BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy15587
         (140 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2DKV|A Chain A, Crystal Structure Of Class I Chitinase From Oryza Sativa
           L. Japonica
 pdb|3IWR|A Chain A, Crystal Structure Of Class I Chitinase From Oryza Sativa
           L. Japonica
 pdb|3IWR|B Chain B, Crystal Structure Of Class I Chitinase From Oryza Sativa
           L. Japonica
          Length = 309

 Score = 26.9 bits (58), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 7/65 (10%)

Query: 40  SDTSTAFYIILIVWLADQYDAICCHTVITKRHWLRKPLGSSLVIAILFG------DGRKR 93
           +D + +F   L  W+  Q +    H VIT R W   P  ++   A  +G      +G   
Sbjct: 201 TDATVSFKTALWFWMTPQGNKPSSHDVITGR-WAPSPADAAAGRAPGYGVITNIVNGGLE 259

Query: 94  NGYGP 98
            G+GP
Sbjct: 260 CGHGP 264


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.326    0.141    0.424 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,138,542
Number of Sequences: 62578
Number of extensions: 166557
Number of successful extensions: 302
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 302
Number of HSP's gapped (non-prelim): 1
length of query: 140
length of database: 14,973,337
effective HSP length: 89
effective length of query: 51
effective length of database: 9,403,895
effective search space: 479598645
effective search space used: 479598645
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 46 (22.3 bits)