Query         psy15591
Match_columns 159
No_of_seqs    103 out of 272
Neff          5.8 
Searched_HMMs 46136
Date          Fri Aug 16 16:31:04 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15591.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15591hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd00117 LU Ly-6 antigen / uPA   97.9 2.2E-05 4.7E-10   53.8   5.1   65   46-136     1-79  (79)
  2 PF01064 Activin_recp:  Activin  97.4 0.00044 9.5E-09   47.5   5.3   76   46-138     1-80  (83)
  3 smart00134 LU Ly-6 antigen / u  97.4 0.00047   1E-08   47.2   5.4   65   46-134     1-79  (79)
  4 PF00021 UPAR_LY6:  u-PAR/Ly-6   96.9  0.0022 4.7E-08   41.6   4.6   64   48-134     1-77  (77)
  5 PF00087 Toxin_1:  Snake toxin;  96.7  0.0054 1.2E-07   40.9   5.4   41   81-134    22-63  (63)
  6 cd00206 snake_toxin Snake toxi  96.4  0.0081 1.8E-07   40.2   4.8   41   81-134    23-64  (64)
  7 PF06579 Ly-6_related:  Caenorh  95.5   0.016 3.4E-07   44.3   3.4   62   74-136    39-129 (129)
  8 PF05444 DUF753:  Protein of un  94.6   0.074 1.6E-06   41.0   5.0   73   49-137     1-77  (152)
  9 KOG3653|consensus               91.4     2.3   5E-05   39.3  10.2   58   81-139    68-131 (534)
 10 PF02988 PLA2_inh:  Phospholipa  77.6      10 0.00022   26.9   5.8   66   47-135     2-83  (83)
 11 KOG2052|consensus               77.3      10 0.00023   34.9   7.2   54   80-135    54-109 (513)
 12 PF01684 ET:  ET module;  Inter  75.4     6.3 0.00014   27.8   4.3   60   76-137    18-81  (82)
 13 PF01307 Plant_vir_prot:  Plant  42.0      50  0.0011   24.2   4.1   32  123-156    55-86  (104)
 14 PRK03625 tatE twin arginine tr  41.1      23 0.00049   24.1   2.0   16   18-33      5-20  (67)
 15 PF08917 ecTbetaR2:  Transformi  39.9      23 0.00051   26.7   2.1   56   81-137    37-101 (118)
 16 PRK00442 tatA twin arginine tr  37.4      30 0.00065   25.0   2.2   17   17-33      4-20  (92)
 17 COG1826 TatA Sec-independent p  36.3      28 0.00061   24.7   2.0   17   17-33      4-20  (94)
 18 PRK00404 tatB sec-independent   35.3      28  0.0006   27.1   1.9   17   18-34      5-21  (141)
 19 PRK00708 sec-independent trans  34.8      27 0.00058   28.8   1.8   16   18-33      5-20  (209)
 20 PF13677 MotB_plug:  Membrane M  31.6      63  0.0014   20.9   2.9   24   13-36     11-41  (58)
 21 PRK14857 tatA twin arginine tr  31.4      39 0.00084   24.3   2.0   16   18-33      7-22  (90)
 22 PRK03100 sec-independent trans  29.9      38 0.00083   26.1   1.9   16   18-33      6-21  (136)
 23 PRK14859 tatA twin arginine tr  29.8      47   0.001   22.3   2.1   16   18-33      5-20  (63)
 24 PRK03554 tatA twin arginine tr  29.8      46   0.001   24.0   2.1   17   18-34      5-21  (89)
 25 PRK14860 tatA twin arginine tr  29.7      43 0.00093   22.5   1.9   17   18-34      5-21  (64)
 26 PF02416 MttA_Hcf106:  mttA/Hcf  29.4      49  0.0011   21.1   2.1   16   18-33      2-17  (53)
 27 PRK08944 motB flagellar motor   29.4      55  0.0012   28.1   3.0   31    5-35      3-40  (302)
 28 PRK14858 tatA twin arginine tr  29.0      42 0.00092   24.9   1.9   16   18-33      5-20  (108)
 29 PRK01770 sec-independent trans  28.3      41 0.00089   26.9   1.9   16   18-33      5-20  (171)
 30 PRK00182 tatB sec-independent   28.3      43 0.00094   26.5   2.0   17   18-34      6-22  (160)
 31 PF12365 DUF3649:  Protein of u  27.2      63  0.0014   18.3   2.0   21   12-32      4-24  (28)
 32 PRK04598 tatA twin arginine tr  27.1      55  0.0012   23.1   2.1   16   18-33      5-20  (81)
 33 PRK14861 tatA twin arginine tr  27.0      54  0.0012   21.8   2.0   17   17-33      5-21  (61)
 34 PRK00575 tatA twin arginine tr  26.3      53  0.0011   23.8   2.0   16   18-33      5-20  (92)
 35 PRK00191 tatA twin arginine tr  26.0      58  0.0013   23.2   2.1   16   18-33      4-19  (84)
 36 PF13721 SecD-TM1:  SecD export  25.7      68  0.0015   23.1   2.5   24   14-37      2-25  (101)
 37 PRK01614 tatE twin arginine tr  25.1      62  0.0014   23.1   2.1   16   18-33      5-20  (85)
 38 PRK01470 tatA twin arginine tr  25.1      63  0.0014   20.8   2.0   16   18-33      4-19  (51)
 39 TIGR01410 tatB twin arginine-t  24.6      49  0.0011   23.0   1.5   16   18-33      4-19  (80)
 40 PRK04654 sec-independent trans  24.5      54  0.0012   27.2   1.9   16   18-33      5-20  (214)
 41 TIGR01411 tatAE twin arginine-  23.1      74  0.0016   19.9   2.0   16   18-33      3-18  (47)
 42 PRK01919 tatB sec-independent   22.9      52  0.0011   26.3   1.5   16   18-33      5-20  (169)
 43 PRK01833 tatA twin arginine tr  22.9      75  0.0016   22.0   2.1   16   18-33      5-20  (74)
 44 PRK04098 sec-independent trans  22.7      60  0.0013   25.7   1.9   16   18-33      5-20  (158)
 45 PF09324 DUF1981:  Domain of un  22.1      35 0.00077   23.7   0.4   23    4-26     45-67  (86)
 46 PF11027 DUF2615:  Protein of u  21.1 1.1E+02  0.0024   22.5   2.8    6  128-133    32-37  (103)
 47 PRK00720 tatA twin arginine tr  20.5      89  0.0019   21.9   2.1   16   19-34      6-21  (78)

No 1  
>cd00117 LU Ly-6 antigen / uPA receptor -like domain; occurs singly in GPI-linked cell-surface glycoproteins (Ly-6 family,CD59, thymocyte B cell antigen, Sgp-2) or as three-fold repeated domain in urokinase-type plasminogen activator receptor. Topology of these domains is similar to that of snake venom neurotoxins.
Probab=97.92  E-value=2.2e-05  Score=53.77  Aligned_cols=65  Identities=29%  Similarity=0.660  Sum_probs=41.1

Q ss_pred             eeEEEcCCCCCCCCCCCCCCCCCCCCCCCCccCcc---CceEEEEecCC----ceeEEEeccccCccccceeccCcccee
Q psy15591         46 IYCYECDSWKDHRCKDPFNYTVLPKDQPPLMTCNG---CCVKMVRNSRT----QFESIRRTCTSQLQINLFMVDHVCMME  118 (159)
Q Consensus        46 I~CY~CnS~~dp~C~Dpf~~~~~~~d~~p~~~c~~---~C~Kivq~~~g----~~~ivRR~C~~~~~~~~~~~d~~C~~~  118 (159)
                      |+||.|.+.++..|..+.             +||.   .|.|.+..+..    ...++ |+|+..           |...
T Consensus         1 L~C~~C~~~~~~~C~~~~-------------~C~~~~~~C~~~~~~~~~~~~~~~~~~-rgC~~~-----------C~~~   55 (79)
T cd00117           1 LECYSCTGVSTSSCSTET-------------NCPSPDDQCLTAVATVIEESVRLSLVV-RGCASD-----------CPFT   55 (79)
T ss_pred             CccCcCCCCCCCCCCCCC-------------ccCCCCCEeeEEEEEEEeeccccceEE-CcccCC-----------CCCC
Confidence            589999876556774432             3643   59988877532    23356 699952           5332


