Query         psy15597
Match_columns 204
No_of_seqs    98 out of 119
Neff          3.4 
Searched_HMMs 46136
Date          Fri Aug 16 16:39:42 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15597.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15597hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4385|consensus              100.0 5.5E-52 1.2E-56  389.5  12.4  189    2-204    63-271 (581)
  2 KOG4385|consensus               95.6 0.00097 2.1E-08   64.9  -3.4   67  133-203   132-198 (581)
  3 PF00096 zf-C2H2:  Zinc finger,  85.7    0.58 1.3E-05   26.1   1.6   20  148-168     4-23  (23)
  4 PF13894 zf-C2H2_4:  C2H2-type   81.3     1.5 3.2E-05   23.7   2.1   21  148-168     4-24  (24)
  5 PF12756 zf-C2H2_2:  C2H2 type   79.8    0.57 1.2E-05   33.2   0.0   41  148-188     3-43  (100)
  6 PF13912 zf-C2H2_6:  C2H2-type   78.9     1.6 3.4E-05   25.3   1.7   21  149-169     6-26  (27)
  7 PF05605 zf-Di19:  Drought indu  77.8     2.5 5.4E-05   28.7   2.7   27  147-174     5-31  (54)
  8 PF12013 DUF3505:  Protein of u  73.5     3.1 6.8E-05   31.6   2.5   33  137-169    75-109 (109)
  9 COG4049 Uncharacterized protei  73.1     1.7 3.8E-05   32.0   1.0   27  144-170    17-43  (65)
 10 PHA00616 hypothetical protein   70.2     2.9 6.4E-05   28.7   1.5   26  147-172     4-29  (44)
 11 smart00355 ZnF_C2H2 zinc finge  68.2     6.3 0.00014   21.1   2.4   22  147-169     3-24  (26)
 12 PF12874 zf-met:  Zinc-finger o  63.5     5.3 0.00012   22.5   1.5   18  149-166     5-22  (25)
 13 PF12756 zf-C2H2_2:  C2H2 type   55.4      12 0.00025   26.4   2.5   28  142-171    50-77  (100)
 14 KOG4377|consensus               54.5     5.8 0.00013   38.8   1.0   29  136-164   395-423 (480)
 15 PF12171 zf-C2H2_jaz:  Zinc-fin  50.8     6.8 0.00015   23.0   0.5   19  148-166     5-23  (27)
 16 PF04696 Pinin_SDK_memA:  pinin  49.1      36 0.00078   27.4   4.6   44  157-200    13-56  (131)
 17 PF04968 CHORD:  CHORD ;  Inter  39.4      12 0.00026   27.4   0.4   30  133-162    25-54  (64)
 18 KOG3915|consensus               38.5      43 0.00094   33.7   4.2   19  147-165   192-212 (641)
 19 TIGR00741 yfiA ribosomal subun  36.6      35 0.00076   24.7   2.5   19  183-201    76-94  (95)
 20 PF13611 Peptidase_S76:  Serine  35.5      19 0.00042   29.5   1.1   20  147-166    78-97  (121)
 21 smart00037 CNX Connexin homolo  34.2     8.2 0.00018   25.5  -1.0   17  147-163    16-32  (34)
 22 KOG3608|consensus               32.8      23 0.00049   34.5   1.3   23  144-166   179-201 (467)
 23 smart00307 ILWEQ I/LWEQ domain  30.8      77  0.0017   27.8   4.1   26  177-203   168-193 (200)
 24 smart00451 ZnF_U1 U1-like zinc  30.2      43 0.00093   20.0   1.8   19  149-167     8-26  (35)
 25 PF03262 Corona_6B_7B:  Coronav  27.9      17 0.00036   32.3  -0.5   21  140-160    66-86  (209)
 26 PF06348 DUF1059:  Protein of u  27.5      58  0.0013   22.8   2.3   27  148-174    11-43  (57)
 27 PF04780 DUF629:  Protein of un  27.3      44 0.00096   32.8   2.2   33  140-174    55-87  (466)
 28 TIGR02218 phg_TIGR02218 phage   26.3      28  0.0006   30.7   0.6   19  138-156   171-191 (229)
 29 COG1544 Ribosome-associated pr  25.8      67  0.0015   25.5   2.6   18  184-201    79-96  (110)
 30 PF02482 Ribosomal_S30AE:  Sigm  24.2      57  0.0012   23.4   1.9   18  183-200    78-95  (97)

No 1  
>KOG4385|consensus
Probab=100.00  E-value=5.5e-52  Score=389.51  Aligned_cols=189  Identities=39%  Similarity=0.605  Sum_probs=149.2

