Query         psy1560
Match_columns 175
No_of_seqs    119 out of 262
Neff          4.3 
Searched_HMMs 46136
Date          Fri Aug 16 16:49:17 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy1560.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/1560hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 smart00068 GHB Glycoprotein ho 100.0 1.7E-43 3.6E-48  270.6  11.5  103   60-169     2-104 (107)
  2 cd00069 GHB Glycoprotein hormo 100.0 6.5E-43 1.4E-47  265.5  10.6  100   63-169     1-100 (102)
  3 PF00007 Cys_knot:  Cystine-kno 100.0 1.4E-28 3.1E-33  184.3   6.8  102   61-169     2-103 (105)
  4 PF03045 DAN:  DAN domain;  Int  98.6 3.7E-07 8.1E-12   70.9   8.8   96   54-155    21-120 (121)
  5 smart00041 CT C-terminal cysti  97.9 5.7E-05 1.2E-09   54.5   7.2   77   67-153     3-79  (82)
  6 PF05463 Sclerostin:  Sclerosti  96.3   0.018 3.9E-07   48.9   7.5   90   57-153    62-157 (198)
  7 PF00019 TGF_beta:  Transformin  80.0     3.3 7.1E-05   30.5   4.1   84   62-152     3-105 (105)
  8 PF00236 Hormone_6:  Glycoprote  66.2     1.8 3.9E-05   33.1  -0.2   56   88-155    29-92  (96)
  9 smart00067 GHA Glycoprotein ho  58.6      17 0.00037   27.3   3.8   57   87-155    19-83  (87)
 10 PF13956 Ibs_toxin:  Toxin Ibs,  50.9     5.3 0.00011   22.2   0.1   16   38-53      1-16  (19)
 11 smart00204 TGFB Transforming g  39.5 1.4E+02  0.0031   22.1   6.3   83   63-152     1-102 (102)
 12 PF11803 UXS1_N:  UDP-glucurona  30.7      40 0.00086   25.0   2.0   24   31-55     11-34  (78)
 13 PF02084 Bindin:  Bindin;  Inte  30.1      27 0.00058   30.7   1.2   10   19-28    163-172 (238)
 14 PRK06411 NADH dehydrogenase su  27.1      49  0.0011   27.9   2.2   20  116-135   127-146 (183)
 15 PF01058 Oxidored_q6:  NADH ubi  24.7      29 0.00063   26.8   0.4   15  121-135   108-122 (131)
 16 TIGR01957 nuoB_fam NADH-quinon  24.3      58  0.0013   26.3   2.1   20  116-135   110-129 (145)
 17 PF13617 Lipoprotein_19:  YnbE-  23.9 1.7E+02  0.0037   20.4   4.1   16   61-79     14-29  (59)
 18 PF15069 FAM163:  FAM163 family  23.9      18 0.00039   29.6  -1.0   16    9-24     24-43  (143)
 19 PF06880 DUF1262:  Protein of u  23.8   1E+02  0.0023   23.9   3.3   19   88-106    19-37  (104)
 20 PRK14816 NADH dehydrogenase su  23.5      61  0.0013   27.4   2.1   19  117-135   135-153 (182)
 21 COG1177 PotC ABC-type spermidi  20.8 1.3E+02  0.0029   26.4   3.8   17   22-38    163-179 (267)
 22 COG1740 HyaA Ni,Fe-hydrogenase  20.2      93   0.002   28.9   2.7   45   88-136   150-197 (355)

No 1  
>smart00068 GHB Glycoprotein hormone beta chain homologues. Also called gonadotropins. Glycoprotein hormones consist of two glycosylated chains (alpha and beta) of similar topology.
Probab=100.00  E-value=1.7e-43  Score=270.65  Aligned_cols=103  Identities=21%  Similarity=0.383  Sum_probs=99.8

Q ss_pred             CCCceeeeeeEEEEecCCCCCccceeEEEeeeeeecccCCCCCCCCCCCCCCCCCcccCceEEEEEEeCCCCCCccCCee
Q psy1560          60 TLDCHRRVYKYRVSQTDSLGRKCWDDIEVLSCWGRCDSNETSDWRFPYKRSHHPVCQHGARALKVVILNNCEENVEQGTE  139 (175)
Q Consensus        60 ~~~C~l~n~Ti~VEk~dC~~c~C~~~I~Tt~C~G~C~T~e~p~~~~P~~~s~Q~VCty~~~~y~tv~LpgC~~gVdP~~~  139 (175)
                      +++|+|+|+||.|||+||++|   +.||||||+|||+|+| |++++|+...+|+||||++|+|+|++|||||+||||   
T Consensus         2 ~~~C~~~n~ti~vEk~~C~~c---~~i~TTiC~G~C~T~d-pv~~~~~~~~~Q~vCtY~d~~Y~tv~lpgCp~gvdp---   74 (107)
T smart00068        2 RPGCRPTNATIAVEKEECPVC---ITINTTICAGYCYTRD-PVYKSPLPPLPQRVCTYRELRYETVRLPGCPPGVDP---   74 (107)
T ss_pred             CCCceeEeEEEEEeeCCCCce---eEEEeEeECccccccC-ccccCCCCCcccCCccCCceEEEEEECCCccCCCCC---
Confidence            578999999999999999999   9999999999999995 999999999999999999999999999999999999   