Q ss_pred             CC-------CCeEEEecCCCCCCCC
Q psy15591        119 GT-------GTGHMCFCEEDMCNAA  136 (159)
Q Consensus       119 ~~-------~~~~~C~C~~D~CN~A  136 (159)
                      ..       +....| |++|+||++
T Consensus        56 ~~~~~~~~~~~~~~C-C~tD~CN~~   79 (79)
T cd00117          56 NVFGQLSITFLKVSC-CQEDLCNAA   79 (79)
T ss_pred             CccCccccceEeeee-CCCCccCCC
Confidence            11       122477 999999986


No 2  
>PF01064 Activin_recp:  Activin types I and II receptor domain;  InterPro: IPR000472 Transforming growth factor-beta (TGF-beta) forms a family with other growth factors described in PDOC00223 from PROSITEDOC. The receptors for most of the members of this growth factor family are related. These proteins are receptor-type kinases of Ser/Thr type PDOC00100 from PROSITEDOC), which have a single transmembrane domain and a specific hydrophilic Cys-rich ligand-binding domain [, , ]. The C-terminal part of the extracellular domain is conserved. Some of the receptors of this family contain subclass-specific N-terminal extensions of this homology domain. The type I receptors also possess 7 extracellular residues preceding the cysteine box.; GO: 0004675 transmembrane receptor protein serine/threonine kinase activity, 0005024 transforming growth factor beta-activated receptor activity, 0016020 membrane; PDB: 3EVS_C 1BTE_A 1LX5_B 2GOO_C 2HLR_A 4FAO_W 2H64_C 2H62_D 1S4Y_C 1NYU_C ....
Probab=97.38  E-value=0.00044  Score=47.51  Aligned_cols=76  Identities=26%  Similarity=0.611  Sum_probs=49.9

Q ss_pred             eeEEEcCCCCCCCCCCCCCCCCCCCCCCCCccCc--cCceEEEEecCCc-eeEEEeccccCccccceeccCccceeC-CC
Q psy15591         46 IYCYECDSWKDHRCKDPFNYTVLPKDQPPLMTCN--GCCVKMVRNSRTQ-FESIRRTCTSQLQINLFMVDHVCMMEG-TG  121 (159)
Q Consensus        46 I~CY~CnS~~dp~C~Dpf~~~~~~~d~~p~~~c~--~~C~Kivq~~~g~-~~ivRR~C~~~~~~~~~~~d~~C~~~~-~~  121 (159)
                      |+|| |++..   |.+.            ...|.  ++|-+.+....+. ..+++|+|....+...... ..|...+ ..
T Consensus         1 l~C~-C~~~~---C~~~------------n~~C~t~~~Cf~~~~~~~~~~~~~~~~GC~~~~~~~~~~~-~~C~~~~~~~   63 (83)
T PF01064_consen    1 LKCY-CDSDD---CNET------------NQTCETGGFCFTSWEQDNGGGVEIVKKGCWSNEEDCPLCR-NQCRSSSSPS   63 (83)
T ss_dssp             EEEE-EETTC---HCTT------------TEEEEESCEEEEEEEEETTESEEEEEEEEEESTGGGTTTS-SSEEECSSST
T ss_pred             CEeE-eCccc---CCCC------------CCEeCCCCEEEEEEEEeeccceeEEEcCccCCccCcceec-ceeeccCCCC
Confidence            6899 99653   6531            12354  5799999987764 5666679998765321011 5687743 35


Q ss_pred             CeEEEecCCCCCCCCCC
Q psy15591        122 TGHMCFCEEDMCNAAMS  138 (159)
Q Consensus       122 ~~~~C~C~~D~CN~A~~  138 (159)
                      ...+|-|++|+||+..+
T Consensus        64 ~~~~CC~~~D~CN~~~~   80 (83)
T PF01064_consen   64 SVVFCCCSGDFCNSNLS   80 (83)
T ss_dssp             CEEEEEESSTTGGGSEE
T ss_pred             CeEEECCCCCccCCCCC
Confidence            56788678999998754


No 3  
>smart00134 LU Ly-6 antigen / uPA receptor -like domain. Three-fold repeated domain in urokinase-type plasminogen activator receptor; occurs singly in other GPI-linked cell-surface glycoproteins (Ly-6 family, CD59, thymocyte B cell antigen, Sgp-2). Topology of these domains is similar to that of snake venom neurotoxins.
Probab=97.38  E-value=0.00047  Score=47.23  Aligned_cols=65  Identities=23%  Similarity=0.613  Sum_probs=39.1

Q ss_pred             eeEEEcCCCCCCCCCCCCCCCCCCCCCCCCccCcc---CceEEEEec--CC-ceeEEEeccccCccccceeccCccceeC
Q psy15591         46 IYCYECDSWKDHRCKDPFNYTVLPKDQPPLMTCNG---CCVKMVRNS--RT-QFESIRRTCTSQLQINLFMVDHVCMMEG  119 (159)
Q Consensus        46 I~CY~CnS~~dp~C~Dpf~~~~~~~d~~p~~~c~~---~C~Kivq~~--~g-~~~ivRR~C~~~~~~~~~~~d~~C~~~~  119 (159)
                      |+||.|.+..+..|..+             .+||.   .|.|.+..+  .+ ..+++ |+|+....         |....
T Consensus         1 L~C~~C~~~~~~~C~~~-------------~~C~~~~~~C~~~~~~~~~~~~~~~~~-rgC~~~~~---------Cp~~~   57 (79)
T smart00134        1 LQCYSCTGNPDSSCSSE-------------EECRSPDDVCLTVVAEVISGSVGSVVY-KGCATSPI---------CPGSH   57 (79)
T ss_pred             CcceecCCcCCCCCCCc-------------ceeCCCCCEeEEEEEEEEecCCCceEE-cCccCCCC---------CCCCc
Confidence            58999987655566432             23643   699886543  22 45677 59994321         43221


Q ss_pred             ----C-C--Ce-EEEecCCCCCC
Q psy15591        120 ----T-G--TG-HMCFCEEDMCN  134 (159)
Q Consensus       120 ----~-~--~~-~~C~C~~D~CN  134 (159)
                          . +  .. .+| |++|+||
T Consensus        58 ~~~~~~~~~~~~~~C-C~tDlCN   79 (79)
T smart00134       58 SYEIHLTIANLKVSC-CQTDLCN   79 (79)
T ss_pred             cccccccEEEEeeEe-cCCCCCC
Confidence                1 1  12 467 9999999


No 4  
>PF00021 UPAR_LY6:  u-PAR/Ly-6 domain omitted due to poor similarity.;  InterPro: IPR001526 CD59 (also called 1F-5Ag, H19, HRF20, MACIF, MIRL, P-18 or protectin) inhibits formation of membrane attack complex (MAC), thus protecting cells from complement mediated lysis. It has a signalling role, as a GPI-anchored molecule, in T cell activation and appears to have some role in cell adhesion through CD2 (controversial). CD59 associates with C9, inhibiting incorporation into C5b-8 preventing terminal steps in polymerisation of the (MAC) in plasma membranes. Genetic defects in GPI-anchor attachment that cause a reduction or loss of both CD59 and CD55 on erythrocytes produce the symptoms of the disease paroxysmal nocturnal haemoglobinuria (PNH).  A variety of GPI-linked cell-surface glycoproteins are composed of one or more copies of a conserved domain of about 100 amino-acid residues [], []. Among these proteins, U-PAR contains three tandem copies of the domain, while all the others are made up of a single domain. As shown in the following schematic, this conserved domain contains 10 cysteine residues involved in five disulphide bonds - in U-PAR, the first copy of the domain lacks the fourth disulphide bond.  +------+ +------------------------+ +---+ | | | | | | xCxxCxxxxxxCxxxxxCxxxxxCxxxxxxxxxxxxxxxxxxCxxxxCxxxxxxxxxxxxxxCCxxxCxxxxxxxx | | | | +---------------------+ +--------------+ 'C': conserved cysteine involved in a disulphide bond.  CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/).; PDB: 2I9B_H 1YWH_E 3BT2_U 2FD6_U 3U74_U 3BT1_U 3U73_U 2L03_A 3LAQ_V 2J8B_A ....
Probab=96.89  E-value=0.0022  Score=41.64  Aligned_cols=64  Identities=28%  Similarity=0.726  Sum_probs=40.1