Q ss_pred             cccchhhhcccccccccCcchhHHHHhhHHHHHHHHHHHHHHHHHHHHHhhhhhhhcccCCC-CCCCC-CCC----CCCC
Q psy15597          2 HQMQEKLFIQHTSSQHIDGDKSAEAMHDMAFQQNQLIHQLEMTQRKYVLQHAIGLQSQASTS-RPGQP-MMM----PSGV   75 (204)
Q Consensus         2 EQLhLQLLqQqh~~qq~~k~~~~~a~qQLafQQQlL~QqlQ~qq~q~~~QhlL~LqRqgllS-~P~q~-~~~----~~~~   75 (204)
                      |||++++++++ +++++... ...++++|+||++++ ||++.++         .|+|+|+++ +||+. +|+    ++||
T Consensus        63 ~qls~q~~~~~-agk~a~s~-~~~~n~~l~fQ~qL~-qm~~~q~---------~l~~~~~~tiqp~e~slplq~t~q~~m  130 (581)
T KOG4385|consen   63 PQLSLQLLQQQ-AGKNAKSQ-QSLLNQQLAFQQQLL-QMQQPQQ---------QLQRQGLLTIQPGESSLPLQTTPQAGM  130 (581)
T ss_pred             cccchhhhhhc-cCcCCccc-cccccccchHHHHHH-HHhhhhh---------hhhhccccccCCCCCCCcccccCcccC
Confidence            78999999887 66664443 357889999999976 6555432         288999999 78877 433    4699


Q ss_pred             CchhHhhhhhhcccC--CCCccCCCCCCCccc-----cccccccccccCcccCCCC----ccccccccccc---cccccc
Q psy15597         76 NQSDINSLWNNFSME--NQDVSIPAGDKSMFG-----INGLLVSMGISRREWMNGD----DQKANESYAEK---VHFLFG  141 (204)
Q Consensus        76 ~paelqqlWke~~~~--~~~~~~~~~~~~~~~-----~~~~~~s~~~~~~~~~nGq----~~~r~ss~~~~---~h~L~~  141 (204)
                      +|+++++||||+..+  .++.  .+++.+.++     ....+.+...+.|.++||+    ++|||+++++.   +||||+
T Consensus       131 ~pt~~~~lw~e~~~a~psed~--~~~~l~ltt~~~~s~~ps~~s~~~nph~~~n~q~~~~~~r~ds~~~~~~~~shPl~~  208 (581)
T KOG4385|consen  131 SPTPLQGLWKEGTPAHPSEDP--KHSGLDLTTTEASSTEPSKTSKVSNPHKVENGQHSVSSPRRDSSSMEEHPSSHPLYA  208 (581)
T ss_pred             CCccHHHHhhccccCCcCCCc--cccceeeeecchhccCccccccCCCcccccccccccccccchhhhhhcccccCCccc
Confidence            999999999988432  2221  222222211     1112223333459999999    48999998874   999999


Q ss_pred             CccccCCCCCcccccHHHHHHHhhhhcCCCCchhHHHHHHHHHHHHHHHHHHHHHHHhhhhhC
Q psy15597        142 HGVCKWPGCEAVCEDVQAFYKHLNKEHNLDDRSTAQARVQMQVVSQLELQLQKERDRLQALKI  204 (204)
Q Consensus       142 ~g~CkWPgCe~~~ed~~~flkHL~~eH~lddrstaQcrvQ~qvVqqLE~qL~~EkerL~AM~~  204 (204)
                      ||+|||||||++||||+.||||||+||+||||||||||||||||++||.+|.||||||+|||+
T Consensus       209 hgvckwpgcE~~~ed~~~flKhln~eh~lddrstaQcrvQmQVvqqlE~ql~ke~erlqamm~  271 (581)
T KOG4385|consen  209 HGVCKWPGCEAVCEDFGSFLKHLNTEHALDDRSTAQCRVQMQVVQQLEIQLSKESERLQAMMA  271 (581)
T ss_pred             CCccCCCchhhhccchHHHHHhhccccccchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999999999999999999995


No 2  
>KOG4385|consensus
Probab=95.61  E-value=0.00097  Score=64.90  Aligned_cols=67  Identities=9%  Similarity=0.069  Sum_probs=61.8

