Query         psy15606
Match_columns 80
No_of_seqs    102 out of 195
Neff          4.9 
Searched_HMMs 46136
Date          Fri Aug 16 17:00:16 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15606.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15606hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF05826 Phospholip_A2_2:  Phos 100.0 4.3E-40 9.3E-45  215.8  -0.9   65   16-80      1-65  (99)
  2 cd04704 PLA2_bee_venom_like PL 100.0 5.3E-39 1.2E-43  210.4   2.0   66   15-80      1-66  (97)
  3 cd04705 PLA2_group_III_like PL  99.9 2.2E-23 4.8E-28  137.8   1.6   50   31-80     24-73  (100)
  4 cd00618 PLA2_like PLA2_like: P  99.7 1.4E-18   3E-23  108.1   1.4   62   17-80      1-75  (83)
  5 smart00085 PA2c Phospholipase   99.2 4.1E-12 8.9E-17   85.2   2.1   58   12-79     15-72  (117)
  6 cd04706 PLA2_plant PLA2_plant:  98.3 1.9E-07 4.1E-12   63.4   1.4   47   18-79     23-69  (117)
  7 PF08398 Parvo_coat_N:  Parvovi  96.7 0.00038 8.2E-09   43.1  -0.1   43   17-62      1-44  (64)
  8 cd00125 PLA2c PLA2c: Phospholi  96.6 0.00085 1.8E-08   45.1   1.0   30   21-56     25-54  (115)
  9 cd04707 otoconin_90 otoconin_9  96.0  0.0013 2.8E-08   44.6  -0.6   30   21-56     22-51  (117)
 10 KOG4087|consensus               94.8   0.011 2.3E-07   41.7   0.6   28   29-56     38-75  (144)
 11 PF00068 Phospholip_A2_1:  Phos  91.6   0.039 8.4E-07   36.6  -0.6   30   22-57     27-56  (116)
 12 PF08036 Antimicrobial_6:  Diap  62.0     2.7 5.8E-05   23.7   0.1   13   38-50     14-26  (39)
 13 PF06951 PLA2G12:  Group XII se  31.5      23  0.0005   25.8   0.8   41   14-56     73-113 (184)
 14 PHA03323 nuclear egress membra  23.7      48   0.001   25.7   1.4   18   15-32     20-37  (272)
 15 PF13899 Thioredoxin_7:  Thiore  23.4      28 0.00062   20.5   0.1   24    2-25      8-31  (82)

No 1  
>PF05826 Phospholip_A2_2:  Phospholipase A2;  InterPro: IPR001211 Phospholipase A2 (3.1.1.4 from EC) (PLA2) is a small lipolytic enzyme that releases fatty acids from the second carbon group of glycerol. It is involved in a number of physiologically important cellular processes, such as the liberation of arachidonic acid from membrane phospholipids []. It plays a pivotal role in the biosynthesis of prostaglandin and other mediators of inflammation. PLA2 has four to seven disulphide bonds and binds a calcium ion that is essential for activity. Within the active enzyme, the alpha amino group is involved in a conserved hydrogen-bonding network linking the N-terminal region to the active site. The side chains of two conserved residues, His and Asp, participate in the catalytic network. Many PLA2's are widely distributed in snakes, lizards, bees and mammals. In mammals there are at least four forms: pancreatic, membrane-associated as well as two less well characterised forms. The venom of most snakes contains multiple forms of PLA2. Some of them are presynaptic neurotoxins which inhibit neuromuscular transmission by blocking acetylcholine release from the nerve termini. Some of the proteins in this family are allergens. Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms. A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans [WHO/IUIS Allergen Nomenclature Subcommittee King T.P., Hoffmann D., Loewenstein H., Marsh D.G., Platts-Mills T.A.E., Thomas W. Bull. World Health Organ. 72:797-806(1994)]. This nomenclature system is defined by a designation that is composed of the first three letters of the genus; a space; the first letter of the species name; a space and an arabic number. In the event that two species names have identical designations, they are discriminated from one another by adding one or more letters (as necessary) to each species designation.  The allergens in this family include allergens with the following designations: Api m 1.; GO: 0004623 phospholipase A2 activity, 0005509 calcium ion binding, 0016042 lipid catabolic process; PDB: 1POC_A.
Probab=100.00  E-value=4.3e-40  Score=215.79  Aligned_cols=65  Identities=54%  Similarity=1.110  Sum_probs=49.8