Q ss_pred             eEEEeeeeceecCCCCCCCCccccccCccc
Q psy1560         140 VYRYLEALSCKCSVCKSSEASCEGLRYSSY  169 (175)
Q Consensus       140 ~ytYPvAlSC~C~~C~t~~TdC~~~~~~~~  169 (175)
                      +|+||||+||+|++|++++|||+.++.+++
T Consensus        75 ~~tYPVAlSC~C~~C~t~~tdC~~~~~~~~  104 (107)
T smart00068       75 VVTYPVALSCHCGKCNTDTTDCTVESLGPD  104 (107)
T ss_pred             cEEeeeecccCCCCcCCCCccccCcCCCCC
Confidence            999999999999999999999999998764


No 2  
>cd00069 GHB Glycoprotein hormone beta chain homologues. Gonadotropins; reproductive hormones consisting of two glycosylated chains (alpha and beta) of similar topology with Cysteine-knot motifs.
Probab=100.00  E-value=6.5e-43  Score=265.48  Aligned_cols=100  Identities=22%  Similarity=0.419  Sum_probs=97.1

Q ss_pred             ceeeeeeEEEEecCCCCCccceeEEEeeeeeecccCCCCCCCCCCCCCCCCCcccCceEEEEEEeCCCCCCccCCeeeEE
Q psy1560          63 CHRRVYKYRVSQTDSLGRKCWDDIEVLSCWGRCDSNETSDWRFPYKRSHHPVCQHGARALKVVILNNCEENVEQGTEVYR  142 (175)
Q Consensus        63 C~l~n~Ti~VEk~dC~~c~C~~~I~Tt~C~G~C~T~e~p~~~~P~~~s~Q~VCty~~~~y~tv~LpgC~~gVdP~~~~yt  142 (175)
                      |+|+|+||.|||+||++|   +.||||||+|||+|+| |++++|+...+|+||||++|+|+|++|||||+||||   +|+
T Consensus         1 C~~~n~ti~vEk~~C~~c---~~i~TTiC~G~C~T~d-pv~~~~~~~~~Q~vCtY~~~~Y~tv~lpgCp~gvdp---~~t   73 (102)
T cd00069           1 CRPTNITIAVEKEECPVC---VTINTTICAGYCYTKD-PVYKSPLSPLPQRVCTYRELSYETVRLPGCPPGVDP---GVT   73 (102)
T ss_pred             CcceeEEEEEeeCCCCce---EEEEeeeEccCccccc-ccccccCCCcccCcccCCcEEEEEEECCCCcCCCCC---CEE
Confidence            899999999999999999   9999999999999995 999999999999999999999999999999999999   999


Q ss_pred             EeeeeceecCCCCCCCCccccccCccc
Q psy1560         143 YLEALSCKCSVCKSSEASCEGLRYSSY  169 (175)
Q Consensus       143 YPvAlSC~C~~C~t~~TdC~~~~~~~~  169 (175)
                      ||||+||+|++|++++|||+.++.+++
T Consensus        74 YPVAlsC~C~~C~t~~tdC~~~~~~~~  100 (102)
T cd00069          74 YPVALSCHCGKCNTDTTDCTVLSLGPP  100 (102)
T ss_pred             eeeecccccCCcCCCCccccccCCCCC
Confidence            999999999999999999999988764


No 3  
>PF00007 Cys_knot:  Cystine-knot domain;  InterPro: IPR006208 This domain is found at the C-terminal of glycoprotein hormones and various extracellular proteins. It is believed to be involved in disulphide-linked dimerisation. ; PDB: 1QFW_B 1HRP_B 1HCN_B 1XWD_B 1FL7_B.
Probab=99.95  E-value=1.4e-28  Score=184.27  Aligned_cols=102  Identities=25%  Similarity=0.485  Sum_probs=90.0

Q ss_pred             CCceeeeeeEEEEecCCCCCccceeEEEeeeeeecccCCCCCCCCCCCCCCCCCcccCceEEEEEEeCCCCCCccCCeee
Q psy1560          61 LDCHRRVYKYRVSQTDSLGRKCWDDIEVLSCWGRCDSNETSDWRFPYKRSHHPVCQHGARALKVVILNNCEENVEQGTEV  140 (175)
Q Consensus        61 ~~C~l~n~Ti~VEk~dC~~c~C~~~I~Tt~C~G~C~T~e~p~~~~P~~~s~Q~VCty~~~~y~tv~LpgC~~gVdP~~~~  140 (175)
                      ++|++++++|.||++||..+   ..|++++|||+|+|++ +++++|++..+|.+|++.++.++++.|+|||+|+||   .
T Consensus         2 ~~C~~~~~ti~ve~~gC~s~---~~v~~~~C~G~C~s~~-~~~~~~~~~~~~~~Cc~~~~~~~~~v~~~C~~G~~~---~   74 (105)
T PF00007_consen    2 PGCHLTNVTIKVEKSGCRSC---KTVNTTYCSGYCESSE-PYSKDPRKFQSQCVCCYPERTYETVVLLGCPDGVDP---T   74 (105)
T ss_dssp             BBSEEEEEEEEEEECCCTEE---EEEEEEEEEEEEEEE---SCTTTTT----EEEEEEEEEEEEEEETTBTTCS-E---E
T ss_pred             CCCeEeeeEEEEEeCCCCCc---eEEEEEEEEEEecCCe-EecccCCcCcccCcCCCcceEEEEEECCCCccCCcc---e
Confidence            57999999999999999987   8999999999999998 999999999999999999999999999999999999   8


