Query         psy15602
Match_columns 72
No_of_seqs    61 out of 63
Neff          2.5 
Searched_HMMs 46136
Date          Fri Aug 16 16:53:44 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15602.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15602hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1048|consensus               99.5 1.5E-14 3.2E-19  120.6   3.1   52    1-72    577-628 (717)
  2 smart00185 ARM Armadillo/beta-  89.7    0.38 8.2E-06   24.2   2.2   17    2-18     24-40  (41)
  3 PF00514 Arm:  Armadillo/beta-c  85.1     1.1 2.4E-05   23.6   2.4   17    2-18     24-40  (41)
  4 cd00020 ARM Armadillo/beta-cat  72.5     7.3 0.00016   22.4   3.4   21    2-22     61-81  (120)
  5 PF04826 Arm_2:  Armadillo-like  56.5      13 0.00028   27.5   2.9   24    4-27    109-132 (254)
  6 PF05804 KAP:  Kinesin-associat  55.3      21 0.00047   30.6   4.3   27    2-28    302-328 (708)
  7 TIGR00094 tRNA_TruD_broad tRNA  54.9       3 6.5E-05   31.9  -0.7   19   37-55    362-383 (387)
  8 PRK00984 truD tRNA pseudouridi  54.3     3.1 6.8E-05   32.0  -0.7   19   37-55    317-338 (341)
  9 KOG4646|consensus               51.4      18 0.00038   26.9   2.9   27    2-28     70-96  (173)
 10 cd02576 PseudoU_synth_ScPUS7 P  51.4     5.1 0.00011   30.5   0.1   17   37-53    351-370 (371)
 11 PF04063 DUF383:  Domain of unk  46.0      18 0.00038   26.0   2.1   20    8-27    121-140 (192)
 12 cd07909 YciF YciF bacterial st  43.4      92   0.002   21.6   5.3   47   10-56     18-77  (147)
 13 KOG4224|consensus               42.9      21 0.00046   30.3   2.4   28    2-29    263-290 (550)
 14 cd02575 PseudoU_synth_EcTruD P  42.9     5.2 0.00011   30.1  -1.0   17   37-53    233-252 (253)
 15 cd02552 PseudoU_synth_TruD_lik  35.5      13 0.00028   27.3   0.1   17   37-53    212-231 (232)
 16 KOG1048|consensus               33.5      30 0.00064   30.3   1.9   22    2-23    287-308 (717)
 17 PF05804 KAP:  Kinesin-associat  30.8      77  0.0017   27.3   3.9   27    2-28    343-369 (708)
 18 PF12290 DUF3802:  Protein of u  29.8      73  0.0016   22.2   3.0   33   25-57     10-42  (113)
 19 PF11320 DUF3122:  Protein of u  28.0      49  0.0011   23.3   2.0   29   33-61     77-105 (134)
 20 PF07565 Band_3_cyto:  Band 3 c  27.8      75  0.0016   23.8   3.0   42    5-48    208-254 (257)
 21 PF04826 Arm_2:  Armadillo-like  27.2      99  0.0021   22.9   3.6   33    3-35     67-99  (254)
 22 KOG4500|consensus               26.6      46   0.001   28.8   1.9   25    3-27    374-398 (604)
 23 KOG4224|consensus               24.6      97  0.0021   26.5   3.4   27    2-28    346-373 (550)
 24 PF08919 F_actin_bind:  F-actin  24.4 1.2E+02  0.0025   20.6   3.2   22   37-58     51-72  (110)
 25 COG4704 Uncharacterized protei  22.7      20 0.00044   26.1  -0.7   11   42-52     83-93  (151)
 26 PF09912 DUF2141:  Uncharacteri  21.8      24 0.00053   22.9  -0.5   10   42-51     49-58  (112)
 27 COG2093 DNA-directed RNA polym  21.7      18  0.0004   23.1  -1.0    8   44-51     55-62  (64)
 28 PF14347 DUF4399:  Domain of un  20.7      19 0.00042   23.1  -1.1   16   38-53     54-69  (87)
 29 PF08664 YcbB:  YcbB domain;  I  20.2      92   0.002   21.7   2.1   15    4-18     69-83  (134)

No 1  
>KOG1048|consensus
Probab=99.48  E-value=1.5e-14  Score=120.57  Aligned_cols=52  Identities=54%  Similarity=0.693  Sum_probs=48.6