Q ss_pred             eecCccccCCCCCCCCCCCCCCCCchhhhcccccCCCCcccCCCccCCeecCCCccccCCccCCC
Q psy15606         16 LVPGTKWCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYTIPGFSWRYKYFNMKPFTLSHCTCDQR   80 (80)
Q Consensus        16 ~~pGTkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~C~~~I~~~~~k~gl~N~~~~T~shC~CD~r   80 (80)
                      |||||||||+||+|.+|+|||.+.+||+|||+||+|+++|+++++||||+|.++||+|||+||+|
T Consensus         1 i~pGT~WCG~gn~a~~~~dlG~~~~tD~CCR~HD~C~~~I~~~~~k~gl~N~~~~T~~hC~Cd~~   65 (99)
T PF05826_consen    1 IYPGTKWCGPGNIAKNYSDLGEFKETDRCCREHDHCPDKIPPGETKYGLHNPRPFTISHCDCDSR   65 (99)
T ss_dssp             B-TT-SSSBSS---SSTT---SSHHHHHHHHHHHT-SSEE-TT-EETTEE--SSS-EEBHHHHHH
T ss_pred             CCCCCcccCCCCCccCcccccccHHHHHHHHhhccCCCccCCCccccccccCCcCceeecCcccH
Confidence            79999999999999999999999999999999999999999999999999999999999999964


No 2  
>cd04704 PLA2_bee_venom_like PLA2_bee_venom_like: A sub-family of  Phospholipase A2, similar to bee venom PLA2. PLA2 is a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. Enzymatically active PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids; secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis cannot form bilayers leading to a change in membrane conformation and ultimately to a block in the release of neurotransmitters. PLA2 may form dimers or oligomers. Bee venom PLA2 has fewer conserved disulfide bridges than most canonical PLA2s.
Probab=100.00  E-value=5.3e-39  Score=210.40  Aligned_cols=66  Identities=53%  Similarity=1.075  Sum_probs=64.3

Q ss_pred             eeecCccccCCCCCCCCCCCCCCCCchhhhcccccCCCCcccCCCccCCeecCCCccccCCccCCC
Q psy15606         15 MLVPGTKWCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYTIPGFSWRYKYFNMKPFTLSHCTCDQR   80 (80)
Q Consensus        15 ~~~pGTkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~C~~~I~~~~~k~gl~N~~~~T~shC~CD~r   80 (80)
                      ||||||||||+||+|.+|+|||.+.+||+|||+||+||++|++++++|||+|.++||++||+||.+
T Consensus         1 ~~~pGTkWCG~Gn~a~~~~dlG~~~~tD~CCr~HD~C~~~i~~~~~kyg~~N~~~~t~~~C~CD~~   66 (97)
T cd04704           1 FIVPGTKWCGPGNIATNYSDLGAFRETDKCCREHDHCPDIISAGEYKYGLTNTRLFTRSHCDCDNR   66 (97)
T ss_pred             CccCCCeecCCCCCCCCcccccCccccchHHHccccCcCcccccccccCccCCCccccccCcHHHH
Confidence            689999999999999999999999999999999999999999999999999999999999999964


No 3  
>cd04705 PLA2_group_III_like PLA2_group_III_like: A sub-family of  Phospholipase A2, similar to human group III PLA2. PLA2 is a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. Enzymatically active PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids; secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis cannot form bilayers leading to a change in membrane conformation and ultimately to a block in the release of neurotransmitters. PLA2 may form dimers or oligomers.
Probab=99.87  E-value=2.2e-23  Score=137.76  Aligned_cols=50  Identities=32%  Similarity=0.584  Sum_probs=47.4

Q ss_pred             CCCCCCCCCchhhhcccccCCCCcccCCCccCCeecCCCccccCCccCCC
Q psy15606         31 GFTDLGSFSSTDLCCRRHDSCQYTIPGFSWRYKYFNMKPFTLSHCTCDQR   80 (80)
Q Consensus        31 ~y~dLG~~~~tD~CCR~HD~C~~~I~~~~~k~gl~N~~~~T~shC~CD~r   80 (80)
                      .+.+||++.+||+|||+||+||++|.+++++|||+|.++||+|||+||.|
T Consensus        24 ~~~~lG~~~~~DrCCR~HD~Cp~~I~~~~~k~gl~N~~~~tisHCdCD~r   73 (100)
T cd04705          24 PFLSEGEFKEPDRCCWKHKQCPGHIIPPFSSDGHHNFHLHSVSHCDCDSR   73 (100)
T ss_pred             cccccccccchhhhhhhhhcCccccCCcccccceecCCCcccccccHHHH
Confidence            44689999999999999999999999999999999999999999999974