Q ss_pred             cccccccccCccccCCCCCcccccHHHHHHHhhhhcCCCCchhHHHHHHHHHHHHHHHHHHHHHHHhhhhh
Q psy15597        133 AEKVHFLFGHGVCKWPGCEAVCEDVQAFYKHLNKEHNLDDRSTAQARVQMQVVSQLELQLQKERDRLQALK  203 (204)
Q Consensus       133 ~~~~h~L~~~g~CkWPgCe~~~ed~~~flkHL~~eH~lddrstaQcrvQ~qvVqqLE~qL~~EkerL~AM~  203 (204)
                      +-+.+-||.+|+|.||+|+. |.+...|..|+.++|...+++++=-+   +.|...|..+..+|.+..+|+
T Consensus       132 pt~~~~lw~e~~~a~psed~-~~~~l~ltt~~~~s~~ps~~s~~~np---h~~~n~q~~~~~~r~ds~~~~  198 (581)
T KOG4385|consen  132 PTPLQGLWKEGTPAHPSEDP-KHSGLDLTTTEASSTEPSKTSKVSNP---HKVENGQHSVSSPRRDSSSME  198 (581)
T ss_pred             CccHHHHhhccccCCcCCCc-cccceeeeecchhccCccccccCCCc---ccccccccccccccchhhhhh
Confidence            34678899999999999999 99999999999999999999999888   788899999999999999987


No 3  
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=85.66  E-value=0.58  Score=26.13  Aligned_cols=20  Identities=20%  Similarity=0.516  Sum_probs=18.3

Q ss_pred             CCCCcccccHHHHHHHhhhhc
Q psy15597        148 PGCEAVCEDVQAFYKHLNKEH  168 (204)
Q Consensus       148 PgCe~~~ed~~~flkHL~~eH  168 (204)
                      |.|++.|.+...|.+|+.. |
T Consensus         4 ~~C~~~f~~~~~l~~H~~~-H   23 (23)
T PF00096_consen    4 PICGKSFSSKSNLKRHMRR-H   23 (23)
T ss_dssp             TTTTEEESSHHHHHHHHHH-H
T ss_pred             CCCCCccCCHHHHHHHHhH-C
Confidence            5899999999999999987 5


No 4  
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=81.32  E-value=1.5  Score=23.68  Aligned_cols=21  Identities=19%  Similarity=0.450  Sum_probs=18.0

Q ss_pred             CCCCcccccHHHHHHHhhhhc
Q psy15597        148 PGCEAVCEDVQAFYKHLNKEH  168 (204)
Q Consensus       148 PgCe~~~ed~~~flkHL~~eH  168 (204)
                      |-|+..|.+..++.+|+.+.|
T Consensus         4 ~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    4 PICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             SSTS-EESSHHHHHHHHHHHS
T ss_pred             cCCCCcCCcHHHHHHHHHhhC
Confidence            459999999999999999877


No 5  
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=79.79  E-value=0.57  Score=33.16  Aligned_cols=41  Identities=17%  Similarity=0.276  Sum_probs=0.0

Q ss_pred             CCCCcccccHHHHHHHhhhhcCCCCchhHHHHHHHHHHHHH
Q psy15597        148 PGCEAVCEDVQAFYKHLNKEHNLDDRSTAQARVQMQVVSQL  188 (204)
Q Consensus       148 PgCe~~~ed~~~flkHL~~eH~lddrstaQcrvQ~qvVqqL  188 (204)
                      +-|+..|.+...+++|+...|..+-....-+.....++..+
T Consensus         3 ~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~l~~~~~~~~~~   43 (100)
T PF12756_consen    3 LFCDESFSSVDDLLQHMKKKHGFDIPDQKYLVDPNRLLNYL   43 (100)
T ss_dssp             -----------------------------------------
T ss_pred             ccccccccccccccccccccccccccccccccccccccccc
Confidence            35999999999999999999999865433333344444444


No 6  
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=78.87  E-value=1.6  Score=25.27  Aligned_cols=21  Identities=14%  Similarity=0.311  Sum_probs=18.2

Q ss_pred             CCCcccccHHHHHHHhhhhcC
Q psy15597        149 GCEAVCEDVQAFYKHLNKEHN  169 (204)
Q Consensus       149 gCe~~~ed~~~flkHL~~eH~  169 (204)
                      -|++.|.+...|++|..+-|.
T Consensus         6 ~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    6 ECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             TTTEEESSHHHHHHHHCTTTT
T ss_pred             ccCCccCChhHHHHHhHHhcC
Confidence            599999999999999976554


No 7  
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=77.84  E-value=2.5  Score=28.72  Aligned_cols=27  Identities=19%  Similarity=0.365  Sum_probs=23.2

