Query         psy15587
Match_columns 140
No_of_seqs    30 out of 32
Neff          2.1 
Searched_HMMs 46136
Date          Fri Aug 16 16:24:13 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15587.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15587hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF09746 Membralin:  Tumour-ass 100.0 6.1E-37 1.3E-41  263.0   2.2   70    1-70    306-375 (375)
  2 KOG2092|consensus               98.6 3.3E-08 7.2E-13   86.6   2.9   92    4-101   113-220 (381)
  3 PF09569 RE_ScaI:  ScaI restric  70.1      13 0.00028   31.0   5.5   86   15-120    56-146 (191)
  4 KOG4452|consensus               61.4     7.4 0.00016   28.5   2.3   30    3-32      2-31  (79)
  5 PF00842 Ala_racemase_C:  Alani  54.4     5.2 0.00011   29.7   0.5   19   94-112    39-57  (129)
  6 PF11108 Phage_glycop_gL:  Vira  41.6      15 0.00033   27.9   1.3   29   62-94      2-31  (111)
  7 PRK02624 psbH photosystem II r  31.3      66  0.0014   22.9   3.1   41    2-44      8-54  (64)
  8 cd06826 PLPDE_III_AR2 Type III  30.2      29 0.00064   29.0   1.4   18   94-111   275-292 (365)
  9 TIGR00492 alr alanine racemase  30.1      30 0.00065   28.6   1.4   17   94-110   281-297 (367)
 10 PF00737 PsbH:  Photosystem II   29.0      89  0.0019   21.4   3.3   40    2-43      5-50  (52)
 11 CHL00066 psbH photosystem II p  28.3      77  0.0017   23.0   3.1   41    2-44     20-66  (73)
 12 KOG4788|consensus               25.9      22 0.00048   27.5  -0.0   28   34-61    103-130 (172)
 13 PF00526 Dicty_CTDC:  Dictyoste  25.9      29 0.00063   20.0   0.4    8   61-68     13-20  (24)
 14 PLN00055 photosystem II reacti  24.9      96  0.0021   22.5   3.0   41    2-44     20-66  (73)
 15 PRK03646 dadX alanine racemase  23.9      45 0.00097   28.2   1.4   19   94-112   269-287 (355)
 16 PRK13340 alanine racemase; Rev  22.4      50  0.0011   28.1   1.4   18   94-111   315-332 (406)
 17 TIGR03510 XapX XapX domain. Th  21.4      80  0.0017   21.0   1.9   19   13-31     20-38  (49)
 18 smart00712 PUR DNA/RNA-binding  21.4      41 0.00089   22.8   0.6   20  100-119    16-35  (63)

No 1  
>PF09746 Membralin:  Tumour-associated protein;  InterPro: IPR019144  Membralin is evolutionarily highly conserved, though it appears to represent a unique protein family. The protein appears to contain several transmembrane regions. In humans it is expressed in certain cancers, particularly ovarian cancers []. Membralin-like gene homologues have been identified in plants including grape, cotton and tomato [].
Probab=100.00  E-value=6.1e-37  Score=262.96  Aligned_cols=70  Identities=84%  Similarity=1.337  Sum_probs=69.1

Q ss_pred             ChhhhhhhhhceeeecCchhHHHHHHHHHHHHHHHhhhcCCcchhhhhhhhhhhccccceeeeecccccc
Q psy15587          1 MVDLLQMLEFNVTVTFPAAPLLTVILALVGMEAIMSEFFSDTSTAFYIILIVWLADQYDAICCHTVITKR   70 (140)
Q Consensus         1 ivDLLqMLefN~~l~fPaapLlTVILaLVGmeaIMsEFFnDtttAFYVILiVWlADqYdaicchT~iSkr   70 (140)
                      |+||+||+|+|.++.+|+|||+||||||||||+||||||||++|||||||+||+|||||+||||||+|||
T Consensus       306 iv~ll~~~~~~~~~~~p~a~llt~il~lvgm~~~m~eff~d~~~af~vil~vw~~d~~~~i~c~t~~~~r  375 (375)
T PF09746_consen  306 IVDLLQMLEHNLPIFFPAAPLLTVILALVGMEAIMSEFFNDTTTAFYVILIVWLADQYDAICCHTPISKR  375 (375)
T ss_pred             HHHHHHHHHhcCccccccceeeeeehhhHHHHHHHHHHhcchhHHHHHHHHHHHHhhccEEEecCccCCC
Confidence            6899999999999999999999999999999999999999999999999999999999999999999997