Q ss_pred             EEEcCCCCCCCCCCCCCCCCCCCCCCCCccCcc---CceEEEEecC--C-ceeEEEeccccCccccceeccCcccee---
Q psy15591         48 CYECDSWKDHRCKDPFNYTVLPKDQPPLMTCNG---CCVKMVRNSR--T-QFESIRRTCTSQLQINLFMVDHVCMME---  118 (159)
Q Consensus        48 CY~CnS~~dp~C~Dpf~~~~~~~d~~p~~~c~~---~C~Kivq~~~--g-~~~ivRR~C~~~~~~~~~~~d~~C~~~---  118 (159)
                      ||+|.+..+..|...             ++||+   .|..++..+.  + ...++.|+|+....         |...   
T Consensus         1 C~~C~~~~~~~C~~~-------------~~C~~~~~~C~~~~~~~~~g~~~~~~~~kgC~~~~~---------C~~~~~~   58 (77)
T PF00021_consen    1 CYSCYSPSSSSCSGE-------------VTCPGSEDVCYTATVTVTSGGNSVTLVSKGCATQSS---------CRFLSDF   58 (77)
T ss_dssp             EEEEECSTTTTSCTE-------------EEECTTTSEEEEEEEEEETTTCCEEEEEEEEEETTC---------CSEEEEE
T ss_pred             CCcccCCCCCCCCCC-------------CCcCCCCCeeEEEEEEeeecccCceEEEeeccccCC---------ccccccc
Confidence            899998877778542             35754   4988887653  2 23334469996432         6221   


Q ss_pred             -CCC--C-eEEEecCCCCCC
Q psy15591        119 -GTG--T-GHMCFCEEDMCN  134 (159)
Q Consensus       119 -~~~--~-~~~C~C~~D~CN  134 (159)
                       ..+  + .++| |++|+||
T Consensus        59 ~~~~~~~~~~~C-C~~dlCN   77 (77)
T PF00021_consen   59 SNGGIIKVSVSC-CNTDLCN   77 (77)
T ss_dssp             ESSSEECEEEEE-ESSTTTT
T ss_pred             cccceeEEEEEe-CCCCCCC
Confidence             112  1 2678 9999999


No 5  
>PF00087 Toxin_1:  Snake toxin;  InterPro: IPR003571 Snake toxins belong to a family of proteins [] which groups short and long neurotoxins, cytotoxins and short toxins, as well as a other miscellaneous venom peptides. Most of these toxins act by binding to the nicotinic acetylcholine receptors in the postsynaptic membrane of skeletal muscles and prevent the binding of acetylcholine, thereby blocking the excitation of muscles. Snake toxins are proteins that consist of sixty to seventy five amino acids. Among the invariant residues are eight cysteines all involved in disulphide bonds. The structure is small, disulphide-rich, nearly all beta sheet.; GO: 0005576 extracellular region; PDB: 3NEQ_B 2H5F_A 3PLC_A 1NOR_A 1UG4_A 1FFJ_A 1CCQ_A 1CB9_A 1VB0_A 1ONJ_A ....
Probab=96.68  E-value=0.0054  Score=40.94  Aligned_cols=41  Identities=27%  Similarity=0.596  Sum_probs=28.6

Q ss_pred             Cce-EEEEecCCceeEEEeccccCccccceeccCccceeCCCCeEEEecCCCCCC
Q psy15591         81 CCV-KMVRNSRTQFESIRRTCTSQLQINLFMVDHVCMMEGTGTGHMCFCEEDMCN  134 (159)
Q Consensus        81 ~C~-Kivq~~~g~~~ivRR~C~~~~~~~~~~~d~~C~~~~~~~~~~C~C~~D~CN  134 (159)
                      .|- |+........+++ |+|+..           |.....+....| |.+|.||
T Consensus        22 ~Cy~k~~~~~~~~~~~~-rGCa~t-----------CP~~~~~~~v~C-C~TD~CN   63 (63)
T PF00087_consen   22 ICYKKTWMDHPRGMRVE-RGCAAT-----------CPTPKPGEKVKC-CSTDKCN   63 (63)
T ss_dssp             EEEEEEEEETSTEEEEE-EEEESS-----------SSSSBSSEEEEE-ESSTTTT
T ss_pred             eeEEEEEecCCCCceEe-cchhcc-----------CcCCCCCCeEEE-cCCCCCC
Confidence            497 5555544567777 599953           755444556788 9999999


No 6  
>cd00206 snake_toxin Snake toxin domain, present in short and long neurotoxins, cytotoxins and short toxins, and in other miscellaneous venom peptides. The toxin acts by binding to the nicotinic acetylcholine receptors in the postsynaptic membrane of skeletal muscles and preventing the binding of acetylcholine, thereby blocking the excitation of muscles. This domain contains 60-75 amino acids that are fixed by 4-5 disulfide bridges and is nearly all beta sheet; it exists as either monomers or dimers.
Probab=96.40  E-value=0.0081  Score=40.16  Aligned_cols=41  Identities=27%  Similarity=0.542  Sum_probs=26.6

Q ss_pred             CceEEEEec-CCceeEEEeccccCccccceeccCccceeCCCCeEEEecCCCCCC
Q psy15591         81 CCVKMVRNS-RTQFESIRRTCTSQLQINLFMVDHVCMMEGTGTGHMCFCEEDMCN  134 (159)
Q Consensus        81 ~C~Kivq~~-~g~~~ivRR~C~~~~~~~~~~~d~~C~~~~~~~~~~C~C~~D~CN  134 (159)
                      .|-|..-.. ....++. |+|+..           |.....+....| |++|.||
T Consensus        23 ~Cyk~~~~~~~~g~~i~-rGCa~t-----------CP~~~~~~~v~C-C~TD~CN   64 (64)
T cd00206          23 ICYKKSWKDTPRGVRIE-RGCAAT-----------CPKVKPGEYVTC-CTTDKCN   64 (64)
T ss_pred             ccceeEEEcCCCCCEEE-ccccCc-----------CcCCCCCcceEe-cCCCCCC
Confidence            487664333 3445677 599953           754444445688 9999999


No 7  
>PF06579 Ly-6_related:  Caenorhabditis elegans ly-6-related protein;  InterPro: IPR010558 This family consists of several Caenorhabditis elegans specific ly-6-related HOT and ODR proteins. These proteins are involved in the olfactory system. Odr-2 mutants are known to be defective in the ability to chemotax to odorants that are recognised by the two AWC olfactory neurons. Odr-2 encodes a membrane-associated protein related to the Ly-6 superfamily of GPI-linked signalling proteins [].
Probab=95.47  E-value=0.016  Score=44.28  Aligned_cols=62  Identities=24%  Similarity=0.497  Sum_probs=39.5

Q ss_pred             CCccCccCceEEEEec--CC---ceeEEEeccccCcc-ccce--------eccCccceeC---------------CCCeE
Q psy15591         74 PLMTCNGCCVKMVRNS--RT---QFESIRRTCTSQLQ-INLF--------MVDHVCMMEG---------------TGTGH  124 (159)
Q Consensus        74 p~~~c~~~C~Kivq~~--~g---~~~ivRR~C~~~~~-~~~~--------~~d~~C~~~~---------------~~~~~  124 (159)
                      |.+.|+..|+-+++..  .|   ...+|| +|.-.-- .+..        +....|..-+               ..++.
T Consensus        39 ~~~~C~s~Cvtl~e~~~~~gg~~~~~yIR-GC~~~I~~~G~n~t~t~~~~~~~~~C~~~~~s~Lf~~~~~~~~~~~~~v~  117 (129)
T PF06579_consen   39 PTVPCSSICVTLFEPLDIFGGTRGFGYIR-GCLDSILRHGFNDTITLSFLDRRDICRRLRLSQLFPPGRRREHPSDSTVQ  117 (129)
T ss_pred             ceeecCchheeeEeccccccccccccEEE-cCHHHHHHhCCCCchHHHHhcCCCeeeeccHHHhcCcccccccCCCCeEE
Confidence            4677988899999983  23   466895 9985431 0110        0112486411               12368