Q ss_pred             CCCCCcccccHHHHHHHhhhhcCCCCch
Q psy15597        147 WPGCEAVCEDVQAFYKHLNKEHNLDDRS  174 (204)
Q Consensus       147 WPgCe~~~ed~~~flkHL~~eH~lddrs  174 (204)
                      =|-|++ --|...|++|...+|..|.+.
T Consensus         5 CP~C~~-~~~~~~L~~H~~~~H~~~~~~   31 (54)
T PF05605_consen    5 CPYCGK-GFSESSLVEHCEDEHRSESKN   31 (54)
T ss_pred             CCCCCC-ccCHHHHHHHHHhHCcCCCCC
Confidence            378999 567899999999999998773


No 8  
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=73.54  E-value=3.1  Score=31.64  Aligned_cols=33  Identities=24%  Similarity=0.418  Sum_probs=30.2

Q ss_pred             cccccCccc--cCCCCCcccccHHHHHHHhhhhcC
Q psy15597        137 HFLFGHGVC--KWPGCEAVCEDVQAFYKHLNKEHN  169 (204)
Q Consensus       137 h~L~~~g~C--kWPgCe~~~ed~~~flkHL~~eH~  169 (204)
                      =|.|.+-.|  .+++|.-++-+....-+|+..+|.
T Consensus        75 Lp~~~G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   75 LPVYDGYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CCCCCCeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            377888889  999999999999999999999994


No 9  
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=73.05  E-value=1.7  Score=32.01  Aligned_cols=27  Identities=26%  Similarity=0.573  Sum_probs=23.9

Q ss_pred             cccCCCCCcccccHHHHHHHhhhhcCC
Q psy15597        144 VCKWPGCEAVCEDVQAFYKHLNKEHNL  170 (204)
Q Consensus       144 ~CkWPgCe~~~ed~~~flkHL~~eH~l  170 (204)
                      .-+-|-|+++|.+-.++++|.|..|..
T Consensus        17 ~lrCPRC~~~FR~~K~Y~RHVNKaH~~   43 (65)
T COG4049          17 FLRCPRCGMVFRRRKDYIRHVNKAHGW   43 (65)
T ss_pred             eeeCCchhHHHHHhHHHHHHhhHHhhh
Confidence            346799999999999999999999964


No 10 
>PHA00616 hypothetical protein
Probab=70.20  E-value=2.9  Score=28.70  Aligned_cols=26  Identities=15%  Similarity=0.304  Sum_probs=23.4

Q ss_pred             CCCCCcccccHHHHHHHhhhhcCCCC
Q psy15597        147 WPGCEAVCEDVQAFYKHLNKEHNLDD  172 (204)
Q Consensus       147 WPgCe~~~ed~~~flkHL~~eH~ldd  172 (204)
                      =|=|+..|-...++.+|+++.|.-|+
T Consensus         4 C~~CG~~F~~~s~l~~H~r~~hg~~~   29 (44)
T PHA00616          4 CLRCGGIFRKKKEVIEHLLSVHKQNK   29 (44)
T ss_pred             cchhhHHHhhHHHHHHHHHHhcCCCc
Confidence            37799999999999999999998865


No 11 
>smart00355 ZnF_C2H2 zinc finger.
Probab=68.20  E-value=6.3  Score=21.11  Aligned_cols=22  Identities=27%  Similarity=0.563  Sum_probs=18.5

Q ss_pred             CCCCCcccccHHHHHHHhhhhcC
Q psy15597        147 WPGCEAVCEDVQAFYKHLNKEHN  169 (204)
Q Consensus       147 WPgCe~~~ed~~~flkHL~~eH~  169 (204)
                      .+-|+..|.+...|..|+. .|.
T Consensus         3 C~~C~~~f~~~~~l~~H~~-~H~   24 (26)
T smart00355        3 CPECGKVFKSKSALKEHMR-THX   24 (26)
T ss_pred             CCCCcchhCCHHHHHHHHH-Hhc
Confidence            4559999999999999997 554


No 12 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=63.47  E-value=5.3  Score=22.55  Aligned_cols=18  Identities=17%  Similarity=0.342  Sum_probs=16.4

Q ss_pred             CCCcccccHHHHHHHhhh
Q psy15597        149 GCEAVCEDVQAFYKHLNK  166 (204)
Q Consensus       149 gCe~~~ed~~~flkHL~~  166 (204)
                      =|++.|.+...|..|+++
T Consensus         5 ~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    5 ICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             TTTEEESSHHHHHHHHTT
T ss_pred             CCCCCcCCHHHHHHHHCc
Confidence            389999999999999986