No 2  
>KOG2092|consensus
Probab=98.56  E-value=3.3e-08  Score=86.55  Aligned_cols=92  Identities=29%  Similarity=0.495  Sum_probs=80.7

Q ss_pred             hhhhhhhceee------ecCchhHHHHHH--------HHHHHHHHHhhhcCCcchhhhhhhhhhhccccceeeeeccccc
Q psy15587          4 LLQMLEFNVTV------TFPAAPLLTVIL--------ALVGMEAIMSEFFSDTSTAFYIILIVWLADQYDAICCHTVITK   69 (140)
Q Consensus         4 LLqMLefN~~l------~fPaapLlTVIL--------aLVGmeaIMsEFFnDtttAFYVILiVWlADqYdaicchT~iSk   69 (140)
                      -.||..|.++|      +.|+..++.|--        .+||+....+||++|+..+||+.+.||+|+.+.++..+||++|
T Consensus       113 w~R~gi~rVev~~H~s~r~p~Fl~f~~~~~~~~vF~~~aI~i~s~l~~~~~e~~e~~m~~~~~~~~~~f~ld~e~~~i~k  192 (381)
T KOG2092|consen  113 WTRMGIFRVEVQHHASHRLPTFLLFFVHVIESLVFVPIAIGILSFLFEFYDEQLEAFMVLVLVWLCELFTLDSERTPISK  192 (381)
T ss_pred             hhhheeEEEEEEecchhcchHHHHHHhhhcccccccchhhhHHHhhHHHhcccHHHHHHHHHHHHHHheeeecccccccC
Confidence            45788888877      489999888622        3788999999999999999999999999999999999999999


Q ss_pred             cccccccc--hhhhhhheeecCCccccCCCCCcC
Q psy15587         70 RHWLRKPL--GSSLVIAILFGDGRKRNGYGPGFD  101 (140)
Q Consensus        70 rhWlRF~l--~~~l~~~ilf~~~~~~~~~~~~~~  101 (140)
                      |+.+|++|  ++.+++||+|=.      |-||+.
T Consensus       193 ~~~p~e~Lnd~~e~~fh~~~f~------~~~g~~  220 (381)
T KOG2092|consen  193 KFFPREFLNDLYELVFHIYFFS------YAYGFS  220 (381)
T ss_pred             CCCcHHHhcchhhcccchhhhh------hccCch
Confidence            99999999  999999999853      566654


No 3  
>PF09569 RE_ScaI:  ScaI restriction endonuclease;  InterPro: IPR019069 There are four classes of restriction endonucleases: types I, II,III and IV. All types of enzymes recognise specific short DNA sequences and carry out the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. They differ in their recognition sequence, subunit composition, cleavage position, and cofactor requirements [, ], as summarised below:   Type I enzymes (3.1.21.3 from EC) cleave at sites remote from recognition site; require both ATP and S-adenosyl-L-methionine to function; multifunctional protein with both restriction and methylase (2.1.1.72 from EC) activities. Type II enzymes (3.1.21.4 from EC) cleave within or at short specific distances from recognition site; most require magnesium; single function (restriction) enzymes independent of methylase. Type III enzymes (3.1.21.5 from EC) cleave at sites a short distance from recognition site; require ATP (but doesn't hydrolyse it); S-adenosyl-L-methionine stimulates reaction but is not required; exists as part of a complex with a modification methylase methylase (2.1.1.72 from EC). Type IV enzymes target methylated DNA.   Type II restriction endonucleases (3.1.21.4 from EC) are components of prokaryotic DNA restriction-modification mechanisms that protect the organism against invading foreign DNA. These site-specific deoxyribonucleases catalyse the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. Of the 3000 restriction endonucleases that have been characterised, most are homodimeric or tetrameric enzymes that cleave target DNA at sequence-specific sites close to the recognition site. For homodimeric enzymes, the recognition site is usually a palindromic sequence 4-8 bp in length. Most enzymes require magnesium ions as a cofactor for catalysis. Although they can vary in their mode of recognition, many restriction endonucleases share a similar structural core comprising four beta-strands and one alpha-helix, as well as a similar mechanism of cleavage, suggesting a common ancestral origin []. However, there is still considerable diversity amongst restriction endonucleases [, ]. The target site recognition process triggers large conformational changes of the enzyme and the target DNA, leading to the activation of the catalytic centres. Like other DNA binding proteins, restriction enzymes are capable of non-specific DNA binding as well, which is the prerequisite for efficient target site location by facilitated diffusion. Non-specific binding usually does not involve interactions with the bases but only with the DNA backbone [].   This entry represents the restriction endonuclease ScaI, which recognises and cleaves the double-stranded sequence AGT^ACT. 
Probab=70.09  E-value=13  Score=31.02  Aligned_cols=86  Identities=24%  Similarity=0.407  Sum_probs=58.7