Q ss_pred             EEecCCCCCCCC
Q psy15591        125 MCFCEEDMCNAA  136 (159)
Q Consensus       125 ~C~C~~D~CN~A  136 (159)
                      .|+|.+|+||+|
T Consensus       118 vCsC~gd~CN~s  129 (129)
T PF06579_consen  118 VCSCYGDRCNGS  129 (129)
T ss_pred             EEEECCCccCCC
Confidence            999999999986


No 8  
>PF05444 DUF753:  Protein of unknown function (DUF753);  InterPro: IPR008472 This entry contains sequences which are repeated in several uncharacterised proteins from Drosophila melanogaster.
Probab=94.61  E-value=0.074  Score=40.95  Aligned_cols=73  Identities=32%  Similarity=0.593  Sum_probs=39.5

Q ss_pred             EEcCCCCCCCCCCCCCCCCCCCCCCCCccCcc---CceEEEEecCCceeEEEeccccCccccceeccCccceeCCCCeEE
Q psy15591         49 YECDSWKDHRCKDPFNYTVLPKDQPPLMTCNG---CCVKMVRNSRTQFESIRRTCTSQLQINLFMVDHVCMMEGTGTGHM  125 (159)
Q Consensus        49 Y~CnS~~dp~C~Dpf~~~~~~~d~~p~~~c~~---~C~Kivq~~~g~~~ivRR~C~~~~~~~~~~~d~~C~~~~~~~~~~  125 (159)
                      |+|+|-.++.|.++-....      +...|++   .|.-++..   ...++ |+|.......   ....|...+   ...
T Consensus         1 ~~C~s~~~~~C~~~~~~~~------~~~~C~~~~~~C~t~~~~---~~~~~-RGC~~~~~~~---~~~~C~~~~---~~~   64 (152)
T PF05444_consen    1 YSCDSCEDPNCTDPDPSTS------ATEECPQQDDQCYTRFDD---DGTTI-RGCLSDLPAE---EQSSCSAGN---DAN   64 (152)
T ss_pred             CCccCCcCCCCCCCCCCce------ecccCCCCCCCCEEEEeC---CCceE-cCchhhcchh---hcccccCCC---CCc
Confidence            6899999999933221111      1234644   38777753   22256 6999764311   123464321   125


Q ss_pred             E-ecCCCCCCCCC
Q psy15591        126 C-FCEEDMCNAAM  137 (159)
Q Consensus       126 C-~C~~D~CN~A~  137 (159)
                      | .|++|+||.+.
T Consensus        65 C~~C~~~~CN~~~   77 (152)
T PF05444_consen   65 CVTCSGDGCNNAV   77 (152)
T ss_pred             ccCcCCCCCCCcc
Confidence            6 57777777743


No 9  
>KOG3653|consensus
Probab=91.40  E-value=2.3  Score=39.30  Aligned_cols=58  Identities=28%  Similarity=0.548  Sum_probs=37.5

Q ss_pred             CceEEEEecCCceeEEEeccccC--ccccceeccCccceeC---CC-CeEEEecCCCCCCCCCCC
Q psy15591         81 CCVKMVRNSRTQFESIRRTCTSQ--LQINLFMVDHVCMMEG---TG-TGHMCFCEEDMCNAAMST  139 (159)
Q Consensus        81 ~C~Kivq~~~g~~~ivRR~C~~~--~~~~~~~~d~~C~~~~---~~-~~~~C~C~~D~CN~A~~l  139 (159)
                      .|.-+-....|..+++.-+|...  ++.+-+ +...|....   .+ +.++|-|.+|.||.-.++
T Consensus        68 ~C~avW~~t~~~~~~v~qGC~~~~~D~~~c~-~~~eCv~s~~~~~g~t~~~CcCs~~~CN~n~s~  131 (534)
T KOG3653|consen   68 HCFAVWNKTSGTIEVVKQGCWSHITDDINCE-DSSECVVSAEPPPGQTLYFCCCSTDFCNANFSH  131 (534)
T ss_pred             ceEEEeeccCCceeEEeecCccccCCccccc-cccccccCCCCCCCCeEEEEecCCCcccCCccc
Confidence            58878777778888888899853  222211 123465421   22 378999999999986543


No 10 
>PF02988 PLA2_inh:  Phospholipase A2 inhibitor;  InterPro: IPR004126 Proteins in this entry inhibit basic phospholipase A2 isozymes in snake's venom [, ].; GO: 0004859 phospholipase inhibitor activity, 0005576 extracellular region
Probab=77.61  E-value=10  Score=26.92  Aligned_cols=66  Identities=27%  Similarity=0.652  Sum_probs=38.4

Q ss_pred             eEEEcCCCCCCCCCCCCCCCCCCCCCCCCccCc---cCceEEEEecC--C-ceeEEEeccccCccccceeccCccceeC-
Q psy15591         47 YCYECDSWKDHRCKDPFNYTVLPKDQPPLMTCN---GCCVKMVRNSR--T-QFESIRRTCTSQLQINLFMVDHVCMMEG-  119 (159)
Q Consensus        47 ~CY~CnS~~dp~C~Dpf~~~~~~~d~~p~~~c~---~~C~Kivq~~~--g-~~~ivRR~C~~~~~~~~~~~d~~C~~~~-  119 (159)
                      .|..|++.. +.|.-++            ..|.   ..|.+++.++-  | ..+.+-+.|.....         |.... 
T Consensus         2 ~CEvC~~~G-~~C~G~~------------~tC~~~eDtC~~~~~E~~~~~~s~~~~~K~C~~S~~---------C~~~~~   59 (83)
T PF02988_consen    2 SCEVCHGSG-KDCSGKM------------KTCEDGEDTCVTVVTEVSSAGVSFRTTHKGCFSSSD---------CHLGYV   59 (83)
T ss_pred             CcceecCcC-CCCCCCe------------eEcCCCCCEEEEEEEEeccCCeEEEEEEecccCccc---------cCCCCE
Confidence            478888753 6776543            2342   24999987753  2 23233258986532         65421 


Q ss_pred             ---CCC------eEEEecCCCCCCC
Q psy15591        120 ---TGT------GHMCFCEEDMCNA  135 (159)
Q Consensus       120 ---~~~------~~~C~C~~D~CN~  135 (159)
                         .++      ..+| |++|+||.
T Consensus        60 ~~n~g~~~y~rs~~~C-C~gd~C~~   83 (83)
T PF02988_consen   60 STNMGHGDYMRSRIHC-CQGDGCNT   83 (83)
T ss_pred             EEecCCCCEEEeeeee-ECCCccCC
Confidence               121      1478 99999994


No 11 
>KOG2052|consensus
Probab=77.35  E-value=10  Score=34.92  Aligned_cols=54  Identities=20%  Similarity=0.332  Sum_probs=31.1

Q ss_pred             cCceEEEEe-cCCceeEEEeccccCccccceeccCccceeC-CCCeEEEecCCCCCCC
Q psy15591         80 GCCVKMVRN-SRTQFESIRRTCTSQLQINLFMVDHVCMMEG-TGTGHMCFCEEDMCNA  135 (159)
Q Consensus        80 ~~C~Kivq~-~~g~~~ivRR~C~~~~~~~~~~~d~~C~~~~-~~~~~~C~C~~D~CN~  135 (159)
                      +.|-+.+.+ ..|+.... |+|....+.........|...+ ..+..+| |++|+||.
T Consensus        54 g~C~~s~~~~~~g~~~~~-~gC~~~~~~~~~~~~~~~~~~s~~~~~~~C-C~~d~CN~  109 (513)
T KOG2052|consen   54 GACFVSVEENDDGKEQHH-RGCMTLEESLPRCNPFKCAHSSPDFRNIEC-CYGDYCNN  109 (513)
T ss_pred             CeEEEEEEecCCCceEEE-ecccccccccccCCCccccCCCCCceEEEe-cCcccccc
Confidence            579999885 45665667 5999764321100111222211 1244688 89999995