Q ss_pred             CCchHHHHHHHHHHHhhhhhhhhHHHHHHHHHHHHHHHhhCCCCchhhhHHHHhhhCCCCCCCCCCCCCCCC
Q psy15602          1 MEVDRVVCAAATALRNLAIDQRNKELIDAFEANLILIELNLSPPAGKYAMRDLVQKLPSGNAQHDQGTSDDT   72 (72)
Q Consensus         1 m~~drVv~a~ataLRNLAlD~RNKeLI~~~~~~~~~~~~~~~~~~GkyAmrdLV~kLP~~~~~~~~~lsddT   72 (72)
                      +++|+|||+++++||||++|.|||++|                  |||||+|||.+||++++  .+.+||||
T Consensus       577 ~~~~~vv~s~a~~LrNls~d~rnk~li------------------gk~a~~~lv~~Lp~~~~--~~~~sedt  628 (717)
T KOG1048|consen  577 NDDSDVVRSAAGALRNLSRDIRNKELI------------------GKYAIPDLVRCLPGSGP--STSLSEDT  628 (717)
T ss_pred             cCCchHHHHHHHHHhhhccCchhhhhh------------------hcchHHHHHHhCcCCCC--CcCchHHH
Confidence            478999999999999999999999999                  99999999999999888  46888886


No 2  
>smart00185 ARM Armadillo/beta-catenin-like repeats. Approx. 40 amino acid repeat. Tandem repeats form superhelix of helices that is proposed to mediate interaction of beta-catenin with its ligands. Involved in transducing the Wingless/Wnt signal. In plakoglobin arm repeats bind alpha-catenin and N-cadherin.
Probab=89.67  E-value=0.38  Score=24.19  Aligned_cols=17  Identities=53%  Similarity=0.476  Sum_probs=15.1

Q ss_pred             CchHHHHHHHHHHHhhh
Q psy15602          2 EVDRVVCAAATALRNLA   18 (72)
Q Consensus         2 ~~drVv~a~ataLRNLA   18 (72)
                      +++++++.++.+||||+
T Consensus        24 ~~~~i~~~a~~aL~nl~   40 (41)
T smart00185       24 EDEEVVKEAAWALSNLS   40 (41)
T ss_pred             CCHHHHHHHHHHHHHHc
Confidence            46789999999999997


No 3  
>PF00514 Arm:  Armadillo/beta-catenin-like repeat;  InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless. Animal Arm-repeat proteins function in various processes, including intracellular signalling and cytoskeletal regulation, and include such proteins as beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumour suppressor protein, and the nuclear transport factor importin-alpha, amongst others []. A subset of these proteins is conserved across eukaryotic kingdoms. In higher plants, some Arm-repeat proteins function in intracellular signalling like their mammalian counterparts, while others have novel functions []. The 3-dimensional fold of an armadillo repeat is known from the crystal structure of beta-catenin, where the 12 repeats form a superhelix of alpha helices with three helices per unit []. The cylindrical structure features a positively charged grove, which presumably interacts with the acidic surfaces of the known interaction partners of beta-catenin.; GO: 0005515 protein binding; PDB: 2Z6G_A 1IQ1_C 3RZX_A 2C1M_A 3BTR_C 3OQS_A 3TPO_A 1IAL_A 1Q1S_C 1PJM_B ....
Probab=85.09  E-value=1.1  Score=23.65  Aligned_cols=17  Identities=47%  Similarity=0.239  Sum_probs=14.9

Q ss_pred             CchHHHHHHHHHHHhhh
Q psy15602          2 EVDRVVCAAATALRNLA   18 (72)
Q Consensus         2 ~~drVv~a~ataLRNLA   18 (72)
                      +++.|.+.++.||+||+
T Consensus        24 ~~~~v~~~a~~al~nl~   40 (41)
T PF00514_consen   24 PDPEVQEEAAWALGNLA   40 (41)
T ss_dssp             SSHHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHh
Confidence            46788999999999997


No 4  
>cd00020 ARM Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model.
Probab=72.52  E-value=7.3  Score=22.43  Aligned_cols=21  Identities=52%  Similarity=0.457  Sum_probs=17.7

Q ss_pred             CchHHHHHHHHHHHhhhhhhh
Q psy15602          2 EVDRVVCAAATALRNLAIDQR   22 (72)
Q Consensus         2 ~~drVv~a~ataLRNLAlD~R   22 (72)
                      ++.+|...++.+|+||+.+..
T Consensus        61 ~~~~v~~~a~~~L~~l~~~~~   81 (120)
T cd00020          61 EDEEVVKAALWALRNLAAGPE   81 (120)
T ss_pred             CCHHHHHHHHHHHHHHccCcH
Confidence            357899999999999998773