Q ss_pred             EEEeeeeceecCCCCCCCCccccccCccc
Q psy1560         141 YRYLEALSCKCSVCKSSEASCEGLRYSSY  169 (175)
Q Consensus       141 ytYPvAlSC~C~~C~t~~TdC~~~~~~~~  169 (175)
                      |+||+|+||+|+.|+++++||++++....
T Consensus        75 ~~y~~a~sC~C~~C~~~~t~c~~~~~~~~  103 (105)
T PF00007_consen   75 FTYPVATSCSCSNCNTDTTDCTRRSLSPS  103 (105)
T ss_dssp             EEEEEEEEEEEEEEETTTEEEESS-SSTT
T ss_pred             EEeeEeeeeeCCCCCCCcccccCccCCCC
Confidence            99999999999999999999999887653


No 4  
>PF03045 DAN:  DAN domain;  InterPro: IPR004133 This domain contains 9 conserved cysteines and is extracellular. Therefore the cysteines may form disulphide bridges. This family of proteins has been termed the DAN family [] after the first member to be reported. This family includes DAN, Cerberus and Gremlin. The gremlin protein is an antagonist of bone morphogenetic protein signalling. It is postulated that all members of this family antagonize different TGF beta TGF-beta ligands [].
Probab=98.58  E-value=3.7e-07  Score=70.88  Aligned_cols=96  Identities=19%  Similarity=0.213  Sum_probs=78.1

Q ss_pred             hcCCCCCCCceeeeeeEEEEecCCCCCccceeEEEeeeeeecccCCCCCCCCCCC----CCCCCCcccCceEEEEEEeCC
Q psy1560          54 AANQDITLDCHRRVYKYRVSQTDSLGRKCWDDIEVLSCWGRCDSNETSDWRFPYK----RSHHPVCQHGARALKVVILNN  129 (175)
Q Consensus        54 ~~~~~~~~~C~l~n~Ti~VEk~dC~~c~C~~~I~Tt~C~G~C~T~e~p~~~~P~~----~s~Q~VCty~~~~y~tv~Lpg  129 (175)
                      .........|+.++|+-.|..+||...    .|....|.|+|.|+-+|.......    ...=..|...+++..+|+|. 
T Consensus        21 ~~~~~~~~~Ck~~p~~Q~I~~~GC~s~----~I~N~~C~GqC~S~~iP~~~~~~~~~~~~~~C~~C~P~~~~~~~V~L~-   95 (121)
T PF03045_consen   21 KLQPLKRDWCKTVPFTQVISHPGCESV----TIQNNFCFGQCSSFYIPSSVPSDPGSQPFQSCSCCQPSRFRWVTVTLR-   95 (121)
T ss_pred             cccccccCccEEEeeEEEECcCCceEE----EEEeeeeEEEcceEEeeCCcccccccccCcccCccCCCeeEEEEEEEE-
Confidence            334557889999999999999999995    999999999999998887643221    23345599999999999995 


Q ss_pred             CCCCccCCeeeEEEeeeeceecCCCC
Q psy1560         130 CEENVEQGTEVYRYLEALSCKCSVCK  155 (175)
Q Consensus       130 C~~gVdP~~~~ytYPvAlSC~C~~C~  155 (175)
                      ||.+..+. ++-.+..+.+|+|..|+
T Consensus        96 C~~~~~~~-~~k~v~~v~~C~C~~~~  120 (121)
T PF03045_consen   96 CPGGSPPF-RVKRVQIVEECSCSSCS  120 (121)
T ss_pred             CcCCCCCc-ceEEEEEeeecccCccc
Confidence            99987663 24678999999999986


No 5  
>smart00041 CT C-terminal cystine knot-like domain (CTCK). The structures of transforming growth factor-beta (TGFbeta), nerve growth factor (NGF), platelet-derived growth factor (PDGF) and gonadotropin all form 2 highly twisted antiparallel pairs of beta-strands and contain three disulphide bonds. The domain is non-globular and little is conserved among these presumed homologues except for their cysteine residues. CT domains are predicted to form homodimers.
Probab=97.90  E-value=5.7e-05  Score=54.52  Aligned_cols=77  Identities=14%  Similarity=0.259  Sum_probs=60.6

Q ss_pred             eeeEEEEecCCCCCccceeEEEeeeeeecccCCCCCCCCCCCCCCCCCcccCceEEEEEEeCCCCCCccCCeeeEEEeee
Q psy1560          67 VYKYRVSQTDSLGRKCWDDIEVLSCWGRCDSNETSDWRFPYKRSHHPVCQHGARALKVVILNNCEENVEQGTEVYRYLEA  146 (175)
Q Consensus        67 n~Ti~VEk~dC~~c~C~~~I~Tt~C~G~C~T~e~p~~~~P~~~s~Q~VCty~~~~y~tv~LpgC~~gVdP~~~~ytYPvA  146 (175)
                      .+...++.+||...    .|..+.|.|.|.++-+++...++  ..-..|.-.+++.+.|+| .||+|-.   ..+.|..+
T Consensus         3 ~~~q~i~~~gC~s~----~v~~~~C~G~C~s~~~~~~~~~~--~~c~CC~p~~~~~~~v~l-~C~dg~~---~~~~v~~i   72 (82)
T smart00041        3 PVRQTITYNGCTSV----TVKNAFCEGKCGSASSYSIQDVQ--HSCSCCQPHKTKTRQVRL-RCPDGST---VKKTVMHI   72 (82)
T ss_pred             ceEEEEEeCCceEe----EEEcCcEEeECCCeeEcCccccc--cCCCccCCceeEEEEEEE-ECCCCCE---EEEEEEEE
Confidence            45667778889886    49999999999887666553222  114689999999999999 5998853   46899999