Q ss_pred             ecCchhHHHHHH-HHHHHH--HHHhhhcCCcchhhhhhhhhhhccccceeeeeccccccccccccchhhhhhheeecCCc
Q psy15587         15 TFPAAPLLTVIL-ALVGME--AIMSEFFSDTSTAFYIILIVWLADQYDAICCHTVITKRHWLRKPLGSSLVIAILFGDGR   91 (140)
Q Consensus        15 ~fPaapLlTVIL-aLVGme--aIMsEFFnDtttAFYVILiVWlADqYdaicchT~iSkrhWlRF~l~~~l~~~ilf~~~~   91 (140)
                      -||-++.+-++| .||+.+  +-.+..-.|.+-.  ===+|.+-|.+=+|=.-|+-+++|.              ||.  
T Consensus        56 IFP~PQimGf~Lh~LI~~~i~~~~p~Wr~~~t~~--~KDiv~i~~~~ysiEiKTSS~~~~i--------------~gN--  117 (191)
T PF09569_consen   56 IFPKPQIMGFFLHELIAQYIAVKYPNWRGDKTKY--EKDIVNIPNPFYSIEIKTSSSPKQI--------------YGN--  117 (191)
T ss_pred             cCCCHHHHHHHHHHHHHHHHhhhCCccccCCccc--ccceeeccCCceeEEEeccCCccce--------------ecc--
Confidence            589999999977 677764  4445544444433  3446777777778888888888762              342  


Q ss_pred             cccCCC-CCcCCCCCCcceeeeeh-hhhhhh
Q psy15587         92 KRNGYG-PGFDRGNSNKGYYLAMA-EKEMDT  120 (140)
Q Consensus        92 ~~~~~~-~~~~~~~~~~~~~~~~~-~~~~~~  120 (140)
                        +.|| ++=++-.|..|||||.- ||=+++
T Consensus       118 --RSy~q~~~~~kKsK~GYYlaINfekf~~~  146 (191)
T PF09569_consen  118 --RSYGQNSDNSKKSKDGYYLAINFEKFSET  146 (191)
T ss_pred             --cccccCCCCCccccCceEEEEEeeccCcc
Confidence              4676 56666678889999975 665655


No 4  
>KOG4452|consensus
Probab=61.41  E-value=7.4  Score=28.49  Aligned_cols=30  Identities=27%  Similarity=0.377  Sum_probs=26.7

Q ss_pred             hhhhhhhhceeeecCchhHHHHHHHHHHHH
Q psy15587          3 DLLQMLEFNVTVTFPAAPLLTVILALVGME   32 (140)
Q Consensus         3 DLLqMLefN~~l~fPaapLlTVILaLVGme   32 (140)
                      |+-.|-+...++.+.+.|.+|++|.-+|+-
T Consensus         2 ~~~~M~RYtsPVNpAvfPhLttvLl~iG~f   31 (79)
T KOG4452|consen    2 DISKMNRYTSPVNPAVFPHLTTVLLGIGLF   31 (79)
T ss_pred             chHHHhhhcCCCChhHhHHHHHHHHHHHHH
Confidence            667788899999999999999999999983