No 5  
>PF04826 Arm_2:  Armadillo-like;  InterPro: IPR006911 This entry consists of mammalian proteins of unknown function.
Probab=56.48  E-value=13  Score=27.52  Aligned_cols=24  Identities=21%  Similarity=0.314  Sum_probs=20.3

Q ss_pred             hHHHHHHHHHHHhhhhhhhhHHHH
Q psy15602          4 DRVVCAAATALRNLAIDQRNKELI   27 (72)
Q Consensus         4 drVv~a~ataLRNLAlD~RNKeLI   27 (72)
                      ..+-.+.-.+|+||++...++.++
T Consensus       109 s~~Q~agLrlL~nLtv~~~~~~~l  132 (254)
T PF04826_consen  109 SEVQLAGLRLLTNLTVTNDYHHML  132 (254)
T ss_pred             CHHHHHHHHHHHccCCCcchhhhH
Confidence            355677889999999999998888


No 6  
>PF05804 KAP:  Kinesin-associated protein (KAP)
Probab=55.33  E-value=21  Score=30.58  Aligned_cols=27  Identities=30%  Similarity=0.391  Sum_probs=23.7

Q ss_pred             CchHHHHHHHHHHHhhhhhhhhHHHHH
Q psy15602          2 EVDRVVCAAATALRNLAIDQRNKELID   28 (72)
Q Consensus         2 ~~drVv~a~ataLRNLAlD~RNKeLI~   28 (72)
                      ++..+.+.+.+.|++||+...||+.|.
T Consensus       302 ~n~ellil~v~fLkkLSi~~ENK~~m~  328 (708)
T PF05804_consen  302 ENEELLILAVTFLKKLSIFKENKDEMA  328 (708)
T ss_pred             CCHHHHHHHHHHHHHHcCCHHHHHHHH
Confidence            455688899999999999999999993


No 7  
>TIGR00094 tRNA_TruD_broad tRNA pseudouridine synthase, TruD family. MJ11364 is a strong partial match from 50 to 230 aa.
Probab=54.92  E-value=3  Score=31.86  Aligned_cols=19  Identities=47%  Similarity=0.964  Sum_probs=16.7

Q ss_pred             HHhhCCCCchhhh---HHHHhh
Q psy15602         37 IELNLSPPAGKYA---MRDLVQ   55 (72)
Q Consensus        37 ~~~~~~~~~GkyA---mrdLV~   55 (72)
                      +.++|+||+|-||   ||+|+.
T Consensus       362 l~l~F~LP~GsYAT~vLREl~k  383 (387)
T TIGR00094       362 VELKFYLPAGSYATSVLRELIK  383 (387)
T ss_pred             EEEEEEeCCchhHHHHHHHHHh
Confidence            6789999999999   888876


No 8  
>PRK00984 truD tRNA pseudouridine synthase D; Reviewed
Probab=54.30  E-value=3.1  Score=31.99  Aligned_cols=19  Identities=42%  Similarity=0.864  Sum_probs=16.4

Q ss_pred             HHhhCCCCchhhh---HHHHhh
Q psy15602         37 IELNLSPPAGKYA---MRDLVQ   55 (72)
Q Consensus        37 ~~~~~~~~~GkyA---mrdLV~   55 (72)
                      +.++|+||+|.||   +|+|+.
T Consensus       317 l~l~F~Lp~GsYAT~lLREl~~  338 (341)
T PRK00984        317 LELEFWLPKGSYATSVLRELLK  338 (341)
T ss_pred             EEEEEEeCCchhHHHHHHHHhc
Confidence            5788999999999   788876


No 9  
>KOG4646|consensus
Probab=51.45  E-value=18  Score=26.93  Aligned_cols=27  Identities=26%  Similarity=0.349  Sum_probs=22.8

Q ss_pred             CchHHHHHHHHHHHhhhhhhhhHHHHH
Q psy15602          2 EVDRVVCAAATALRNLAIDQRNKELID   28 (72)
Q Consensus         2 ~~drVv~a~ataLRNLAlD~RNKeLI~   28 (72)
                      +|...|--..++|.|+..|..|++.|.
T Consensus        70 ~ne~LvefgIgglCNlC~d~~n~~~I~   96 (173)
T KOG4646|consen   70 QNELLVEFGIGGLCNLCLDKTNAKFIR   96 (173)
T ss_pred             ccHHHHHHhHHHHHhhccChHHHHHHH
Confidence            355667777899999999999999994