No 13 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=55.43  E-value=12  Score=26.37  Aligned_cols=28  Identities=21%  Similarity=0.470  Sum_probs=22.0

Q ss_pred             CccccCCCCCcccccHHHHHHHhhhhcCCC
Q psy15597        142 HGVCKWPGCEAVCEDVQAFYKHLNKEHNLD  171 (204)
Q Consensus       142 ~g~CkWPgCe~~~ed~~~flkHL~~eH~ld  171 (204)
                      .-.|  +-|.+.|.+...+.+|+++.+..+
T Consensus        50 ~~~C--~~C~~~f~s~~~l~~Hm~~~~H~~   77 (100)
T PF12756_consen   50 SFRC--PYCNKTFRSREALQEHMRSKHHKK   77 (100)
T ss_dssp             SEEB--SSSS-EESSHHHHHHHHHHTTTTC
T ss_pred             CCCC--CccCCCCcCHHHHHHHHcCccCCC
Confidence            4556  469999999999999999876554


No 14 
>KOG4377|consensus
Probab=54.47  E-value=5.8  Score=38.75  Aligned_cols=29  Identities=28%  Similarity=0.346  Sum_probs=24.0

Q ss_pred             ccccccCccccCCCCCcccccHHHHHHHh
Q psy15597        136 VHFLFGHGVCKWPGCEAVCEDVQAFYKHL  164 (204)
Q Consensus       136 ~h~L~~~g~CkWPgCe~~~ed~~~flkHL  164 (204)
                      ..-.+.|+.|.|+|||..+-+..+-..|-
T Consensus       395 ys~~cnhfhc~r~Gc~~tl~s~sqm~shk  423 (480)
T KOG4377|consen  395 YSGICNHFHCDRLGCEATLYSVSQMASHK  423 (480)
T ss_pred             cccceeeeeecccCCceEEEehhhhhhhh
Confidence            34567899999999999999988887774


No 15 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=50.80  E-value=6.8  Score=22.97  Aligned_cols=19  Identities=11%  Similarity=0.389  Sum_probs=17.2

Q ss_pred             CCCCcccccHHHHHHHhhh
Q psy15597        148 PGCEAVCEDVQAFYKHLNK  166 (204)
Q Consensus       148 PgCe~~~ed~~~flkHL~~  166 (204)
                      +-|++.|.|-..|-.|+++
T Consensus         5 ~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    5 DACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             TTTTBBBSSHHHHHCCTTS
T ss_pred             ccCCCCcCCHHHHHHHHcc
Confidence            4699999999999999986


No 16 
>PF04696 Pinin_SDK_memA:  pinin/SDK/memA/ protein conserved region;  InterPro: IPR006786 This conserved region is located adjacent and C-terminal to a N-terminal pinin/SKD domain IPR006787 from INTERPRO. Members of this family have very varied localisations within the eukaryotic cell. Pinin is known to localise at the desmosomes and is implicated in anchoring intermediate filaments to the desmosomal plaque []. SDK2/3 is a dynamically localised nuclear protein thought to be involved in modulation of alternative pre-mRNA splicing []. MemA is a tumour marker preferentially expressed in human melanoma cell lines. A common feature of the members of this family is that they may all participate in regulating protein-protein interactions [].
Probab=49.10  E-value=36  Score=27.42  Aligned_cols=44  Identities=20%  Similarity=0.379  Sum_probs=36.4

Q ss_pred             HHHHHHHhhhhcCCCCchhHHHHHHHHHHHHHHHHHHHHHHHhh
Q psy15597        157 VQAFYKHLNKEHNLDDRSTAQARVQMQVVSQLELQLQKERDRLQ  200 (204)
Q Consensus       157 ~~~flkHL~~eH~lddrstaQcrvQ~qvVqqLE~qL~~EkerL~  200 (204)
                      ||.++-||+.-=.-+++.+.+-.=+.+|-..||.++..|++.|.
T Consensus        13 FG~LlGTL~kf~~e~~k~~~~~~rR~eie~rleek~~~e~e~l~   56 (131)
T PF04696_consen   13 FGGLLGTLQKFKKEEEKKTEQQKRRAEIEKRLEEKLKEEKEELR   56 (131)
T ss_pred             HHHHHHHHHHHHHhHHhccHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            67788888866665677788888889999999999999988775