No 5  
>PF00842 Ala_racemase_C:  Alanine racemase, C-terminal domain;  InterPro: IPR011079 Alanine racemase (5.1.1.1 from EC) plays a role in providing the D-alanine required for cell wall biosynthesis by isomerising L-alanine to D-alanine. Proteins contains this domain are found in both prokaryotic and eukaryotic proteins [,]. The molecular structure of alanine racemase from Bacillus stearothermophilus (Geobacillus stearothermophilus) was determined by X-ray crystallography to a resolution of 1.9 A []. The alanine racemase monomer is composed of two domains, an eight-stranded alpha/beta barrel at the N terminus, and a C-terminal domain essentially composed of beta-strand. The pyridoxal 5'-phosphate (PLP) cofactor lies in and above the mouth of the alpha/beta barrel and is covalently linked via an aldimine linkage to a lysine residue, which is at the C terminus of the first beta-strand of the alpha/beta barrel.; GO: 0008784 alanine racemase activity, 0006522 alanine metabolic process; PDB: 3HUR_A 4A3Q_B 3S46_A 1RCQ_A 3CO8_A 1VFT_B 1VFH_A 1VFS_B 2DY3_B 4ECL_C ....
Probab=54.41  E-value=5.2  Score=29.70  Aligned_cols=19  Identities=53%  Similarity=0.840  Sum_probs=14.6

Q ss_pred             cCCCCCcCCCCCCcceeee
Q psy15587         94 NGYGPGFDRGNSNKGYYLA  112 (140)
Q Consensus        94 ~~~~~~~~~~~~~~~~~~~  112 (140)
                      =|||-||.|..||+|+-+.
T Consensus        39 iGYaDG~~r~~~~~~~v~i   57 (129)
T PF00842_consen   39 IGYADGFPRALSNGGYVLI   57 (129)
T ss_dssp             --GGGTGGGGGTTTEEEEE
T ss_pred             EEeeCCcCcccCCCcEEEE
Confidence            4999999999999886543


No 6  
>PF11108 Phage_glycop_gL:  Viral glycoprotein L;  InterPro: IPR020175 Herpesviruses are enveloped by a lipid bilayer that contains at least a dozen glycoproteins. The virion surface glycoproteins mediate recognition of susceptible cells and promote fusion of the viral envelope with the cell membrane, leading to virus entry. No single glycoprotein associated with the virion membrane has been identified as the fusogen []. Glycoprotein L (gL) forms a non-covalently linked heterodimer with glycoprotein H (gH). This heterodimer is essential for virus-cell and cell-cell fusion since the association of gH and gL is necessary for correct localisation of gH to the virion or cell surface. gH anchoring the heterodimer to the plasma membrane through its transmembrane domain. gL lacks a transmembrane domain and is secreted from cells when expressed in the absence of gH [].; PDB: 3PHF_N.
Probab=41.60  E-value=15  Score=27.88  Aligned_cols=29  Identities=24%  Similarity=0.432  Sum_probs=11.9

Q ss_pred             eee-ccccccccccccchhhhhhheeecCCcccc
Q psy15587         62 CCH-TVITKRHWLRKPLGSSLVIAILFGDGRKRN   94 (140)
Q Consensus        62 cch-T~iSkrhWlRF~l~~~l~~~ilf~~~~~~~   94 (140)
                      ||| ++..+++||   ..++++ .|||-+-..=+
T Consensus         2 CC~I~~~~~~~~p---~~~~I~-~Iyl~~p~tC~   31 (111)
T PF11108_consen    2 CCHIQALNETHLP---SLFSIS-SIYLTSPSTCN   31 (111)
T ss_dssp             -----S-TSSS------TTT---EEEE--TTSSS
T ss_pred             CcccccccccCCc---chhhhh-heeecCcccCC
Confidence            999 999999998   334455 78887755433


No 7  
>PRK02624 psbH photosystem II reaction center protein H; Provisional
Probab=31.26  E-value=66  Score=22.89  Aligned_cols=41  Identities=24%  Similarity=0.428  Sum_probs=30.6

Q ss_pred             hhhhhhhhhceee--ecC---chhHHHHHHHHHHH-HHHHhhhcCCcch
Q psy15587          2 VDLLQMLEFNVTV--TFP---AAPLLTVILALVGM-EAIMSEFFSDTST   44 (140)
Q Consensus         2 vDLLqMLefN~~l--~fP---aapLlTVILaLVGm-eaIMsEFFnDttt   44 (140)
                      .|+|+.|  |...  .-|   +.|++-|..+|+.. ..|+.|.||.+.+
T Consensus         8 G~lLkpL--NSEyGKVaPGWGTTplMgv~m~Lf~vFl~iiLeIYNsSvl   54 (64)
T PRK02624          8 GDLLKPL--NSEYGKVVPGWGTTPVMAVFMVLFLVFLLIILQIYNQSLL   54 (64)
T ss_pred             hhhcccc--ccccCcccCCccchHHHHHHHHHHHHHHHHHHHHhCccee
Confidence            4667776  4333  234   68999999998877 7999999998754