No 12 
>PF01684 ET:  ET module;  InterPro: IPR002603 The proteins in this entry have no known function, and are found in Caenorhabditis elegans and in Caenorhabditis briggsae. Each repeat contains 8-10 conserved cysteines that probably form 4-5 disulphide bridges. By inspection of the conservation of cysteines it looks like cysteines 1, 2, 3, 4, 9 and 10 are always present and that sometimes the pair 5 and 8 or the pair 6 and 7 are missing. This suggests that cysteines 5/8 and 6/7 make disulphide bridges.
Probab=75.44  E-value=6.3  Score=27.78  Aligned_cols=60  Identities=22%  Similarity=0.464  Sum_probs=39.4

Q ss_pred             ccCccCceEEEE-ecCCceeEEEeccccCcc-ccceeccCccceeCCC-CeEEEecC-CCCCCCCC
Q psy15591         76 MTCNGCCVKMVR-NSRTQFESIRRTCTSQLQ-INLFMVDHVCMMEGTG-TGHMCFCE-EDMCNAAM  137 (159)
Q Consensus        76 ~~c~~~C~Kivq-~~~g~~~ivRR~C~~~~~-~~~~~~d~~C~~~~~~-~~~~C~C~-~D~CN~A~  137 (159)
                      +.|.|.|.++.. .++|....+= .|..... ..++ .++.|..-..+ .+..|-|+ .|.||...
T Consensus        18 ~~C~G~CaSvs~~~~ng~~~t~y-~C~P~~vC~~L~-l~n~C~~i~~~~~vtgCCC~~~dnC~~p~   81 (82)
T PF01684_consen   18 VACQGQCASVSITTYNGHNVTLY-TCDPTSVCRSLN-LNNSCNTIEGGREVTGCCCNNSDNCNDPT   81 (82)
T ss_pred             EEeCCEEEEEEEEeECCceEEEE-EechHHHHhhhc-ccCcccccCCCCcEEEEECCCCccccCCC
Confidence            358899999988 7888766663 7876533 1111 13457653333 47788798 99999753


No 13 
>PF01307 Plant_vir_prot:  Plant viral movement protein;  InterPro: IPR001896 This family of membrane/coat proteins are found in a number of different ssRNA plant virus families that include Potexvirus, Hordeivirus and Carlavirus.
Probab=41.99  E-value=50  Score=24.21  Aligned_cols=32  Identities=9%  Similarity=0.185  Sum_probs=14.6

Q ss_pred             eEEEecCCCCCCCCCCCchhHHHHHHHHHHHHHh
Q psy15591        123 GHMCFCEEDMCNAAMSTETSHFLLLFLVTLSMAL  156 (159)
Q Consensus       123 ~~~C~C~~D~CN~A~~l~~~~~l~~l~l~~~~a~  156 (159)
                      +.|+ ..... |+........+.+++.++|+++|
T Consensus        55 I~Y~-~P~~~-~~~~~~~~~~~~~~~vl~L~~~I   86 (104)
T PF01307_consen   55 INYN-SPNKL-SSSSSSSSKFQPFLLVLLLILLI   86 (104)
T ss_pred             EEeC-CCCCC-CcccCCCccHHHHHHHHHHHHHH
Confidence            4554 33344 44444433444444444444444


No 14 
>PRK03625 tatE twin arginine translocase protein E; Validated
Probab=41.05  E-value=23  Score=24.10  Aligned_cols=16  Identities=13%  Similarity=0.511  Sum_probs=11.0

Q ss_pred             hHHHHHHHHHHHHHHh
Q psy15591         18 GWSQMLTIPVLLLFFI   33 (159)
Q Consensus        18 ~~~~~l~~~v~~~~~~   33 (159)
                      +|.++|++++++++++
T Consensus         5 g~~elliIlvI~lllF   20 (67)
T PRK03625          5 SITKLLVVAALVVLLF   20 (67)
T ss_pred             cHHHHHHHHHHHHHHc
Confidence            5667777777777654


No 15 
>PF08917 ecTbetaR2:  Transforming growth factor beta receptor 2 ectodomain;  InterPro: IPR015013 The Transforming growth factor beta receptor 2 ectodomain is a compact fold consisting of nine beta-strands and a single helix stabilised by a network of six intra strand disulphide bonds. The folding topology includes a central five-stranded antiparallel beta-sheet, eight-residues long at its centre, covered by a second layer consisting of two segments of two-stranded antiparallel beta-sheets (beta1-beta4, beta3-beta9) []. ; GO: 0005026 transforming growth factor beta receptor activity, type II, 0005524 ATP binding, 0046872 metal ion binding, 0006468 protein phosphorylation, 0016020 membrane; PDB: 1KTZ_B 3KFD_E 1M9Z_A 2PJY_B 1PLO_A 1KS6_A.
Probab=39.92  E-value=23  Score=26.71  Aligned_cols=56  Identities=23%  Similarity=0.523  Sum_probs=35.7

Q ss_pred             CceEEEEecCCceeEEEeccccCccc--ccee---ccCccceeC----CCCeEEEecCCCCCCCCC
Q psy15591         81 CCVKMVRNSRTQFESIRRTCTSQLQI--NLFM---VDHVCMMEG----TGTGHMCFCEEDMCNAAM  137 (159)
Q Consensus        81 ~C~Kivq~~~g~~~ivRR~C~~~~~~--~~~~---~d~~C~~~~----~~~~~~C~C~~D~CN~A~  137 (159)
                      .|+-|--+.++...+- --|.-....  |..-   ....|.+..    ++..+.|.|.+|.||.--
T Consensus        37 VCvAiWRk~~~nitie-TlCHdP~~~l~G~~l~d~ns~~C~Mkek~~~g~~~~~CsC~~eECNd~l  101 (118)
T PF08917_consen   37 VCVAIWRKNDENITIE-TLCHDPKLPLHGFMLEDYNSSKCIMKEKKSEGGTFFMCSCSGEECNDKL  101 (118)
T ss_dssp             EEEEEEEEETTEEEEE-EEEE-TTSBCTTCB-TTTTCSSEEEEEEEETTCEEEEEEESSTTCCCEE
T ss_pred             EEEEEEEECCCCeEEE-EeecCCCCcccceEecCCCCCeeEEEeeeCCCCcEEEEecCccccCCeE
Confidence            5988887777766655 378855331  1100   235798742    356789999999999643


No 16 
>PRK00442 tatA twin arginine translocase protein A; Provisional
Probab=37.41  E-value=30  Score=25.04  Aligned_cols=17  Identities=18%  Similarity=0.534  Sum_probs=9.6

Q ss_pred             hhHHHHHHHHHHHHHHh
Q psy15591         17 PGWSQMLTIPVLLLFFI   33 (159)
Q Consensus        17 ~~~~~~l~~~v~~~~~~   33 (159)
                      .+|.++|++++++|++|
T Consensus         4 ~g~~elliIlvIvlllF   20 (92)
T PRK00442          4 FDWKHWIVILVVVVLVF   20 (92)
T ss_pred             ccHHHHHHHHHHHHHHh
Confidence            34556666666655554


No 17 
>COG1826 TatA Sec-independent protein secretion pathway components [Intracellular trafficking and secretion]
Probab=36.28  E-value=28  Score=24.72  Aligned_cols=17  Identities=41%  Similarity=0.806  Sum_probs=12.7

Q ss_pred             hhHHHHHHHHHHHHHHh
Q psy15591         17 PGWSQMLTIPVLLLFFI   33 (159)
Q Consensus        17 ~~~~~~l~~~v~~~~~~   33 (159)
                      .+|.++|+++|++++++
T Consensus         4 ig~~elliIlvV~lllf   20 (94)
T COG1826           4 IGWSELLIILVVALLVF   20 (94)
T ss_pred             CCHHHHHHHHHHHHHhc
Confidence            57788888888777665