Q ss_pred             eceecCC
Q psy1560         147 LSCKCSV  153 (175)
Q Consensus       147 lSC~C~~  153 (175)
                      .+|.|..
T Consensus        73 ~~C~C~~   79 (82)
T smart00041       73 EECGCEP   79 (82)
T ss_pred             Eeccccc
Confidence            9999976


No 6  
>PF05463 Sclerostin:  Sclerostin (SOST);  InterPro: IPR008835 This family contains several mammalian sclerostin (SOST) proteins. SOST is thought to suppress bone formation. Mutations of the SOST gene lead to sclerosteosis, a progressive sclerosing bone dysplasia with an autosomal recessive mode of inheritance. Radiologically, it is characterised by a generalised hyperostosis and sclerosis leading to a markedly thickened and sclerotic skull, with mandible, ribs, clavicles and all long bones also being affected. Due to narrowing of the foramina of the cranial nerves, facial nerve palsy, hearing loss and atrophy of the optic nerves can occur. Sclerosteosis is clinically and radiologically very similar to van Buchem disease, mainly differentiated by hand malformations and a large stature in sclerosteosis patients [].; GO: 0005615 extracellular space; PDB: 2KD3_A 3SOV_Z 2K8P_A.
Probab=96.32  E-value=0.018  Score=48.89  Aligned_cols=90  Identities=20%  Similarity=0.364  Sum_probs=56.5

Q ss_pred             CCCCCCceeeeeeEEEEecCCCCCccceeEEEeeeeeecccCCC-CCCCCCCC-CCCCCC----cccCceEEEEEEeCCC
Q psy1560          57 QDITLDCHRRVYKYRVSQTDSLGRKCWDDIEVLSCWGRCDSNET-SDWRFPYK-RSHHPV----CQHGARALKVVILNNC  130 (175)
Q Consensus        57 ~~~~~~C~l~n~Ti~VEk~dC~~c~C~~~I~Tt~C~G~C~T~e~-p~~~~P~~-~s~Q~V----Cty~~~~y~tv~LpgC  130 (175)
                      .....+|+--.+|-+|..--|..-   -.|.--.|+|.|..... |.|+.--+ ++.+.+    |.-+..+.+.|+|. |
T Consensus        62 ~~~~~~CrELrstrYisdG~C~S~---kPikelvCsGqClP~~llPn~Ig~~k~W~R~~~~e~RCv~d~~RtqrVqL~-C  137 (198)
T PF05463_consen   62 DASQVGCRELRSTRYISDGQCRSA---KPIKELVCSGQCLPAHLLPNWIGRGKYWWRRSAQEWRCVPDHTRTQRVQLQ-C  137 (198)
T ss_dssp             TTTTTSS-CEEEEE--EETTEEES---S-EEEEEE----S-----TTSTTSSS-SSSSS------EEEEEEEEEEEEE--
T ss_pred             CcccCccceeeeeeeeecCccccc---CchhhheeeccccccccCcccccccceecccCCCcccccCCcceeEEEEEE-C
Confidence            346788999999999988666665   78999999999997764 66655333 333333    99899999999995 9


Q ss_pred             CCCccCCeeeEEEeeeeceecCC
Q psy1560         131 EENVEQGTEVYRYLEALSCKCSV  153 (175)
Q Consensus       131 ~~gVdP~~~~ytYPvAlSC~C~~  153 (175)
                      |+|.-   ++|-.-|..||+|..
T Consensus       138 ~dG~t---RTyKI~vVtSCKCKR  157 (198)
T PF05463_consen  138 PDGTT---RTYKIRVVTSCKCKR  157 (198)
T ss_dssp             TTTSS---EEEEEEEEEEEE---
T ss_pred             CCCCe---eEEEEEEEEEeeecc
Confidence            99954   589999999999975


No 7  
>PF00019 TGF_beta:  Transforming growth factor beta like domain;  InterPro: IPR001839 Transforming growth factor-beta (TGF-beta) is a multifunctional peptide that controls proliferation, differentiation and other functions in many cell types. TGF-beta-1 is a peptide of 112 amino acid residues derived by proteolytic cleavage from the C-terminal of a precursor protein []. A number of proteins are known to be related to TGF-beta-1 [, ]. Proteins from the TGF-beta family are only active as homo- or heterodimer; the two chains being linked by a single disulphide bond. From X-ray studies of TGF-beta-2 [], it is known that all the other cysteines are involved in intrachain disulphide bonds. There are four disulphide bonds in the TGF-beta's and in inhibin beta chains, while the other members of this family lack the first bond. The regulatory cytokine TGFbeta exerts tumour-suppressive effects, but also modulates cell invasion and immune regulation []. Misregulation of the TGF-beta signalling pathway can result in tumour development. ; GO: 0008083 growth factor activity; PDB: 2QCQ_B 2QCW_B 2R53_A 2R52_A 1M4U_L 1BMP_A 1LX5_A 1LXI_A 3FUB_B 2V5E_B ....
Probab=79.95  E-value=3.3  Score=30.55  Aligned_cols=84  Identities=15%  Similarity=0.286  Sum_probs=51.7