No 8  
>cd06826 PLPDE_III_AR2 Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme, Alanine Racemase 2. This subfamily is composed of bacterial alanine racemases (EC 5.1.1.1) with similarity to Yersinia pestis and Vibrio cholerae alanine racemase (AR) 2. ARs catalyze the interconversion between L- and D-alanine, an essential component of the peptidoglycan layer of bacterial cell walls. These proteins are similar to other bacterial ARs and are fold type III PLP-dependent enzymes containing contains an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain. They exist as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Homodimer formation and the presence of the PLP cofactor are required for catalytic activity.
Probab=30.16  E-value=29  Score=28.97  Aligned_cols=18  Identities=44%  Similarity=0.661  Sum_probs=15.2

Q ss_pred             cCCCCCcCCCCCCcceee
Q psy15587         94 NGYGPGFDRGNSNKGYYL  111 (140)
Q Consensus        94 ~~~~~~~~~~~~~~~~~~  111 (140)
                      =||+-|+.|..||+|+-+
T Consensus       275 iGYaDG~~r~ls~~~~v~  292 (365)
T cd06826         275 VGYSDGYRRSFSNKAHVL  292 (365)
T ss_pred             eecccCcCccCCCCcEEE
Confidence            489999999999997643


No 9  
>TIGR00492 alr alanine racemase. This enzyme interconverts L-alanine and D-alanine. Its primary function is to generate D-alanine for cell wall formation. With D-alanine-D-alanine ligase, it makes up the D-alanine branch of the peptidoglycan biosynthetic route. It is a monomer with one pyridoxal phosphate per subunit. In E. coli, the ortholog is duplicated so that a second isozyme, DadX, is present. DadX, a paralog of the biosynthetic Alr, is induced by D- or L-alanine and is involved in catabolism.
Probab=30.06  E-value=30  Score=28.56  Aligned_cols=17  Identities=35%  Similarity=0.475  Sum_probs=15.0

Q ss_pred             cCCCCCcCCCCCCccee
Q psy15587         94 NGYGPGFDRGNSNKGYY  110 (140)
Q Consensus        94 ~~~~~~~~~~~~~~~~~  110 (140)
                      =||+-||.|..||||+-
T Consensus       281 ~GYaDG~~r~~s~~~~v  297 (367)
T TIGR00492       281 IGYADGYPRALSNGTPV  297 (367)
T ss_pred             eecccCcCcccCCCcEE
Confidence            48999999999999975


No 10 
>PF00737 PsbH:  Photosystem II 10 kDa phosphoprotein;  InterPro: IPR001056 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents the low molecular weight phosphoprotein PsbH found in PSII. The phosphorylation site of PsbH is located in the N terminus, where reversible phosphorylation is light-dependent and redox-controlled. PsbH is necessary for the photoprotection of PSII, being required for: (1) the rapid degradation of photodamaged D1 core protein to prevent further oxidative damage to the PSII core, and (2) the insertion of newly synthesised D1 protein into the thylakoid membrane []. PsbH may also regulate the transfer of electrons from D2 (Qa) to D1 (Qb) in the reaction core.; GO: 0042301 phosphate ion binding, 0015979 photosynthesis, 0050821 protein stabilization, 0009523 photosystem II, 0016020 membrane; PDB: 3PRR_H 2AXT_h 3BZ2_H 3BZ1_H 4FBY_W 3PRQ_H 3KZI_H 1S5L_h 3A0H_H 3ARC_H ....
Probab=28.99  E-value=89  Score=21.38  Aligned_cols=40  Identities=30%  Similarity=0.478  Sum_probs=28.2