No 17 
>PF04968 CHORD:  CHORD ;  InterPro: IPR007051  Cysteine- and histidine-rich domains (CHORDs) are 60-amino acid modules that bind two zinc ions. They are usually arranged in tandem and are found in all tested eukaryotes, with the exception of yeast, where they are involved in processes ranging from pressure sensing in the heart to maintenance of diploidy in fungi, and exhibit distinct protein-protein interaction specificity. Six cysteine and two histidine residues are invariant within the CHORD domain. Three other residues are also invariant and some positions are confined to positive, negative, or aromatic amino acids [, ].   Silencing of the Caenorhabditis elegansCHORD-containing gene results in semisterility and embryo lethality, suggesting an essential function of the wild-type gene in nematode development. The CHORD domain is sometimes found N-terminal to the CS domain, IPR007052 from INTERPRO, in metazoan proteins, but occurs separately from the CS domain in plants. This association is thought to be indicative of an functional interaction between CS and CHORD domains []. ; PDB: 2XCM_E 2YRT_A.
Probab=39.39  E-value=12  Score=27.44  Aligned_cols=30  Identities=23%  Similarity=0.454  Sum_probs=26.0

Q ss_pred             cccccccccCccccCCCCCcccccHHHHHH
Q psy15597        133 AEKVHFLFGHGVCKWPGCEAVCEDVQAFYK  162 (204)
Q Consensus       133 ~~~~h~L~~~g~CkWPgCe~~~ed~~~flk  162 (204)
                      +-+..|.|..|+=.|-=|.+..-||.+|++
T Consensus        25 yHpG~PvFHeg~K~WsCC~~k~~dF~~Fl~   54 (64)
T PF04968_consen   25 YHPGPPVFHEGMKGWSCCKKKVSDFDEFLK   54 (64)
T ss_dssp             EBSS-EEEETTEEEETTTTEEESSHHHHTT
T ss_pred             ecCCCceecCCceEEecCCCEeeCHHHHhc
Confidence            446788999999999999999999999985


No 18 
>KOG3915|consensus
Probab=38.47  E-value=43  Score=33.67  Aligned_cols=19  Identities=42%  Similarity=0.833  Sum_probs=16.4

Q ss_pred             CCCCCcccc--cHHHHHHHhh
Q psy15597        147 WPGCEAVCE--DVQAFYKHLN  165 (204)
Q Consensus       147 WPgCe~~~e--d~~~flkHL~  165 (204)
                      --|||.+|-  -|.-|||||-
T Consensus       192 i~g~emiCLPQafdlFLKhlV  212 (641)
T KOG3915|consen  192 IEGCELICLPQAFDLFLKHLV  212 (641)
T ss_pred             ecCceEEecHHHHHHHHHHHh
Confidence            469999997  6999999984


No 19 
>TIGR00741 yfiA ribosomal subunit interface protein. The member of this family from E. coli is now recognized as a protein at the interace between ribosomal large and small subunits, with about 1/3 as many copies per cell as the number of ribosomes.
Probab=36.56  E-value=35  Score=24.67  Aligned_cols=19  Identities=26%  Similarity=0.440  Sum_probs=16.4

Q ss_pred             HHHHHHHHHHHHHHHHhhh
Q psy15597        183 QVVSQLELQLQKERDRLQA  201 (204)
Q Consensus       183 qvVqqLE~qL~~EkerL~A  201 (204)
                      .++..||.||.++|+|+.+
T Consensus        76 ~a~~klerql~k~k~k~~~   94 (95)
T TIGR00741        76 LAIDKLERQLRKLKEKRKE   94 (95)
T ss_pred             HHHHHHHHHHHHHHhhhhc
Confidence            3789999999999999853


No 20 
>PF13611 Peptidase_S76:  Serine peptidase of plant viral polyprotein, P1
Probab=35.52  E-value=19  Score=29.49  Aligned_cols=20  Identities=20%  Similarity=0.375  Sum_probs=18.5

Q ss_pred             CCCCCcccccHHHHHHHhhh
Q psy15597        147 WPGCEAVCEDVQAFYKHLNK  166 (204)
Q Consensus       147 WPgCe~~~ed~~~flkHL~~  166 (204)
                      |-||+-++++...||+|+|.
T Consensus        78 ~d~~~Dm~p~~r~fl~h~n~   97 (121)
T PF13611_consen   78 KDGEDDMYPEDRSFLEHYNA   97 (121)
T ss_pred             cCcccCCCHHHHHHHhcccc
Confidence            66999999999999999995


No 21 
>smart00037 CNX Connexin homologues. Connexin channels participate in the regulation of signaling between  developing and differentiated cell types.
Probab=34.20  E-value=8.2  Score=25.50  Aligned_cols=17  Identities=47%  Similarity=0.800  Sum_probs=12.3