Q ss_pred             CceeeeeeEEEEecCCCCCccc----eeEEEeeeeeecccCCCCCCCCC-------------CCCCCCCCcccCceEEEE
Q psy1560          62 DCHRRVYKYRVSQTDSLGRKCW----DDIEVLSCWGRCDSNETSDWRFP-------------YKRSHHPVCQHGARALKV  124 (175)
Q Consensus        62 ~C~l~n~Ti~VEk~dC~~c~C~----~~I~Tt~C~G~C~T~e~p~~~~P-------------~~~s~Q~VCty~~~~y~t  124 (175)
                      .|.++.+.|..+.-+=+.   |    ..++...|.|.|...-.....++             -....++.|...+....+
T Consensus         3 ~Cc~~~~~v~F~~lGw~~---wIi~P~~~~~~~C~G~C~~~~~~~~~~~~ha~~~~~~~~~~~~~~~~pCC~P~~~~~l~   79 (105)
T PF00019_consen    3 RCCRRSLYVNFKDLGWDD---WIIAPEGYNANYCSGSCPFPLSNHNNHSNHAILQSLMHSLNPRSVPQPCCVPTKYSPLS   79 (105)
T ss_dssp             BSEEEEEEEECTCTTSTT---TEEESSEEEEEEEESBSCSSSSCGCHHHHHHHHHHHHHHHSTTTSTS-EEEEEEEEEEE
T ss_pred             cceeEEEEEEhhhcCCce---eEeccCccccccccceecccccccccccccccccccccccccccccCCcEeeeeeceEE
Confidence            588887777764322110   1    27899999999996532111111             135678999988777777


Q ss_pred             EEeCCCCCCccCCeeeEEEe--eeeceecC
Q psy1560         125 VILNNCEENVEQGTEVYRYL--EALSCKCS  152 (175)
Q Consensus       125 v~LpgC~~gVdP~~~~ytYP--vAlSC~C~  152 (175)
                      +..-+  .  +-.+.+-+||  +|++|.|+
T Consensus        80 il~~~--~--~~~i~~~~~~~m~v~~CgC~  105 (105)
T PF00019_consen   80 ILYLD--E--DGNIVLKTLPNMIVKECGCS  105 (105)
T ss_dssp             EEEEE--T--TSEEEEEEEEEEEEEEEEEE
T ss_pred             EEEEE--C--CCcEEEEEeCCEEecccccC
Confidence            73331  1  2224466777  99999984


No 8  
>PF00236 Hormone_6:  Glycoprotein hormone;  InterPro: IPR000476 Glycoprotein hormones [, ] (or gonadotropins) are a family of proteins, which include the mammalian hormones follitropin (FSH), lutropin (LSH), thyrotropin (TSH) placental chorionic gonadotropins hCG and eCG [] and chorionic gonadotropin (CG), as well as at least two forms of fish gonadotropins. These hormones are central to the complex endocrine system that regulates normal growth, sexual development, and reproductive function []. The hormones LH, FSH and TSH are secreted by the anterior pituitary gland, while hCG and eCG are secreted by the placenta []. All these hormones consist of two glycosylated chains (alpha and beta). The alpha subunit is common to each protein dimer (well conserved within species, but differing between them []), and a unique beta subunit, which confers biological specificity []. The alpha chains are highly conserved proteins of about 100 amino acid residues which contain ten conserved cysteines all involved in disulphide bonds [], as shown in the following schematic representation.  +---------------------------+ +----------+| +-------------|--+ | || | | | xxxxCxCxxxxxxCxCCxxxxxxxxxxxxxCCxxxxxxxxxxCxCxxCx | | | | +------|-----------------+ | | | +----------------------------+ 'C': conserved cysteine involved in a disulphide bond.  Intracellular levels of free alpha subunits are greater than those of the mature glycoprotein, implying that hormone assembly is limited by the appearance of the specific beta subunits, and hence that synthesis of alpha and beta is independently regulated [].; GO: 0005179 hormone activity, 0005576 extracellular region; PDB: 1HD4_A 1QFW_A 1XWD_D 1DZ7_A 1HCN_A 1E9J_A 1HRP_A 1FL7_A.
Probab=66.22  E-value=1.8  Score=33.11  Aligned_cols=56  Identities=23%  Similarity=0.388  Sum_probs=35.3

Q ss_pred             EeeeeeecccCCCCCCCC-------C-CCCCCCCCcccCceEEEEEEeCCCCCCccCCeeeEEEeeeeceecCCCC
Q psy1560          88 VLSCWGRCDSNETSDWRF-------P-YKRSHHPVCQHGARALKVVILNNCEENVEQGTEVYRYLEALSCKCSVCK  155 (175)
Q Consensus        88 Tt~C~G~C~T~e~p~~~~-------P-~~~s~Q~VCty~~~~y~tv~LpgC~~gVdP~~~~ytYPvAlSC~C~~C~  155 (175)
                      +..|.|.|+|++.|....       | ..+|.-..|+.+.+...+|  .|   +       ...-.-..|+|+.|-
T Consensus        29 iyQC~GCCFSrAYPTP~rskktM~vpKNITSEAtCCVAk~~~~v~v--~~---~-------~~v~NHTeChCsTCy   92 (96)
T PF00236_consen   29 IYQCMGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAKSSTRVTV--MG---N-------IKVENHTECHCSTCY   92 (96)
T ss_dssp             EEEEEEEEEEEEEE-SHHHHTSSSSSSSEEEEEEEEEEEEEEEEEE--TT---T-------EEEEEEEEEEEEESS
T ss_pred             eeEeeeeeeccccCCchhhhhhccCCccccceeeEEEeeeeeEEEE--ec---c-------eEEeeccccccCcee
Confidence            688999999999765221       2 2345566788666554433  21   1       223556799999995