No 10 
>cd02576 PseudoU_synth_ScPUS7 PseudoU_synth_ScPUS7: Pseudouridine synthase, TruD family. This group consists of eukaryotic pseudouridine synthases similar to Saccharomyces cerevisiae Pus7.  Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi).  Saccharomyces cerevisiae Pus7 makes psi35 in U2 small nuclear RNA (U2 snRNA), psi13 in cytoplasmic tRNAs and psi35 in pre-tRNATyr. Psi35 in yeast U2 snRNA and psi13 in tRNAs are highly phylogenetically conserved.  Psi34 is the mammalian U2 snRNA counterpart of yeast U2 snRNA psi35.
Probab=51.44  E-value=5.1  Score=30.53  Aligned_cols=17  Identities=41%  Similarity=0.868  Sum_probs=13.7

Q ss_pred             HHhhCCCCchhhh---HHHH
Q psy15602         37 IELNLSPPAGKYA---MRDL   53 (72)
Q Consensus        37 ~~~~~~~~~GkyA---mrdL   53 (72)
                      +.++|+||+|-||   ||+|
T Consensus       351 l~l~F~Lp~GsYAT~~LREl  370 (371)
T cd02576         351 LKLKFSLPSSSYATMALREL  370 (371)
T ss_pred             EEEEEEcCchhHHHHHHHhh
Confidence            4678999999999   6665


No 11 
>PF04063 DUF383:  Domain of unknown function (DUF383);  InterPro: IPR007205 This is a protein of unknown function. It is found N-terminal to another domain of unknown function (IPR007206 from INTERPRO).
Probab=46.04  E-value=18  Score=25.97  Aligned_cols=20  Identities=25%  Similarity=0.391  Sum_probs=17.7

Q ss_pred             HHHHHHHHhhhhhhhhHHHH
Q psy15602          8 CAAATALRNLAIDQRNKELI   27 (72)
Q Consensus         8 ~a~ataLRNLAlD~RNKeLI   27 (72)
                      +.|+++|||.++|....+.+
T Consensus       121 ~Gva~~IrNccFd~~~H~~L  140 (192)
T PF04063_consen  121 GGVAGTIRNCCFDTDSHEWL  140 (192)
T ss_pred             HHHHHHHHHhhccHhHHHHh
Confidence            46899999999999998776


No 12 
>cd07909 YciF YciF bacterial stress response protein, ferritin-like iron-binding domain. YciF is a bacterial protein of unknown function that is up-regulated when bacteria experience stress conditions, and is highly conserved in a broad range of bacterial species.  YciF has a ferritin-like domain.  Ferritin-like, diiron-carboxylate proteins participate in a range of functions including iron regulation, mono-oxygenation, and reactive radical production. These proteins are characterized by the fact that they catalyze dioxygen-dependent oxidation-hydroxylation reactions within diiron centers; one exception is manganese catalase, which catalyzes peroxide-dependent oxidation-reduction within a dimanganese center. Diiron-carboxylate proteins are further characterized by the presence of duplicate metal ligands, glutamates and histidines (ExxH) and two additional glutamates within a four-helix bundle. Outside of these conserved residues there is little obvious homology. Members include bacterio
Probab=43.42  E-value=92  Score=21.57  Aligned_cols=47  Identities=32%  Similarity=0.429  Sum_probs=37.8

Q ss_pred             HHHHHHhhhhhhhhHHHHHHHHHHHH------------HHHhhCCCCchh-hhHHHHhhh
Q psy15602         10 AATALRNLAIDQRNKELIDAFEANLI------------LIELNLSPPAGK-YAMRDLVQK   56 (72)
Q Consensus        10 ~ataLRNLAlD~RNKeLI~~~~~~~~------------~~~~~~~~~~Gk-yAmrdLV~k   56 (72)
                      +..+|.-|+.-..+.+|-.+|+.|+.            |-.+..+|+..| .+|..||..
T Consensus        18 ~~~al~~m~~~a~~peLk~~l~~H~~eT~~qi~rLe~if~~lg~~~~~~~c~~m~gli~e   77 (147)
T cd07909          18 LVKALPKMAKAATSEELKEAFESHLEETEGQVERLEQIFESLGEKPEGKKCKAMEGLIKE   77 (147)
T ss_pred             HHHHHHHHHHHhCCHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCCccCcchHHHHHHHH
Confidence            45788999999999999999999864            445778888888 888888753