Q ss_pred             CCCCCcccccHHHHHHH
Q psy15597        147 WPGCEAVCEDVQAFYKH  163 (204)
Q Consensus       147 WPgCe~~~ed~~~flkH  163 (204)
                      =|||+.+|-|.-.=|.|
T Consensus        16 QPGC~nvCyD~~fPiSh   32 (34)
T smart00037       16 QPGCENVCYDQAFPISH   32 (34)
T ss_pred             CCCccceeccccccCcc
Confidence            59999999886544444


No 22 
>KOG3608|consensus
Probab=32.84  E-value=23  Score=34.51  Aligned_cols=23  Identities=17%  Similarity=0.595  Sum_probs=21.4

Q ss_pred             cccCCCCCcccccHHHHHHHhhh
Q psy15597        144 VCKWPGCEAVCEDVQAFYKHLNK  166 (204)
Q Consensus       144 ~CkWPgCe~~~ed~~~flkHL~~  166 (204)
                      +|+|-||-+.++|-..+.+|+.+
T Consensus       179 ~C~W~~Ct~~~~~k~~LreH~r~  201 (467)
T KOG3608|consen  179 MCNWAMCTKHMGNKYRLREHIRT  201 (467)
T ss_pred             eccchhhhhhhccHHHHHHHHHh
Confidence            79999999999999999999874


No 23 
>smart00307 ILWEQ I/LWEQ domain. Thought to possess an F-actin binding function.
Probab=30.83  E-value=77  Score=27.83  Aligned_cols=26  Identities=23%  Similarity=0.528  Sum_probs=20.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhhhh
Q psy15597        177 QARVQMQVVSQLELQLQKERDRLQALK  203 (204)
Q Consensus       177 QcrvQ~qvVqqLE~qL~~EkerL~AM~  203 (204)
                      ...-|..|+ .||..|.++|.||-.|-
T Consensus       168 emE~Qv~IL-~lE~~L~~ar~~L~~lR  193 (200)
T smart00307      168 EMEQQVEIL-KLENELEAARKKLAEIR  193 (200)
T ss_pred             HHHHHHHHH-HHHHHHHHHHHHHHHHH
Confidence            445566666 89999999999998873


No 24 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=30.18  E-value=43  Score=19.96  Aligned_cols=19  Identities=21%  Similarity=0.302  Sum_probs=16.8

Q ss_pred             CCCcccccHHHHHHHhhhh
Q psy15597        149 GCEAVCEDVQAFYKHLNKE  167 (204)
Q Consensus       149 gCe~~~ed~~~flkHL~~e  167 (204)
                      =|++.|.+-.++..|+++.
T Consensus         8 ~C~~~~~~~~~~~~H~~gk   26 (35)
T smart00451        8 LCNVTFTDEISVEAHLKGK   26 (35)
T ss_pred             ccCCccCCHHHHHHHHChH
Confidence            4899999999999999865


No 25 
>PF03262 Corona_6B_7B:  Coronavirus 6B/7B protein;  InterPro: IPR004945  The function of the Coronavirus 6B and 7B proteins is not known.
Probab=27.92  E-value=17  Score=32.26  Aligned_cols=21  Identities=29%  Similarity=0.613  Sum_probs=16.5

Q ss_pred             ccCccccCCCCCcccccHHHH
Q psy15597        140 FGHGVCKWPGCEAVCEDVQAF  160 (204)
Q Consensus       140 ~~~g~CkWPgCe~~~ed~~~f  160 (204)
                      ..+-.|.|||-...-.|...|
T Consensus        66 ieGf~CtwPGf~~~a~DHiDf   86 (209)
T PF03262_consen   66 IEGFNCTWPGFQNPAHDHIDF   86 (209)
T ss_pred             ccceeccCCCcccccccceeE
Confidence            456689999999988876655


No 26 
>PF06348 DUF1059:  Protein of unknown function (DUF1059);  InterPro: IPR009409 This entry consists of short hypothetical archaeal and bacterial proteins of unknown function.
Probab=27.49  E-value=58  Score=22.80  Aligned_cols=27  Identities=22%  Similarity=0.481  Sum_probs=21.7

Q ss_pred             CCCCccccc------HHHHHHHhhhhcCCCCch
Q psy15597        148 PGCEAVCED------VQAFYKHLNKEHNLDDRS  174 (204)
Q Consensus       148 PgCe~~~ed------~~~flkHL~~eH~lddrs  174 (204)
                      |||+..+.-      +..+..|...+|..++-+
T Consensus        11 ~~C~~~~~a~tedEll~~~~~Ha~~~Hg~~~~~   43 (57)
T PF06348_consen   11 PDCGFVIRAETEDELLEAVVEHAREVHGMTEIP   43 (57)
T ss_pred             CCCCeEEeeCCHHHHHHHHHHHHHHhcCCccCC
Confidence            888887763      567889999999998743