Q ss_pred             hhhhhhhhhceee-----ecCchhHHHHHHHHHHH-HHHHhhhcCCcc
Q psy15587          2 VDLLQMLEFNVTV-----TFPAAPLLTVILALVGM-EAIMSEFFSDTS   43 (140)
Q Consensus         2 vDLLqMLefN~~l-----~fPaapLlTVILaLVGm-eaIMsEFFnDtt   43 (140)
                      .|+|+.|  |..-     .--+.|++.+..+|+.. ..|+.|.||.+.
T Consensus         5 g~lLKpL--NSeyGkVaPGWGTtplM~~~m~lf~vfl~iiL~IyNssv   50 (52)
T PF00737_consen    5 GDLLKPL--NSEYGKVAPGWGTTPLMGVFMALFAVFLLIILEIYNSSV   50 (52)
T ss_dssp             HHHCCCC--CCSTT--BSTTTTHHHHHHHHHHHHHHHHHHHHHHTTSS
T ss_pred             hhccccc--cccCCCcCCCccchHHHHHHHHHHHHHHHHHHHHhcccc
Confidence            3555555  4332     23367999998888776 789999999874


No 11 
>CHL00066 psbH photosystem II protein H
Probab=28.33  E-value=77  Score=22.98  Aligned_cols=41  Identities=29%  Similarity=0.476  Sum_probs=30.2

Q ss_pred             hhhhhhhhhceee--ecC---chhHHHHHHHHHHH-HHHHhhhcCCcch
Q psy15587          2 VDLLQMLEFNVTV--TFP---AAPLLTVILALVGM-EAIMSEFFSDTST   44 (140)
Q Consensus         2 vDLLqMLefN~~l--~fP---aapLlTVILaLVGm-eaIMsEFFnDttt   44 (140)
                      .|+|+.|  |...  .-|   +.|++-|+.+|+.. ..|+.|.||.+.+
T Consensus        20 G~lLKPL--NSeyGkvapgWGTtp~Mgv~m~lf~vfl~iiLeiyNssvl   66 (73)
T CHL00066         20 GNLLKPL--NSEYGKVAPGWGTTPLMGVAMALFAVFLSIILEIYNSSVL   66 (73)
T ss_pred             ccccccc--ccccCcccCCccchHHHHHHHHHHHHHHHHHHHHhCccee
Confidence            4666666  4433  333   68999999998877 7999999998754


No 12 
>KOG4788|consensus
Probab=25.90  E-value=22  Score=27.48  Aligned_cols=28  Identities=11%  Similarity=0.376  Sum_probs=25.6

Q ss_pred             HHhhhcCCcchhhhhhhhhhhcccccee
Q psy15587         34 IMSEFFSDTSTAFYIILIVWLADQYDAI   61 (140)
Q Consensus        34 IMsEFFnDtttAFYVILiVWlADqYdai   61 (140)
                      ++++++|+-..+++.+..+|++++++..
T Consensus       103 ~~~~l~~~~v~~~~~~i~~~~~~~~~~~  130 (172)
T KOG4788|consen  103 FLLDLLNLVVALLLFAIASWVLAQFSAT  130 (172)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhhc
Confidence            4899999999999999999999999765


No 13 
>PF00526 Dicty_CTDC:  Dictyostelium (slime mold) repeat;  InterPro: IPR001673 Several Dictyostelium species have proteins that contain conserved repeats. These proteins have been variously described as 'extracellular matrix protein B', 'cyclic nucleotide phosphodiesterase inhibitor precursor', 'prestalk protein precursor', 'putative calmodulin-binding protein CamBP64', and 'cysteine-rich, acidic integral membrane protein precursor' as well as 'hypothetical protein'.
Probab=25.86  E-value=29  Score=19.98  Aligned_cols=8  Identities=50%  Similarity=0.800  Sum_probs=6.9

Q ss_pred             eeeecccc
Q psy15587         61 ICCHTVIT   68 (140)
Q Consensus        61 icchT~iS   68 (140)
                      -|+||||+
T Consensus        13 GC~htpi~   20 (24)
T PF00526_consen   13 GCVHTPIS   20 (24)
T ss_pred             CEECcccc
Confidence            49999986


No 14 
>PLN00055 photosystem II reaction center protein H; Provisional
Probab=24.86  E-value=96  Score=22.48  Aligned_cols=41  Identities=32%  Similarity=0.496  Sum_probs=30.3