No 13 
>KOG4224|consensus
Probab=42.94  E-value=21  Score=30.31  Aligned_cols=28  Identities=43%  Similarity=0.520  Sum_probs=24.1

Q ss_pred             CchHHHHHHHHHHHhhhhhhhhHHHHHH
Q psy15602          2 EVDRVVCAAATALRNLAIDQRNKELIDA   29 (72)
Q Consensus         2 ~~drVv~a~ataLRNLAlD~RNKeLI~~   29 (72)
                      ..|+|.|-++.||||+|-|.+-+.-|++
T Consensus       263 ~s~kvkcqA~lALrnlasdt~Yq~eiv~  290 (550)
T KOG4224|consen  263 GSDKVKCQAGLALRNLASDTEYQREIVE  290 (550)
T ss_pred             CChHHHHHHHHHHhhhcccchhhhHHHh
Confidence            4689999999999999999988777643


No 14 
>cd02575 PseudoU_synth_EcTruD PseudoU_synth_EcTruD: Pseudouridine synthase, TruD family. This group consists of bacterial pseudouridine synthases similar to Escherichia coli TruD. Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi).  E. coli TruD makes the highly phylogenetically conserved psi13 in tRNAs.
Probab=42.90  E-value=5.2  Score=30.09  Aligned_cols=17  Identities=53%  Similarity=0.983  Sum_probs=13.6

Q ss_pred             HHhhCCCCchhhh---HHHH
Q psy15602         37 IELNLSPPAGKYA---MRDL   53 (72)
Q Consensus        37 ~~~~~~~~~GkyA---mrdL   53 (72)
                      ++++|.+|+|-||   ||+|
T Consensus       233 ~~l~f~lp~g~~at~~l~e~  252 (253)
T cd02575         233 LELSFYLPAGSYATSVLREL  252 (253)
T ss_pred             EEEEEEeCCCchHHHHHHHh
Confidence            5689999999999   5554


No 15 
>cd02552 PseudoU_synth_TruD_like PseudoU_synth_TruD_like: Pseudouridine synthase, TruD family. This group consists of eukaryotic, bacterial and archeal pseudouridine synthases similar to Escherichia coli TruD and Saccharomyces cerevisiae Pus7.  Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi).  E. coli TruD and S. cerevisiae Pus7 make psi13 in cytoplasmic tRNAs. In addition S. cerevisiae Pus7 makes psi35 in U2 small nuclear RNA (U2 snRNA) and psi35 in pre-tRNATyr.  Psi35 in U2 snRNA and psi13 in tRNAs are highly phylogenetically conserved.  Psi34 is the mammalian U2 snRNA counterpart of yeast U2 snRNA psi35.
Probab=35.54  E-value=13  Score=27.34  Aligned_cols=17  Identities=47%  Similarity=0.958  Sum_probs=13.5

Q ss_pred             HHhhCCCCchhhh---HHHH
Q psy15602         37 IELNLSPPAGKYA---MRDL   53 (72)
Q Consensus        37 ~~~~~~~~~GkyA---mrdL   53 (72)
                      +.++|+||+|-||   +|+|
T Consensus       212 ~~l~F~Lp~g~YAT~~lREl  231 (232)
T cd02552         212 LKLSFSLPRGSYATMVLREL  231 (232)
T ss_pred             EEEEEEcCCchHHHHHHHHh
Confidence            4678999999999   5554


No 16 
>KOG1048|consensus
Probab=33.53  E-value=30  Score=30.28  Aligned_cols=22  Identities=36%  Similarity=0.403  Sum_probs=19.0

Q ss_pred             CchHHHHHHHHHHHhhhhhhhh
Q psy15602          2 EVDRVVCAAATALRNLAIDQRN   23 (72)
Q Consensus         2 ~~drVv~a~ataLRNLAlD~RN   23 (72)
                      .++.|.+.+++|||||.+..-+
T Consensus       287 ~~~evq~~acgaLRNLvf~~~~  308 (717)
T KOG1048|consen  287 RNDEVQRQACGALRNLVFGKST  308 (717)
T ss_pred             CcHHHHHHHHHHHHhhhcccCC
Confidence            4688999999999999987765


No 17 
>PF05804 KAP:  Kinesin-associated protein (KAP)
Probab=30.76  E-value=77  Score=27.33  Aligned_cols=27  Identities=26%  Similarity=0.256  Sum_probs=22.8