No 9  
>smart00067 GHA Glycoprotein hormone alpha chain homologues. Also called gonadotropins. Glycoprotein hormones consist of two glycosylated chains (alpha and beta) of similar topology.
Probab=58.63  E-value=17  Score=27.33  Aligned_cols=57  Identities=23%  Similarity=0.378  Sum_probs=35.7

Q ss_pred             EEeeeeeecccCCCCCCCC-------C-CCCCCCCCcccCceEEEEEEeCCCCCCccCCeeeEEEeeeeceecCCCC
Q psy1560          87 EVLSCWGRCDSNETSDWRF-------P-YKRSHHPVCQHGARALKVVILNNCEENVEQGTEVYRYLEALSCKCSVCK  155 (175)
Q Consensus        87 ~Tt~C~G~C~T~e~p~~~~-------P-~~~s~Q~VCty~~~~y~tv~LpgC~~gVdP~~~~ytYPvAlSC~C~~C~  155 (175)
                      -+.-|.|-|+|+..|....       | ..+|....|.-+.....++ ..    +       +..-.-..|+|+.|-
T Consensus        19 PiyQC~GCCFSrAYPTPlrskktM~vpKNITSEAtCCVAk~~~~v~v-~~----~-------~~v~NHT~ChCsTCy   83 (87)
T smart00067       19 PIYQCMGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAKEFYRVTV-MD----N-------IKVENHTECHCSTCY   83 (87)
T ss_pred             ceeEecceecccccCCchhhhhccccCccccCceeEEEecccEEEEE-eC----C-------cEEeeccccccccee
Confidence            3578999999999775221       2 2456667788665433333 22    1       223566789999984


No 10 
>PF13956 Ibs_toxin:  Toxin Ibs, type I toxin-antitoxin system
Probab=50.90  E-value=5.3  Score=22.24  Aligned_cols=16  Identities=25%  Similarity=0.320  Sum_probs=10.5

Q ss_pred             HHHHHHHHHHHHHHhh
Q psy1560          38 MLQSTIGFTLLLFSYC   53 (175)
Q Consensus        38 ~mqlvv~a~ll~~~~~   53 (175)
                      ||.+++.+.+|++.+.
T Consensus         1 MMk~vIIlvvLLliSf   16 (19)
T PF13956_consen    1 MMKLVIILVVLLLISF   16 (19)
T ss_pred             CceehHHHHHHHhccc
Confidence            5777887776665443


No 11 
>smart00204 TGFB Transforming growth  factor-beta (TGF-beta) family. Family members are active as disulphide-linked homo- or heterodimers. TGFB is a multifunctional peptide that controls proliferation,  differentiation, and other functions in many cell types.
Probab=39.48  E-value=1.4e+02  Score=22.10  Aligned_cols=83  Identities=14%  Similarity=0.308  Sum_probs=48.3

Q ss_pred             ceeeeeeEEEEecCCCCCccc----eeEEEeeeeeecccCCCCCCCCC-------------CCCCCCCCcccCceEEEEE
Q psy1560          63 CHRRVYKYRVSQTDSLGRKCW----DDIEVLSCWGRCDSNETSDWRFP-------------YKRSHHPVCQHGARALKVV  125 (175)
Q Consensus        63 C~l~n~Ti~VEk~dC~~c~C~----~~I~Tt~C~G~C~T~e~p~~~~P-------------~~~s~Q~VCty~~~~y~tv  125 (175)
                      |.++.++|..+.-+=..   |    -..+..-|.|.|...-.+.....             .....++.|...+....++
T Consensus         1 Ccr~~l~VdF~~iGW~~---wIiaP~~y~a~yC~G~C~~~~~~~~~~~~Ha~i~~~~~~~~~~~~~~pCC~P~~~~~l~~   77 (102)
T smart00204        1 CRRRQLYVDFKDLGWDD---WIIAPKGYNAYYCEGECPFPLSTSLNATNHAIVQTLVHLLGPNPVPKPCCVPTKLSPLSM   77 (102)
T ss_pred             CceeEEEEEHhhcCCcc---eEEcCCceeeeEEeeeCCCCcccccCCcchhhhhhhHHhcCCCCCCCCCccCceEecEEE
Confidence            55555555554322211   1    24688999999986532211110             0124578899888777777


Q ss_pred             EeCCCCCCccCCeeeEEEe--eeeceecC
Q psy1560         126 ILNNCEENVEQGTEVYRYL--EALSCKCS  152 (175)
Q Consensus       126 ~LpgC~~gVdP~~~~ytYP--vAlSC~C~  152 (175)
                      ..-+  .+  -.+.+.+||  +|.+|.|+
T Consensus        78 ly~~--~~--~~i~~~~~~~Mvv~~CgC~  102 (102)
T smart00204       78 LYYD--DD--GNVVLRNYPNMVVEECGCR  102 (102)
T ss_pred             EEEe--CC--CcEEEEEcCCCEEeeeeeC
Confidence            6531  11  134567788  99999995


No 12 
>PF11803 UXS1_N:  UDP-glucuronate decarboxylase N-terminal;  InterPro: IPR021761  The N terminus of the UDP-glucuronate decarboxylases may be involved in localisation to the perinuclear Golgi membrane. ; GO: 0048040 UDP-glucuronate decarboxylase activity
Probab=30.69  E-value=40  Score=25.00  Aligned_cols=24  Identities=17%  Similarity=0.343  Sum_probs=16.9

