oogenesis.	confident	Q24524

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0043025 [CC]	neuronal cell body	probable	GO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0043005 [CC]	neuron projection	probable	GO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0031941 [CC]	filamentous actin	probable	GO:0043234, GO:0005856, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005884, GO:0005575, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0016358 [BP]	dendrite development	probable	GO:0048666, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007275, GO:0071840, GO:0048869, GO:0016043, GO:0008150, GO:0044699, GO:0032502, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0007163 [BP]	establishment or maintenance of cell polarity	probable	GO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0046847 [BP]	filopodium assembly	probable	GO:0022607, GO:0030030, GO:0030031, GO:0009987, GO:0016043, GO:0044085, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0035317 [BP]	imaginal disc-derived wing hair organization	probable	GO:0048563, GO:0030030, GO:0060429, GO:0030154, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0035316, GO:0007275, GO:0044699, GO:0035315, GO:0008544, GO:0007472, GO:0048869, GO:0007552, GO:0007476, GO:0016043, GO:0048569, GO:0048513, GO:0071840, GO:0030855, GO:0032502, GO:0048707, GO:0009886, GO:0030182, GO:0009987, GO:0009888, GO:0035114, GO:0044763, GO:0048731, GO:0022008, GO:0044767, GO:0048699, GO:0007399, GO:0044707, GO:0007444, GO:0009913, GO:0048856, GO:0007560, GO:0008150, GO:0048736, GO:0048737
GO:0003779 [MF]	actin binding	probable	GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0048800 [BP]	antennal morphogenesis	probable	GO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0009791, GO:0002165, GO:0035214, GO:0009653, GO:0007275, GO:0044699, GO:0007455, GO:0007552, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0032501, GO:0035114, GO:0008150, GO:0007469, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0042060 [BP]	wound healing	probable	GO:0050896, GO:0006950, GO:0008150, GO:0009611
GO:0035017 [BP]	cuticle pattern formation	probable	GO:0032502, GO:0007389, GO:0042335, GO:0044707, GO:0048856, GO:0044767, GO:0032501, GO:0008150, GO:0003002, GO:0007275, GO:0044699
GO:0035099 [BP]	hemocyte migration	probable	GO:0048568, GO:0006928, GO:0009790, GO:0051674, GO:0007275, GO:0044699, GO:0048513, GO:0048534, GO:0016477, GO:0032502, GO:0032501, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0035162, GO:0051179, GO:0002520, GO:0040011, GO:0044707, GO:0048870, GO:0048856, GO:0030097, GO:0002376, GO:0008150
GO:0048812 [BP]	neuron projection morphogenesis	probable	GO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0071840, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0008150
GO:0030034 [BP]	microvillar actin bundle assembly	probable	GO:0006996, GO:0007015, GO:0044699, GO:0022607, GO:0007010, GO:0030029, GO:0071822, GO:0030030, GO:0051017, GO:0030033, GO:0032528, GO:0016043, GO:0043933, GO:0044085, GO:0044763, GO:0030036, GO:0030031, GO:0008150, GO:0009987, GO:0071840

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LLP, chain A
Confidence level:very confident
Coverage over the Query: 24-61,88-189,203-382,427-469,482-527,546-613
View the alignment between query and template
View the model in PyMOL

Template: 3LLP, chain A
Confidence level:very confident
Coverage over the Query: 256-467,490-613
View the alignment between query and template
View the model in PyMOL