No 18 
>PRK00404 tatB sec-independent translocase; Provisional
Probab=35.31  E-value=28  Score=27.07  Aligned_cols=17  Identities=18%  Similarity=0.522  Sum_probs=13.3

Q ss_pred             hHHHHHHHHHHHHHHhh
Q psy15591         18 GWSQMLTIPVLLLFFIS   34 (159)
Q Consensus        18 ~~~~~l~~~v~~~~~~~   34 (159)
                      ||+++|+|+|+.|++|-
T Consensus         5 G~~ELlvI~VVaLlV~G   21 (141)
T PRK00404          5 SFSELLLVGLVALLVLG   21 (141)
T ss_pred             cHHHHHHHHHHHHHhcC
Confidence            67888888888887653


No 19 
>PRK00708 sec-independent translocase; Provisional
Probab=34.77  E-value=27  Score=28.84  Aligned_cols=16  Identities=38%  Similarity=1.057  Sum_probs=12.4

Q ss_pred             hHHHHHHHHHHHHHHh
Q psy15591         18 GWSQMLTIPVLLLFFI   33 (159)
Q Consensus        18 ~~~~~l~~~v~~~~~~   33 (159)
                      ||.++|+|+|+.|++|
T Consensus         5 G~~ELlvI~vVaLvV~   20 (209)
T PRK00708          5 GWSELLVIAIVLIVVV   20 (209)
T ss_pred             cHHHHHHHHHHHHhhc
Confidence            6778888888888655


No 20 
>PF13677 MotB_plug:  Membrane MotB of proton-channel complex MotA/MotB 
Probab=31.58  E-value=63  Score=20.92  Aligned_cols=24  Identities=29%  Similarity=0.497  Sum_probs=11.7

Q ss_pred             ccCchhH-------HHHHHHHHHHHHHhhhc
Q psy15591         13 RSRWPGW-------SQMLTIPVLLLFFISEA   36 (159)
Q Consensus        13 ~~~~~~~-------~~~l~~~v~~~~~~~~~   36 (159)
                      -.+-|+|       +-.|+.++++++.++..
T Consensus        11 ~~~~~~WlvtyaDlmTLLl~fFVlL~s~s~~   41 (58)
T PF13677_consen   11 EEGSPRWLVTYADLMTLLLAFFVLLFSMSSV   41 (58)
T ss_pred             CCCCccHHHHHHHHHHHHHHHHHHHHHHHhC
Confidence            4555566       33444444555444443


No 21 
>PRK14857 tatA twin arginine translocase protein A; Provisional
Probab=31.42  E-value=39  Score=24.26  Aligned_cols=16  Identities=31%  Similarity=0.520  Sum_probs=9.8

Q ss_pred             hHHHHHHHHHHHHHHh
Q psy15591         18 GWSQMLTIPVLLLFFI   33 (159)
Q Consensus        18 ~~~~~l~~~v~~~~~~   33 (159)
                      ||.++|+++|+.|+++
T Consensus         7 G~~ElliIlvVaLlvf   22 (90)
T PRK14857          7 GLPEMAVILVIALLVF   22 (90)
T ss_pred             cHHHHHHHHHHHHHHc
Confidence            4556777776666544


No 22 
>PRK03100 sec-independent translocase; Provisional
Probab=29.93  E-value=38  Score=26.10  Aligned_cols=16  Identities=38%  Similarity=0.789  Sum_probs=12.1

Q ss_pred             hHHHHHHHHHHHHHHh
Q psy15591         18 GWSQMLTIPVLLLFFI   33 (159)
Q Consensus        18 ~~~~~l~~~v~~~~~~   33 (159)
                      ||.++|+|+|+.|++|
T Consensus         6 G~~EllvI~vVaLvv~   21 (136)
T PRK03100          6 GWGEMLVLVVAGLVIL   21 (136)
T ss_pred             cHHHHHHHHHHHHhhc
Confidence            6778888888877655


No 23 
>PRK14859 tatA twin arginine translocase protein A; Provisional
Probab=29.83  E-value=47  Score=22.27  Aligned_cols=16  Identities=25%  Similarity=0.607  Sum_probs=10.9

Q ss_pred             hHHHHHHHHHHHHHHh
Q psy15591         18 GWSQMLTIPVLLLFFI   33 (159)
Q Consensus        18 ~~~~~l~~~v~~~~~~   33 (159)
                      |+.++|++++++|+++
T Consensus         5 G~~ElliIlvv~Llvf   20 (63)
T PRK14859          5 GMPELIVILVIVLIVF   20 (63)
T ss_pred             cHHHHHHHHHHHHHHh
Confidence            5667777777777654


No 24 
>PRK03554 tatA twin arginine translocase protein A; Provisional
Probab=29.80  E-value=46  Score=23.96  Aligned_cols=17  Identities=24%  Similarity=0.465  Sum_probs=10.2

Q ss_pred             hHHHHHHHHHHHHHHhh
Q psy15591         18 GWSQMLTIPVLLLFFIS   34 (159)
Q Consensus        18 ~~~~~l~~~v~~~~~~~   34 (159)
                      |+.++|++++|+|++|-
T Consensus         5 G~~eLlIIlvIvLLlFG   21 (89)
T PRK03554          5 SIWQLLIIAVIVVLLFG   21 (89)
T ss_pred             cHHHHHHHHHHHHHHhC
Confidence            45566666666665543


No 25 
>PRK14860 tatA twin arginine translocase protein A; Provisional
Probab=29.66  E-value=43  Score=22.55  Aligned_cols=17  Identities=24%  Similarity=0.503  Sum_probs=11.5

Q ss_pred             hHHHHHHHHHHHHHHhh
Q psy15591         18 GWSQMLTIPVLLLFFIS   34 (159)
Q Consensus        18 ~~~~~l~~~v~~~~~~~   34 (159)
                      +|.++|++++++++++-
T Consensus         5 G~~ElliI~vIalllfG   21 (64)
T PRK14860          5 GMPELIVILVIALVVFG   21 (64)
T ss_pred             cHHHHHHHHHHHHhhcC
Confidence            56677777777776553


No 26 
>PF02416 MttA_Hcf106:  mttA/Hcf106 family;  InterPro: IPR003369 Members of this protein family are involved in a sec-independent translocation mechanism. This pathway has been called the DeltapH pathway in chloroplasts []. Members of this family in Escherichia coli are involved in export of redox proteins with a "twin arginine" leader motif (S/T-R-R-X-F-L-K) []. This sec-independent pathway is termed TAT for twin-arginine translocation system. This system mainly transports proteins with bound cofactors that require folding prior to export.; GO: 0008565 protein transporter activity, 0015031 protein transport; PDB: 2L16_A.
Probab=29.43  E-value=49  Score=21.14  Aligned_cols=16  Identities=31%  Similarity=0.692  Sum_probs=9.9

Q ss_pred             hHHHHHHHHHHHHHHh
Q psy15591         18 GWSQMLTIPVLLLFFI   33 (159)
Q Consensus        18 ~~~~~l~~~v~~~~~~   33 (159)
                      ||.++++++++.++++
T Consensus         2 g~~El~iI~vvalllf   17 (53)
T PF02416_consen    2 GFPELLIILVVALLLF   17 (53)
T ss_dssp             -HHHHHHHHHHHHHHS
T ss_pred             CHHHHHHHHHHHHHHh
Confidence            4567777777666554


No 27 
>PRK08944 motB flagellar motor protein MotB; Reviewed
Probab=29.37  E-value=55  Score=28.14  Aligned_cols=31  Identities=29%  Similarity=0.397  Sum_probs=19.0

Q ss_pred             hhccCcccccCchhHHH-------HHHHHHHHHHHhhh
Q psy15591          5 AQRKTPQVRSRWPGWSQ-------MLTIPVLLLFFISE   35 (159)
Q Consensus         5 ~~~~~~~~~~~~~~~~~-------~l~~~v~~~~~~~~   35 (159)
                      +.+|.+--..+.|+||-       +|+.+++||+.++.
T Consensus         3 ~~~~~~~~~~g~~~Wm~TfADlmTLLm~FFVlL~S~S~   40 (302)
T PRK08944          3 AEKKCKCPPPGAPAWLATFADLMSLLMCFFVLLLSFSE   40 (302)
T ss_pred             cccccCCCCCCchhHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            34566666789999964       45555555555543