Q ss_pred             cCCchhHHHHHHHHHHHHHHHhhhc
Q psy1560          31 TGHKRLIMLQSTIGFTLLLFSYCAA   55 (175)
Q Consensus        31 ~~~~~~~~mqlvv~a~ll~~~~~~~   55 (175)
                      .|++|- ||.+++++++++....-+
T Consensus        11 ~~~NRr-~mkll~~lal~ayiasvw   34 (78)
T PF11803_consen   11 SGCNRR-RMKLLLGLALIAYIASVW   34 (78)
T ss_pred             HHhhHH-HHHHHHHHHHHHHHHHHH
Confidence            688887 688888777766544444


No 13 
>PF02084 Bindin:  Bindin;  InterPro: IPR000775 Bindin, the major protein component of the acrosome granule of sea urchin sperm, mediates species-specific adhesion of sperm to the egg surface during fertilisation [, ]. The protein coats the acrosomal process after externalisation by the acrosome reaction; it binds to sulphated, fucose-containing polysaccharides on the vitelline-layer receptor proteoglycans that cover the egg plasma membrane. Bindins from different genera show high levels of sequence similarity in both the mature bindin domain and in the probindin precursor region. The most highly conserved region is a 42-residue segment in the central portion of the mature bindin protein. This domain may be responsible for conserved functions of bindin, while the more highly divergent flanking regions may be responsible for its species-specific properties [].; GO: 0007342 fusion of sperm to egg plasma membrane
Probab=30.13  E-value=27  Score=30.70  Aligned_cols=10  Identities=70%  Similarity=0.963  Sum_probs=4.9

Q ss_pred             hhHHHHHhhh
Q psy1560          19 EEEEEEEEAC   28 (175)
Q Consensus        19 ~~~~~~~~~~   28 (175)
                      ||||||++|+
T Consensus       163 eeeEEe~DAa  172 (238)
T PF02084_consen  163 EEEEEEQDAA  172 (238)
T ss_pred             hHHHHHHHHh
Confidence            4444555554


No 14 
>PRK06411 NADH dehydrogenase subunit B; Validated
Probab=27.07  E-value=49  Score=27.88  Aligned_cols=20  Identities=15%  Similarity=0.067  Sum_probs=14.5

Q ss_pred             ccCceEEEEEEeCCCCCCcc
Q psy1560         116 QHGARALKVVILNNCEENVE  135 (175)
Q Consensus       116 ty~~~~y~tv~LpgC~~gVd  135 (175)
                      ...+....-+.+|||||..+
T Consensus       127 gv~~~ipVDv~IPGCPP~Pe  146 (183)
T PRK06411        127 GVDRIVPVDVYVPGCPPRPE  146 (183)
T ss_pred             CcccccccceEeCCCCCCHH
Confidence            34455566689999999854


No 15 
>PF01058 Oxidored_q6:  NADH ubiquinone oxidoreductase, 20 Kd subunit;  InterPro: IPR006137  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. Among the many polypeptide subunits that make up complex I, there is one with a molecular weight of 20 kDa (in mammals) [], which is a component of the iron-sulphur (IP) fragment of the enzyme. It seems to bind a 4Fe-4S iron-sulphur cluster. The 20 kDa subunit has been found to be nuclear encoded, as a precursor form with a transit peptide in mammals, and in Neurospora crassa. It is and chloroplast encoded in various higher plants (gene ndhK or psbG).; GO: 0008137 NADH dehydrogenase (ubiquinone) activity, 0048038 quinone binding, 0051539 4 iron, 4 sulfur cluster binding, 0055114 oxidation-reduction process; PDB: 3MYR_E 3RGW_S 2FUG_F 3IAS_6 3I9V_F 3IAM_F 2YBB_6 3M9S_F 2FRV_G 1YQ9_B ....
Probab=24.68  E-value=29  Score=26.77  Aligned_cols=15  Identities=7%  Similarity=0.189  Sum_probs=8.2

Q ss_pred             EEEEEEeCCCCCCcc
Q psy1560         121 ALKVVILNNCEENVE  135 (175)
Q Consensus       121 ~y~tv~LpgC~~gVd  135 (175)
                      ....+.||||||+-|
T Consensus       108 ~~VDi~IpGCPp~pd  122 (131)
T PF01058_consen  108 VPVDINIPGCPPHPD  122 (131)
T ss_dssp             S-ECEEE-SSS--HH
T ss_pred             ccEEEEeeCCCCCHH
Confidence            344489999999865


No 16 
>TIGR01957 nuoB_fam NADH-quinone oxidoreductase, B subunit. This model describes the B chain of complexes that resemble NADH-quinone oxidoreductases. The electron acceptor is a quinone, ubiquinone, in mitochondria and most bacteria, including Escherichia coli, where the recommended gene symbol is nuoB. The quinone is plastoquinone in Synechocystis (where the chain is designated K) and in chloroplast, where NADH may be replaced by NADPH. In the methanogenic archaeal genus Methanosarcina, NADH is replaced by F420H2.
Probab=24.30  E-value=58  Score=26.32  Aligned_cols=20  Identities=15%  Similarity=0.084  Sum_probs=14.3

Q ss_pred             ccCceEEEEEEeCCCCCCcc
Q psy1560         116 QHGARALKVVILNNCEENVE  135 (175)
Q Consensus       116 ty~~~~y~tv~LpgC~~gVd  135 (175)
                      ..++....-+.+|||||..+
T Consensus       110 ~v~~~ipVDi~IPGCPp~Pe  129 (145)
T TIGR01957       110 GVDRIVPVDVYIPGCPPRPE  129 (145)
T ss_pred             CcccccccceEeCCCCCCHH
Confidence            33455566689999999854