Q ss_pred             hhhhhhhhhceee--ecC---chhHHHHHHHHHHH-HHHHhhhcCCcch
Q psy15587          2 VDLLQMLEFNVTV--TFP---AAPLLTVILALVGM-EAIMSEFFSDTST   44 (140)
Q Consensus         2 vDLLqMLefN~~l--~fP---aapLlTVILaLVGm-eaIMsEFFnDttt   44 (140)
                      .|+|+.|  |...  .-|   +.|++-|+.+|+.. ..|+.|.||.+.+
T Consensus        20 G~lLKPL--NSeyGkvapgWGTtp~Mg~~m~lf~vfl~iileiyNssvl   66 (73)
T PLN00055         20 GDLLKPL--NSEYGKVAPGWGTTPLMGVAMALFAVFLSIILEIYNSSVL   66 (73)
T ss_pred             ccccccc--ccccCcccCCccchhHHHHHHHHHHHHHHHHHHHhcccee
Confidence            4667766  4433  333   68999999998877 7899999998753


No 15 
>PRK03646 dadX alanine racemase; Reviewed
Probab=23.94  E-value=45  Score=28.16  Aligned_cols=19  Identities=26%  Similarity=0.466  Sum_probs=16.0

Q ss_pred             cCCCCCcCCCCCCcceeee
Q psy15587         94 NGYGPGFDRGNSNKGYYLA  112 (140)
Q Consensus        94 ~~~~~~~~~~~~~~~~~~~  112 (140)
                      =||+-|+.|.-||+|+.+.
T Consensus       269 iGYaDG~~r~ls~~~~v~i  287 (355)
T PRK03646        269 AGYADGYPRHAPTGTPVLV  287 (355)
T ss_pred             eccccccCcccCCCCEEEE
Confidence            5899999999999987543


No 16 
>PRK13340 alanine racemase; Reviewed
Probab=22.42  E-value=50  Score=28.10  Aligned_cols=18  Identities=44%  Similarity=0.656  Sum_probs=15.1

Q ss_pred             cCCCCCcCCCCCCcceee
Q psy15587         94 NGYGPGFDRGNSNKGYYL  111 (140)
Q Consensus        94 ~~~~~~~~~~~~~~~~~~  111 (140)
                      =||+-|+.|.-||+|+-+
T Consensus       315 iGYaDG~~r~ls~~~~v~  332 (406)
T PRK13340        315 VGYSDGYPRHASNKAPVL  332 (406)
T ss_pred             eecccCcCccCCCCcEEE
Confidence            489999999999998643


No 17 
>TIGR03510 XapX XapX domain. This model describes an uncharacterized small, hydrophobic protein of about 50 amino acids, found between the xapB and xapR genes of the E. coli xanthosine utilization system, and homologous regions in other small proteins, such as the N-terminal region of DUF1427 (Pfam model pfam07235). We name this domain XapX, as it comprises the full length of the protein encoded between the genes for the well-studied XapB and XapR proteins.
Probab=21.39  E-value=80  Score=21.03  Aligned_cols=19  Identities=42%  Similarity=0.765  Sum_probs=16.0

Q ss_pred             eeecCchhHHHHHHHHHHH
Q psy15587         13 TVTFPAAPLLTVILALVGM   31 (140)
Q Consensus        13 ~l~fPaapLlTVILaLVGm   31 (140)
                      .+..|+.|.+.=++.++||
T Consensus        20 ~vp~PAPP~laGl~gi~gm   38 (49)
T TIGR03510        20 KVPSPAPPVLAGLVGLLGM   38 (49)
T ss_pred             CCCCCCCchHHHHHHHHHH
Confidence            4678999999978888888


No 18 
>smart00712 PUR DNA/RNA-binding repeats in PUR-alpha/beta/gamma and in hypothetical proteins from spirochetes and the Bacteroides-Cytophaga-Flexibacter bacteria.
Probab=21.35  E-value=41  Score=22.82  Aligned_cols=20  Identities=25%  Similarity=0.557  Sum_probs=16.4

Q ss_pred             cCCCCCCcceeeeehhhhhh
Q psy15587        100 FDRGNSNKGYYLAMAEKEMD  119 (140)
Q Consensus       100 ~~~~~~~~~~~~~~~~~~~~  119 (140)
                      ||-+..++|+||..+|.-..
T Consensus        16 fDvk~N~rG~fLrIsE~~~~   35 (63)
T smart00712       16 FDVKENRRGRFLRISEVKNN   35 (63)
T ss_pred             EEecccCCccEEEEEEecCC
Confidence            78888899999999986443


Done!