BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy15587
(140 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2DKV|A Chain A, Crystal Structure Of Class I Chitinase From Oryza Sativa
L. Japonica
pdb|3IWR|A Chain A, Crystal Structure Of Class I Chitinase From Oryza Sativa
L. Japonica
pdb|3IWR|B Chain B, Crystal Structure Of Class I Chitinase From Oryza Sativa
L. Japonica
Length = 309
Score = 26.9 bits (58), Expect = 3.4, Method: Compositional matrix adjust.
Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 7/65 (10%)
Query: 40 SDTSTAFYIILIVWLADQYDAICCHTVITKRHWLRKPLGSSLVIAILFG------DGRKR 93
+D + +F L W+ Q + H VIT R W P ++ A +G +G
Sbjct: 201 TDATVSFKTALWFWMTPQGNKPSSHDVITGR-WAPSPADAAAGRAPGYGVITNIVNGGLE 259
Query: 94 NGYGP 98
G+GP
Sbjct: 260 CGHGP 264
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.326 0.141 0.424
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,138,542
Number of Sequences: 62578
Number of extensions: 166557
Number of successful extensions: 302
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 302
Number of HSP's gapped (non-prelim): 1
length of query: 140
length of database: 14,973,337
effective HSP length: 89
effective length of query: 51
effective length of database: 9,403,895
effective search space: 479598645
effective search space used: 479598645
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 46 (22.3 bits)