Diaphorina citri psyllid: psy15572


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140----
MSQTISTEATVPGGIYSDLRRGNILKEDVYYRDNDLKYRWVSKTGWTYSTEFEEEDVYYRDNDLKYRWVSKTGWTYSTEFEVTDKNFLALPNQFLVFHGVDTIATIYLNDKELGKTDNMFVRYRFDVKDKLQENESKQNLELGE
ccccEEEEECccccHHHHHHHccccccccccccccccHHccccccccCCcccccccccccccccccEEEccccCEEEEEEEcccccccccccEEEEEcccccEEEEEEccEEEEECccccEEEEEcccccccccccEEEEEEcc
***TISTEATVPGGIYSDLRRGNILKEDVYYRDNDLKYRWVSKTGWTYSTEFEEEDVYYRDNDLKYRWVSKTGWTYSTEFEVTDKNFLALPNQFLVFHGVDTIATIYLNDKELGKTDNMFVRYRFDVKDKLQENESKQNLELGE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQTISTEATVPGGIYSDLRRGNILKEDVYYRDNDLKYRWVSKTGWTYSTEFEEEDVYYRDNDLKYRWVSKTGWTYSTEFEVTDKNFLALPNQFLVFHGVDTIATIYLNDKELGKTDNMFVRYRFDVKDKLQENESKQNLELGE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044248 [BP]cellular catabolic processprobableGO:0008150, GO:0009987, GO:0009056, GO:0008152, GO:0044237
GO:0003674 [MF]molecular_functionprobable
GO:0044260 [BP]cellular macromolecule metabolic processprobableGO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0009057 [BP]macromolecule catabolic processprobableGO:1901575, GO:0043170, GO:0071704, GO:0008150, GO:0008152, GO:0009056
GO:0044238 [BP]primary metabolic processprobableGO:0008150, GO:0008152

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JE8, chain A
Confidence level:very confident
Coverage over the Query: 3-52,81-142
View the alignment between query and template
View the model in PyMOL
Template: 2WBK, chain A
Confidence level:probable
Coverage over the Query: 9-26,56-136
View the alignment between query and template
View the model in PyMOL