No 27 
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=27.26  E-value=44  Score=32.81  Aligned_cols=33  Identities=21%  Similarity=0.541  Sum_probs=26.8

Q ss_pred             ccCccccCCCCCcccccHHHHHHHhhhhcCCCCch
Q psy15597        140 FGHGVCKWPGCEAVCEDVQAFYKHLNKEHNLDDRS  174 (204)
Q Consensus       140 ~~~g~CkWPgCe~~~ed~~~flkHL~~eH~lddrs  174 (204)
                      |--=+|  |-|++.|-|+.+|+.|+-.+|.-+-..
T Consensus        55 WrFWiC--p~CskkF~d~~~~~~H~~~eH~~~l~P   87 (466)
T PF04780_consen   55 WRFWIC--PRCSKKFSDAESCLSHMEQEHPAGLKP   87 (466)
T ss_pred             eeEeeC--CcccceeCCHHHHHHHHHHhhhhhcCh
Confidence            444455  559999999999999999999987653


No 28 
>TIGR02218 phg_TIGR02218 phage conserved hypothetical protein BR0599. This model describes a family of proteins found almost exclusively in phage or in prophage regions of bacterial genomes, including the phage-like Rhodobacter capsulatus gene transfer agent, which packages DNA. An apparent exception is Wolbachia pipientis wMel, a bacterial endosymbiont of the fruit fly, which has several candidate phage-related genes physically separate from obvious prophage regions.
Probab=26.28  E-value=28  Score=30.71  Aligned_cols=19  Identities=26%  Similarity=0.676  Sum_probs=16.4

Q ss_pred             ccccCccccC--CCCCccccc
Q psy15597        138 FLFGHGVCKW--PGCEAVCED  156 (204)
Q Consensus       138 ~L~~~g~CkW--PgCe~~~ed  156 (204)
                      .-|.+|+-+|  |||++.|+.
T Consensus       171 g~f~~G~l~~~~~GCDk~~~T  191 (229)
T TIGR02218       171 GWFSRGRLEWTGAGCDKRFAT  191 (229)
T ss_pred             ccccccEEEEeCCCCCCChhH
Confidence            4589999999  999998874


No 29 
>COG1544 Ribosome-associated protein Y (PSrp-1) [Translation, ribosomal structure and biogenesis]
Probab=25.82  E-value=67  Score=25.50  Aligned_cols=18  Identities=33%  Similarity=0.661  Sum_probs=16.3

Q ss_pred             HHHHHHHHHHHHHHHhhh
Q psy15597        184 VVSQLELQLQKERDRLQA  201 (204)
Q Consensus       184 vVqqLE~qL~~EkerL~A  201 (204)
                      ++..||.||.|-|+|+..
T Consensus        79 a~dKLerqlrK~K~K~~~   96 (110)
T COG1544          79 AIDKLERQLRKHKEKLKD   96 (110)
T ss_pred             HHHHHHHHHHHHHHHHhh
Confidence            789999999999999864


No 30 
>PF02482 Ribosomal_S30AE:  Sigma 54 modulation protein / S30EA ribosomal protein;  InterPro: IPR003489 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This family contains the sigma-54 modulation protein family and the S30Ae family of ribosomal proteins which includes the light-repressed protein (lrtA) [].; GO: 0005488 binding, 0044238 primary metabolic process; PDB: 1L4S_A 1VOX_a 1VOV_a 3V2E_Y 3V2C_Y 1N3G_A 1VOS_a 1VOZ_a 1VOQ_a 1IMU_A ....
Probab=24.24  E-value=57  Score=23.42  Aligned_cols=18  Identities=33%  Similarity=0.586  Sum_probs=15.8

Q ss_pred             HHHHHHHHHHHHHHHHhh
Q psy15597        183 QVVSQLELQLQKERDRLQ  200 (204)
Q Consensus       183 qvVqqLE~qL~~EkerL~  200 (204)
                      .++..||.+|.+.|+|+.
T Consensus        78 ~a~dkl~rql~k~k~k~~   95 (97)
T PF02482_consen   78 EAFDKLERQLRKYKEKLR   95 (97)
T ss_dssp             HHHHHHHHHHHHHHHCCC
T ss_pred             HHHHHHHHHHHHHHHHhh
Confidence            478999999999999875


Done!