Q ss_pred             CchHHHHHHHHHHHhhhhhhhhHHHHH
Q psy15602          2 EVDRVVCAAATALRNLAIDQRNKELID   28 (72)
Q Consensus         2 ~~drVv~a~ataLRNLAlD~RNKeLI~   28 (72)
                      ++..++..+..+|.|||+|..++..|.
T Consensus       343 ~~~~l~~~aLrlL~NLSfd~~~R~~mV  369 (708)
T PF05804_consen  343 ENEDLVNVALRLLFNLSFDPELRSQMV  369 (708)
T ss_pred             CCHHHHHHHHHHHHHhCcCHHHHHHHH
Confidence            456678888899999999999998884


No 18 
>PF12290 DUF3802:  Protein of unknown function (DUF3802);  InterPro: IPR020979  This family of proteins is found in bacteria and are typically between 114 and 143 amino acids in length. There is a conserved KNLFD sequence motif. The annotation with this family suggests that it may be the B subunit of bacterial type IIA DNA topoisomerase but there is no evidence to support this annotation. 
Probab=29.78  E-value=73  Score=22.20  Aligned_cols=33  Identities=30%  Similarity=0.414  Sum_probs=29.2

Q ss_pred             HHHHHHHHHHHHHHhhCCCCchhhhHHHHhhhC
Q psy15602         25 ELIDAFEANLILIELNLSPPAGKYAMRDLVQKL   57 (72)
Q Consensus        25 eLI~~~~~~~~~~~~~~~~~~GkyAmrdLV~kL   57 (72)
                      .||.-|-.|+.+.+.+-+.++|.+-+.|+|.-+
T Consensus        10 ~LI~yLte~L~lFe~~~~~~~~~~Tv~d~vee~   42 (113)
T PF12290_consen   10 ALIEYLTENLSLFESSQSGDTGDETVEDVVEEQ   42 (113)
T ss_pred             HHHHHHHHhHHHhcCCCCCCcccchHHHHHHHH
Confidence            588889999999999999999999999998754


No 19 
>PF11320 DUF3122:  Protein of unknown function (DUF3122);  InterPro: IPR021469  This family of proteins with unknown function appear to be restricted to Cyanobacteria. 
Probab=28.00  E-value=49  Score=23.26  Aligned_cols=29  Identities=21%  Similarity=0.529  Sum_probs=25.1

Q ss_pred             HHHHHHhhCCCCchhhhHHHHhhhCCCCC
Q psy15602         33 NLILIELNLSPPAGKYAMRDLVQKLPSGN   61 (72)
Q Consensus        33 ~~~~~~~~~~~~~GkyAmrdLV~kLP~~~   61 (72)
                      .-.|.+.+..+..|.|.+.+|+.+|+.+.
T Consensus        77 ~d~~~~~~~~~nvgqydl~plL~~L~~~~  105 (134)
T PF11320_consen   77 EDVFLDEDPRPNVGQYDLKPLLPQLSSNR  105 (134)
T ss_pred             CChHHhhCcCccccccccHhHHhhCCCCC
Confidence            44567889999999999999999999775


No 20 
>PF07565 Band_3_cyto:  Band 3 cytoplasmic domain;  InterPro: IPR013769 Bicarbonate (HCO3 -) transport mechanisms are the principal regulators of pH in animal cells. Such transport also plays a vital role in acid-base movements in the stomach, pancreas, intestine, kidney, reproductive organs and the central nervous system. Functional studies have suggested four different HCO3 - transport modes. Anion exchanger proteins exchange HCO3 - for Cl- in a reversible, electroneutral manner []. Na+/HCO3 - co-transport proteins mediate the coupled movement of Na+ and HCO3 - across plasma membranes, often in an electrogenic manner []. Na- driven Cl-/HCO3 - exchange and K+/HCO3 - exchange activities have also been detected in certain cell types, although the molecular identities of the proteins responsible remain to be determined. Sequence analysis of the two families of HCO3 - transporters that have been cloned to date (the anion exchangers and Na+/HCO3 - co-transporters) reveals that they are homologous. This is not entirely unexpected, given that they both transport HCO3 - and are inhibited by a class of pharmacological agents called disulphonic stilbenes []. They share around ~25-30% sequence identity, which is distributed along their entire sequence length, and have similar predicted membrane topologies, suggesting they have ~10 transmembrane (TM) domains.; GO: 0008509 anion transmembrane transporter activity, 0006820 anion transport, 0016021 integral to membrane; PDB: 1HYN_Q.
Probab=27.80  E-value=75  Score=23.85  Aligned_cols=42  Identities=17%  Similarity=0.304  Sum_probs=27.1