No 28 
>PRK14858 tatA twin arginine translocase protein A; Provisional
Probab=29.04  E-value=42  Score=24.89  Aligned_cols=16  Identities=31%  Similarity=0.607  Sum_probs=10.8

Q ss_pred             hHHHHHHHHHHHHHHh
Q psy15591         18 GWSQMLTIPVLLLFFI   33 (159)
Q Consensus        18 ~~~~~l~~~v~~~~~~   33 (159)
                      ||.++|+|+|+.|++|
T Consensus         5 G~~ElliIlvVallvf   20 (108)
T PRK14858          5 GMPELIVILVIALIVI   20 (108)
T ss_pred             cHHHHHHHHHHHHHhc
Confidence            5567777777777654


No 29 
>PRK01770 sec-independent translocase; Provisional
Probab=28.34  E-value=41  Score=26.91  Aligned_cols=16  Identities=31%  Similarity=0.578  Sum_probs=11.9

Q ss_pred             hHHHHHHHHHHHHHHh
Q psy15591         18 GWSQMLTIPVLLLFFI   33 (159)
Q Consensus        18 ~~~~~l~~~v~~~~~~   33 (159)
                      ||.++|+|+|+.|++|
T Consensus         5 G~~ELllI~vVaLlV~   20 (171)
T PRK01770          5 GFSELLLVFVIGLVVL   20 (171)
T ss_pred             cHHHHHHHHHHHHHhc
Confidence            5678888888877655


No 30 
>PRK00182 tatB sec-independent translocase; Provisional
Probab=28.25  E-value=43  Score=26.55  Aligned_cols=17  Identities=29%  Similarity=0.757  Sum_probs=12.5

Q ss_pred             hHHHHHHHHHHHHHHhh
Q psy15591         18 GWSQMLTIPVLLLFFIS   34 (159)
Q Consensus        18 ~~~~~l~~~v~~~~~~~   34 (159)
                      ||.++|+|+||.|++|-
T Consensus         6 G~~EllvIlvIaLlVfG   22 (160)
T PRK00182          6 GWGEILLLLIVGLIVIG   22 (160)
T ss_pred             cHHHHHHHHHHHHHhcC
Confidence            67788888888777653


No 31 
>PF12365 DUF3649:  Protein of unknown function (DUF3649) ;  InterPro: IPR022109  This domain family is found in bacteria and eukaryotes, and is approximately 30 amino acids in length. 
Probab=27.23  E-value=63  Score=18.27  Aligned_cols=21  Identities=33%  Similarity=0.721  Sum_probs=17.1

Q ss_pred             cccCchhHHHHHHHHHHHHHH
Q psy15591         12 VRSRWPGWSQMLTIPVLLLFF   32 (159)
Q Consensus        12 ~~~~~~~~~~~l~~~v~~~~~   32 (159)
                      +||-|-+|.-+++...++...
T Consensus         4 ~rsa~rAW~Gll~~a~~l~~~   24 (28)
T PF12365_consen    4 ARSAWRAWLGLLLPAALLALL   24 (28)
T ss_pred             cchHHHHHHHHHHHHHHHHHH
Confidence            689999999988888777643


No 32 
>PRK04598 tatA twin arginine translocase protein A; Provisional
Probab=27.08  E-value=55  Score=23.09  Aligned_cols=16  Identities=25%  Similarity=0.486  Sum_probs=9.1

Q ss_pred             hHHHHHHHHHHHHHHh
Q psy15591         18 GWSQMLTIPVLLLFFI   33 (159)
Q Consensus        18 ~~~~~l~~~v~~~~~~   33 (159)
                      ++.++|+++++++++|
T Consensus         5 g~~elliIlvivlllF   20 (81)
T PRK04598          5 SIWQLLIIAVIVVLLF   20 (81)
T ss_pred             cHHHHHHHHHHHHHHh
Confidence            4446666666555544


No 33 
>PRK14861 tatA twin arginine translocase protein A; Provisional
Probab=27.02  E-value=54  Score=21.78  Aligned_cols=17  Identities=24%  Similarity=0.471  Sum_probs=12.5

Q ss_pred             hhHHHHHHHHHHHHHHh
Q psy15591         17 PGWSQMLTIPVLLLFFI   33 (159)
Q Consensus        17 ~~~~~~l~~~v~~~~~~   33 (159)
                      .||.++++++++.++++
T Consensus         5 ig~~ElliI~vi~llvf   21 (61)
T PRK14861          5 IGFPGLILILVVALIIF   21 (61)
T ss_pred             CCHHHHHHHHHHHHHhc
Confidence            36778888888877655


No 34 
>PRK00575 tatA twin arginine translocase protein A; Provisional
Probab=26.32  E-value=53  Score=23.76  Aligned_cols=16  Identities=6%  Similarity=0.177  Sum_probs=10.3

Q ss_pred             hHHHHHHHHHHHHHHh
Q psy15591         18 GWSQMLTIPVLLLFFI   33 (159)
Q Consensus        18 ~~~~~l~~~v~~~~~~   33 (159)
                      |+.++++|++++|++|
T Consensus         5 G~~ElliIlvi~LllF   20 (92)
T PRK00575          5 SPWHWAILAVVVILLF   20 (92)
T ss_pred             cHHHHHHHHHHHHHhc
Confidence            4557777777666655


No 35 
>PRK00191 tatA twin arginine translocase protein A; Provisional
Probab=26.01  E-value=58  Score=23.16  Aligned_cols=16  Identities=19%  Similarity=0.297  Sum_probs=10.3

Q ss_pred             hHHHHHHHHHHHHHHh
Q psy15591         18 GWSQMLTIPVLLLFFI   33 (159)
Q Consensus        18 ~~~~~l~~~v~~~~~~   33 (159)
                      ||.++|+++++++++|
T Consensus         4 g~~ElliI~vI~lllF   19 (84)
T PRK00191          4 GPWEIGIIVLLIIVLF   19 (84)
T ss_pred             cHHHHHHHHHHHHHHh
Confidence            4557777777666554


No 36 
>PF13721 SecD-TM1:  SecD export protein N-terminal TM region
Probab=25.72  E-value=68  Score=23.09  Aligned_cols=24  Identities=33%  Similarity=0.566  Sum_probs=18.5

Q ss_pred             cCchhHHHHHHHHHHHHHHhhhcc
Q psy15591         14 SRWPGWSQMLTIPVLLLFFISEAS   37 (159)
Q Consensus        14 ~~~~~~~~~l~~~v~~~~~~~~~~   37 (159)
                      .+.|.|--+|+++++++.++++--
T Consensus         2 N~yp~WKyllil~vl~~~~lyALP   25 (101)
T PF13721_consen    2 NRYPLWKYLLILVVLLLGALYALP   25 (101)
T ss_pred             CCcchHHHHHHHHHHHHHHHHHhh
Confidence            367889888888888887777644


No 37 
>PRK01614 tatE twin arginine translocase protein A; Validated
Probab=25.12  E-value=62  Score=23.09  Aligned_cols=16  Identities=13%  Similarity=0.555  Sum_probs=9.5

Q ss_pred             hHHHHHHHHHHHHHHh
Q psy15591         18 GWSQMLTIPVLLLFFI   33 (159)
Q Consensus        18 ~~~~~l~~~v~~~~~~   33 (159)
                      ++.++|+++++++++|
T Consensus         5 G~~ELLIIlvIvLLLF   20 (85)
T PRK01614          5 SITKLLVVGILIVLLF   20 (85)
T ss_pred             cHHHHHHHHHHHHHHh
Confidence            4456666666666554


No 38 
>PRK01470 tatA twin arginine translocase protein A; Provisional
Probab=25.08  E-value=63  Score=20.76  Aligned_cols=16  Identities=13%  Similarity=0.561  Sum_probs=9.6