No 17 
>PF13617 Lipoprotein_19:  YnbE-like lipoprotein
Probab=23.91  E-value=1.7e+02  Score=20.41  Aligned_cols=16  Identities=19%  Similarity=0.258  Sum_probs=10.4

Q ss_pred             CCceeeeeeEEEEecCCCC
Q psy1560          61 LDCHRRVYKYRVSQTDSLG   79 (175)
Q Consensus        61 ~~C~l~n~Ti~VEk~dC~~   79 (175)
                      .+|.|   |+.|+-++-+-
T Consensus        14 ~gCtP---tV~v~aP~~PI   29 (59)
T PF13617_consen   14 TGCTP---TVKVEAPDKPI   29 (59)
T ss_pred             ccCCC---eEEeecCCCCE
Confidence            45766   67777777554


No 18 
>PF15069 FAM163:  FAM163 family
Probab=23.85  E-value=18  Score=29.57  Aligned_cols=16  Identities=56%  Similarity=1.178  Sum_probs=11.1

Q ss_pred             hhhhch----hchhhhHHHH
Q psy1560           9 LLTYCK----DCKKEEEEEE   24 (175)
Q Consensus         9 ~~~~~~----~~~~~~~~~~   24 (175)
                      +|=||.    =|||+|+|++
T Consensus        24 VLCYCRLQYYCCKK~~se~~   43 (143)
T PF15069_consen   24 VLCYCRLQYYCCKKNESEED   43 (143)
T ss_pred             HHHHHhhHHHHhhccCCccc
Confidence            456776    7999766655


No 19 
>PF06880 DUF1262:  Protein of unknown function (DUF1262);  InterPro: IPR010683 This family represents a conserved region within a number of proteins of unknown function that seem to be specific to Arabidopsis thaliana. Note that some family members contain more than one copy of this region.
Probab=23.81  E-value=1e+02  Score=23.93  Aligned_cols=19  Identities=26%  Similarity=0.749  Sum_probs=14.5

Q ss_pred             EeeeeeecccCCCCCCCCC
Q psy1560          88 VLSCWGRCDSNETSDWRFP  106 (175)
Q Consensus        88 Tt~C~G~C~T~e~p~~~~P  106 (175)
                      -|.|||.|....+..+.||
T Consensus        19 ~t~CfG~c~~~~v~~LPFP   37 (104)
T PF06880_consen   19 ETCCFGLCKDTRVRGLPFP   37 (104)
T ss_pred             ccEEeeEcCCCccccCCCC
Confidence            4689999998876655555


No 20 
>PRK14816 NADH dehydrogenase subunit B; Provisional
Probab=23.53  E-value=61  Score=27.39  Aligned_cols=19  Identities=16%  Similarity=0.086  Sum_probs=14.4

Q ss_pred             cCceEEEEEEeCCCCCCcc
Q psy1560         117 HGARALKVVILNNCEENVE  135 (175)
Q Consensus       117 y~~~~y~tv~LpgC~~gVd  135 (175)
                      .++....-+.+|||||..+
T Consensus       135 vd~vIpVDv~IPGCPP~Pe  153 (182)
T PRK14816        135 VDKILPVDVYIPGCPPRPE  153 (182)
T ss_pred             ccccccccEEeeCcCCCHH
Confidence            3455666799999999854


No 21 
>COG1177 PotC ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism]
Probab=20.75  E-value=1.3e+02  Score=26.35  Aligned_cols=17  Identities=29%  Similarity=0.223  Sum_probs=14.0

Q ss_pred             HHHHhhhHhcCCchhHH
Q psy1560          22 EEEEEACYDTGHKRLIM   38 (175)
Q Consensus        22 ~~~~~~~~~~~~~~~~~   38 (175)
                      .+-|||++|+|-++.-.
T Consensus       163 ~~LeeAA~dLGAs~~~~  179 (267)
T COG1177         163 RSLEEAARDLGASPWQT  179 (267)
T ss_pred             hHHHHHHHHcCCCHHHH
Confidence            36689999999998765


No 22 
>COG1740 HyaA Ni,Fe-hydrogenase I small subunit [Energy production and conversion]
Probab=20.17  E-value=93  Score=28.93  Aligned_cols=45  Identities=16%  Similarity=0.190  Sum_probs=25.8

Q ss_pred             EeeeeeecccCC-CCCCCCCCCCCCCCCcccCceE--EEEEEeCCCCCCccC
Q psy1560          88 VLSCWGRCDSNE-TSDWRFPYKRSHHPVCQHGARA--LKVVILNNCEENVEQ  136 (175)
Q Consensus        88 Tt~C~G~C~T~e-~p~~~~P~~~s~Q~VCty~~~~--y~tv~LpgC~~gVdP  136 (175)
                      .-+=+|.|-||- ++--+ |.   ........++.  +-++.|||||++-|-
T Consensus       150 aIiAvGtCAs~GgI~AA~-pn---ps~a~~i~ev~~~kpVINiPGCPp~pd~  197 (355)
T COG1740         150 AIIAVGTCASWGGIQAAK-PN---PTGAGPLSEVIKDKPVINIPGCPPNPDW  197 (355)
T ss_pred             eEEEEecccccCCeeccC-CC---CCCcccceecccCCceeeCCCCCCCchh
Confidence            345689999986 22111 21   11222223333  678999999998663


Done!