Q ss_pred             HHHHHHHHHH-----HhhhhhhhhHHHHHHHHHHHHHHHhhCCCCchhh
Q psy15602          5 RVVCAAATAL-----RNLAIDQRNKELIDAFEANLILIELNLSPPAGKY   48 (72)
Q Consensus         5 rVv~a~ataL-----RNLAlD~RNKeLI~~~~~~~~~~~~~~~~~~Gky   48 (72)
                      .+=||+||.+     ++.|...++++.+  +.+=-.|+.-++-+|||++
T Consensus       208 eiGR~~atlmsd~~F~~~ay~a~~r~dl--~~~id~Fl~~~iVlPPg~~  254 (257)
T PF07565_consen  208 EIGRAIATLMSDEVFHDVAYKAKSREDL--LAGIDEFLDDSIVLPPGEW  254 (257)
T ss_dssp             HHHHHHHHHHTSHHHHHHHHH-SSHHHH--HHHHHHHHHT-EEE-S--S
T ss_pred             ccchhhhhhhccHHHHHHHHHcCCHHHH--HHHHHHHhcCceecCCcCC
Confidence            3446666654     6777788888776  5677789999999999985


No 21 
>PF04826 Arm_2:  Armadillo-like;  InterPro: IPR006911 This entry consists of mammalian proteins of unknown function.
Probab=27.24  E-value=99  Score=22.91  Aligned_cols=33  Identities=27%  Similarity=0.345  Sum_probs=25.1

Q ss_pred             chHHHHHHHHHHHhhhhhhhhHHHHHHHHHHHH
Q psy15602          3 VDRVVCAAATALRNLAIDQRNKELIDAFEANLI   35 (72)
Q Consensus         3 ~drVv~a~ataLRNLAlD~RNKeLI~~~~~~~~   35 (72)
                      +..|..-+..||-|||.+..|++.|..+..+.-
T Consensus        67 ~~~vr~~AL~aL~Nls~~~en~~~Ik~~i~~Vc   99 (254)
T PF04826_consen   67 NPSVREKALNALNNLSVNDENQEQIKMYIPQVC   99 (254)
T ss_pred             ChHHHHHHHHHHHhcCCChhhHHHHHHHHHHHH
Confidence            345555678899999999999999976654433


No 22 
>KOG4500|consensus
Probab=26.60  E-value=46  Score=28.76  Aligned_cols=25  Identities=36%  Similarity=0.263  Sum_probs=21.2

Q ss_pred             chHHHHHHHHHHHhhhhhhhhHHHH
Q psy15602          3 VDRVVCAAATALRNLAIDQRNKELI   27 (72)
Q Consensus         3 ~drVv~a~ataLRNLAlD~RNKeLI   27 (72)
                      |=+++-|+..||||++|-.-||...
T Consensus       374 nV~~qhA~lsALRnl~IPv~nka~~  398 (604)
T KOG4500|consen  374 NVERQHACLSALRNLMIPVSNKAHF  398 (604)
T ss_pred             cchhHHHHHHHHHhccccCCchhhc
Confidence            3467789999999999999999765


No 23 
>KOG4224|consensus
Probab=24.61  E-value=97  Score=26.50  Aligned_cols=27  Identities=33%  Similarity=0.608  Sum_probs=23.4

Q ss_pred             CchHHHHHHHHHHHhhhh-hhhhHHHHH
Q psy15602          2 EVDRVVCAAATALRNLAI-DQRNKELID   28 (72)
Q Consensus         2 ~~drVv~a~ataLRNLAl-D~RNKeLI~   28 (72)
                      |++...|.+...|||||- ..+|+..|-
T Consensus       346 dnEeiqchAvstLrnLAasse~n~~~i~  373 (550)
T KOG4224|consen  346 DNEEIQCHAVSTLRNLAASSEHNVSVIR  373 (550)
T ss_pred             CchhhhhhHHHHHHHHhhhhhhhhHHHh
Confidence            567789999999999999 778988884