Q ss_pred             hHHHHHHHHHHHHHHh
Q psy15591         18 GWSQMLTIPVLLLFFI   33 (159)
Q Consensus        18 ~~~~~l~~~v~~~~~~   33 (159)
                      ++.++++++++.++++
T Consensus         4 g~~elliI~vi~llvF   19 (51)
T PRK01470          4 SFSHLLIVLLIIFVLF   19 (51)
T ss_pred             CHHHHHHHHHHHHHhc
Confidence            3456666666666544


No 39 
>TIGR01410 tatB twin arginine-targeting protein translocase TatB. This model represents the TatB protein of a Sec-independent system for transporting folded proteins, often with a bound redox cofactor, across the bacterial inner membrane. TatC is the multiple membrane spanning component. TatB, like the related TatA/E proteins, appears to span the membrane one time. The tat system recognizes proteins with an elongated signal sequence containing a conserved R-R in a motif approximated by RRxFLK N-terminal to the transmembrane helix. TIGRFAMs model TIGR01409 describes this twin-Arg signal sequence. A similar system, termed Delta-pH-dependent transport, operates on chloroplast-encoded proteins.
Probab=24.55  E-value=49  Score=22.97  Aligned_cols=16  Identities=38%  Similarity=0.727  Sum_probs=11.8

Q ss_pred             hHHHHHHHHHHHHHHh
Q psy15591         18 GWSQMLTIPVLLLFFI   33 (159)
Q Consensus        18 ~~~~~l~~~v~~~~~~   33 (159)
                      ||.++|+++|+.++++
T Consensus         4 g~~EllvI~vvallv~   19 (80)
T TIGR01410         4 GFSELLLIAVVALVVL   19 (80)
T ss_pred             cHHHHHHHHHHHHheE
Confidence            5678888888877654


No 40 
>PRK04654 sec-independent translocase; Provisional
Probab=24.45  E-value=54  Score=27.21  Aligned_cols=16  Identities=25%  Similarity=0.451  Sum_probs=11.4

Q ss_pred             hHHHHHHHHHHHHHHh
Q psy15591         18 GWSQMLTIPVLLLFFI   33 (159)
Q Consensus        18 ~~~~~l~~~v~~~~~~   33 (159)
                      ||.++|+|+|+.|++|
T Consensus         5 G~~ELLlI~VVALlV~   20 (214)
T PRK04654          5 GVGELTLIAVVALVVL   20 (214)
T ss_pred             cHHHHHHHHHHHHHhc
Confidence            5667777777777655


No 41 
>TIGR01411 tatAE twin arginine-targeting protein translocase, TatA/E family. This model distinguishes TatA/E from the related TatB, but does not distinguish TatA from TatE. The Tat (twin-arginine translocation) system is a Sec-independent exporter for folded proteins, often with a redox cofactor already bound, across the bacterial inner membrane. Functionally equivalent systems are found in the chloroplast and some in archaeal species. The signal peptide recognized by the Tat system is modeled by TIGR01409.
Probab=23.06  E-value=74  Score=19.90  Aligned_cols=16  Identities=25%  Similarity=0.389  Sum_probs=10.0

Q ss_pred             hHHHHHHHHHHHHHHh
Q psy15591         18 GWSQMLTIPVLLLFFI   33 (159)
Q Consensus        18 ~~~~~l~~~v~~~~~~   33 (159)
                      +|.+++.++++.++++
T Consensus         3 g~~ElliI~vi~llvf   18 (47)
T TIGR01411         3 SPPEWLIILVVILLLF   18 (47)
T ss_pred             CHHHHHHHHHHHHHhc
Confidence            4567777776666554


No 42 
>PRK01919 tatB sec-independent translocase; Provisional
Probab=22.93  E-value=52  Score=26.34  Aligned_cols=16  Identities=38%  Similarity=0.511  Sum_probs=10.4

Q ss_pred             hHHHHHHHHHHHHHHh
Q psy15591         18 GWSQMLTIPVLLLFFI   33 (159)
Q Consensus        18 ~~~~~l~~~v~~~~~~   33 (159)
                      ||+++|+|.|+.|++|
T Consensus         5 G~~ElliI~VVALiV~   20 (169)
T PRK01919          5 GLSKLALIGVVALVVI   20 (169)
T ss_pred             cHHHHHHHHHHHHhee
Confidence            5667777777666544


No 43 
>PRK01833 tatA twin arginine translocase protein A; Provisional
Probab=22.88  E-value=75  Score=22.02  Aligned_cols=16  Identities=19%  Similarity=0.395  Sum_probs=8.9

Q ss_pred             hHHHHHHHHHHHHHHh
Q psy15591         18 GWSQMLTIPVLLLFFI   33 (159)
Q Consensus        18 ~~~~~l~~~v~~~~~~   33 (159)
                      ++.++|++++++++++
T Consensus         5 g~~elliIl~i~lllF   20 (74)
T PRK01833          5 SIWQLLIIVAIIVLLF   20 (74)
T ss_pred             cHHHHHHHHHHHHHHh
Confidence            4456666666555544


No 44 
>PRK04098 sec-independent translocase; Provisional
Probab=22.74  E-value=60  Score=25.67  Aligned_cols=16  Identities=31%  Similarity=0.727  Sum_probs=11.1

Q ss_pred             hHHHHHHHHHHHHHHh
Q psy15591         18 GWSQMLTIPVLLLFFI   33 (159)
Q Consensus        18 ~~~~~l~~~v~~~~~~   33 (159)
                      ||.++|+|+|+.+++|
T Consensus         5 G~~EllvI~vVaLlvf   20 (158)
T PRK04098          5 GFFEILVILVVAIIFL   20 (158)
T ss_pred             cHHHHHHHHHHHHhhc
Confidence            5667777777777654


No 45 
>PF09324 DUF1981:  Domain of unknown function (DUF1981);  InterPro: IPR015403 This domain is functionally uncharacterised and found in various plant and yeast protein transport proteins. It is noramlly associated with and C-termianl to the SEC7 domain. The SEC7 domain was named after the first protein found to contain such a region []. It has been shown to be linked with guanine nucleotide exchange function [, ]. 
Probab=22.08  E-value=35  Score=23.67  Aligned_cols=23  Identities=17%  Similarity=0.291  Sum_probs=17.2

Q ss_pred             hhhccCcccccCchhHHHHHHHH
Q psy15591          4 SAQRKTPQVRSRWPGWSQMLTIP   26 (159)
Q Consensus         4 ~~~~~~~~~~~~~~~~~~~l~~~   26 (159)
                      -.+.+....|||||-..++|..+
T Consensus        45 il~~~~~~i~SGW~~if~il~~a   67 (86)
T PF09324_consen   45 ILQSRGENIKSGWKVIFSILRAA   67 (86)
T ss_pred             HHHHhHHHHHhccHHHHHHHHHH
Confidence            34566678999999888777654


No 46 
>PF11027 DUF2615:  Protein of unknown function (DUF2615);  InterPro: IPR020309 This entry represents a group of uncharacterised protein from the Metazoa, including CD034 (or C4orf34) and YQF4 (or C34C12.4).
Probab=21.06  E-value=1.1e+02  Score=22.53  Aligned_cols=6  Identities=33%  Similarity=1.309  Sum_probs=2.9

Q ss_pred             cCCCCC
Q psy15591        128 CEEDMC  133 (159)
Q Consensus       128 C~~D~C  133 (159)
                      |+...|
T Consensus        32 CTDteC   37 (103)
T PF11027_consen   32 CTDTEC   37 (103)
T ss_pred             cCcchh
Confidence            444455


No 47 
>PRK00720 tatA twin arginine translocase protein A; Provisional
Probab=20.45  E-value=89  Score=21.89  Aligned_cols=16  Identities=13%  Similarity=0.260  Sum_probs=9.4

Q ss_pred             HHHHHHHHHHHHHHhh
Q psy15591         19 WSQMLTIPVLLLFFIS   34 (159)
Q Consensus        19 ~~~~l~~~v~~~~~~~   34 (159)
                      +.++|+++++++++|-
T Consensus         6 ~~ellIIlvIvlllFG   21 (78)
T PRK00720          6 IWHWLIVLAVVLLLFG   21 (78)
T ss_pred             HHHHHHHHHHHHHHhC
Confidence            3466666666665553


Done!