No 24 
>PF08919 F_actin_bind:  F-actin binding;  InterPro: IPR015015 The F-actin binding domain forms a compact bundle of four antiparallel alpha-helices, which are arranged in a left-handed topology. Binding of F-actin to the F-actin binding domain may result in cytoplasmic retention and subcellular distribution of the protein, as well as possible inhibition of protein function []. ; GO: 0004715 non-membrane spanning protein tyrosine kinase activity, 0005524 ATP binding, 0006468 protein phosphorylation; PDB: 1ZZP_A 2KK1_A.
Probab=24.41  E-value=1.2e+02  Score=20.59  Aligned_cols=22  Identities=27%  Similarity=0.549  Sum_probs=16.0

Q ss_pred             HHhhCCCCchhhhHHHHhhhCC
Q psy15602         37 IELNLSPPAGKYAMRDLVQKLP   58 (72)
Q Consensus        37 ~~~~~~~~~GkyAmrdLV~kLP   58 (72)
                      ++-+..+|-+|++.|++|+||=
T Consensus        51 yaD~~~~p~~KF~FREllsrLE   72 (110)
T PF08919_consen   51 YADSIIQPHAKFAFRELLSRLE   72 (110)
T ss_dssp             HGGG-S-CCCHHHHHHHHHHHH
T ss_pred             HHHcCcCcchhhhHHHHHHHHH
Confidence            4444677789999999999983


No 25 
>COG4704 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.69  E-value=20  Score=26.14  Aligned_cols=11  Identities=36%  Similarity=0.561  Sum_probs=8.9

Q ss_pred             CCCchhhhHHH
Q psy15602         42 SPPAGKYAMRD   52 (72)
Q Consensus        42 ~~~~GkyAmrd   52 (72)
                      -++||+||++-
T Consensus        83 ~Lk~G~YAvaa   93 (151)
T COG4704          83 GLKPGKYAVAA   93 (151)
T ss_pred             cCCCccEEEEE
Confidence            57999999763


No 26 
>PF09912 DUF2141:  Uncharacterized protein conserved in bacteria (DUF2141);  InterPro: IPR018673  This family of conserved hypothetical proteins has no known function. 
Probab=21.76  E-value=24  Score=22.91  Aligned_cols=10  Identities=40%  Similarity=0.830  Sum_probs=8.4

Q ss_pred             CCCchhhhHH
Q psy15602         42 SPPAGKYAMR   51 (72)
Q Consensus        42 ~~~~GkyAmr   51 (72)
                      .+|||+||+.
T Consensus        49 ~lp~G~YAi~   58 (112)
T PF09912_consen   49 DLPPGTYAIA   58 (112)
T ss_pred             CCCCccEEEE
Confidence            6899999964


No 27 
>COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription]
Probab=21.68  E-value=18  Score=23.09  Aligned_cols=8  Identities=63%  Similarity=1.049  Sum_probs=6.3

Q ss_pred             CchhhhHH
Q psy15602         44 PAGKYAMR   51 (72)
Q Consensus        44 ~~GkyAmr   51 (72)
                      -|||||++
T Consensus        55 ~Pg~yAl~   62 (64)
T COG2093          55 IPGKYALR   62 (64)
T ss_pred             CCceEEEE
Confidence            47999975


No 28 
>PF14347 DUF4399:  Domain of unknown function (DUF4399)
Probab=20.68  E-value=19  Score=23.05  Aligned_cols=16  Identities=38%  Similarity=0.526  Sum_probs=12.3

Q ss_pred             HhhCCCCchhhhHHHH
Q psy15602         38 ELNLSPPAGKYAMRDL   53 (72)
Q Consensus        38 ~~~~~~~~GkyAmrdL   53 (72)
                      ++++.|+||||-+.-+
T Consensus        54 e~~I~L~PG~htLtl~   69 (87)
T PF14347_consen   54 ELNIELPPGKHTLTLQ   69 (87)
T ss_pred             EEEEEeCCCCEEEEEE
Confidence            5678899999987533


No 29 
>PF08664 YcbB:  YcbB domain;  InterPro: IPR013972  YcbB is a DNA-binding protein []. 
Probab=20.18  E-value=92  Score=21.69  Aligned_cols=15  Identities=47%  Similarity=0.492  Sum_probs=13.2

Q ss_pred             hHHHHHHHHHHHhhh
Q psy15602          4 DRVVCAAATALRNLA   18 (72)
Q Consensus         4 drVv~a~ataLRNLA   18 (72)
                      -|+-||+..||-|||
T Consensus        69 QRIRRai~~al~nlA   83 (134)
T PF08664_consen   69 QRIRRAIKQALTNLA   83 (134)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            378899999999997


Done!