No 4  
>cd00618 PLA2_like PLA2_like: Phospholipase A2, a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids (PC or phosphatidylethanolamine), usually in a metal-dependent reaction, to generate lysophospholipid (LysoPL) and a free fatty acid (FA). The resulting products are either dietary or used in synthetic pathways for leukotrienes and prostaglandins. Often, arachidonic acid is released as a free fatty acid and acts as second messenger in signaling networks. Secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis (LysoPL and FA) cannot form bilayers leading to a change in membrane conformation and ultimately 
Probab=99.72  E-value=1.4e-18  Score=108.08  Aligned_cols=62  Identities=35%  Similarity=0.572  Sum_probs=56.9

Q ss_pred             ecCccccCCCCCCCCCCCCCCCCchhhhcccccCCCCcccCCCccCC-------------eecCCCccccCCccCCC
Q psy15606         17 VPGTKWCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYTIPGFSWRYK-------------YFNMKPFTLSHCTCDQR   80 (80)
Q Consensus        17 ~pGTkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~C~~~I~~~~~k~g-------------l~N~~~~T~shC~CD~r   80 (80)
                      .|+++|||.|+.+.++..++  .+||+|||+||+|++.|...+.+++             +.|..+++++||+||.+
T Consensus         1 ~~ygc~CG~g~~~~~~g~p~--D~~D~CC~~HD~Cy~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~~~C~CD~~   75 (83)
T cd00618           1 LPYGCYCGPGGSACPSGQPV--DETDRCCRKHDCCYDQISDGGCCDGCLSYSFSEGGVTCLTNSDLCTRSHCDCDRR   75 (83)
T ss_pred             CCcCcccCCCCcCCCCCCCC--CcchhhhhhCccHhhhhhccCCCCCcceeeecCCceeECCCCChhhHhhCcccHH
Confidence            47899999999999888877  6999999999999999999998888             78999999999999963


No 5  
>smart00085 PA2c Phospholipase A2.
Probab=99.22  E-value=4.1e-12  Score=85.16  Aligned_cols=58  Identities=28%  Similarity=0.384  Sum_probs=47.1

Q ss_pred             cCceeecCccccCCCCCCCCCCCCCCCCchhhhcccccCCCCcccCCCccCCeecCCCccccCCccCC
Q psy15606         12 SNLMLVPGTKWCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYTIPGFSWRYKYFNMKPFTLSHCTCDQ   79 (80)
Q Consensus        12 ~~~~~~pGTkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~C~~~I~~~~~k~gl~N~~~~T~shC~CD~   79 (80)
                      .+.++.++|+||+-|+.+....    ...||+||++||+|++.|++ +.-+.     .+++++|+|+.
T Consensus        15 ~~~~~~y~~YGCyCG~gg~G~p----vD~~D~CC~~HD~Cy~~~~~-~~C~~-----~~~~y~~~c~~   72 (117)
T smart00085       15 KRAWLSYGDYGCYCGWGGSGTP----VDATDRCCFVHDCCYGKAEK-EGCNP-----KTTTYSYSCDN   72 (117)
T ss_pred             CCcccchhccCcccCCCCCCCc----cccccchhhhcCchhhhccc-CCCcc-----cccceEEEEEC
Confidence            3578999999999999887653    67999999999999999987 44443     67788888875


No 6  
>cd04706 PLA2_plant PLA2_plant: Plant-specific sub-family of  Phospholipase A2, a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. Enzymatically active PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids; secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis cannot form bilayers leading to a change in membrane conformation and ultimately to a block in the release of neurotransmitters. PLA2 may form dimers or oligomers. This sub-family does not appear to have a conserved active site and metal-binding loop.
Probab=98.33  E-value=1.9e-07  Score=63.44  Aligned_cols=47  Identities=23%  Similarity=0.475  Sum_probs=35.0

Q ss_pred             cCccccCCCCCCCCCCCCCCCCchhhhcccccCCCCcccCCCccCCeecCCCccccCCccCC
Q psy15606         18 PGTKWCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYTIPGFSWRYKYFNMKPFTLSHCTCDQ   79 (80)
Q Consensus        18 pGTkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~C~~~I~~~~~k~gl~N~~~~T~shC~CD~   79 (80)
                      --.+|||+|+.+..  ++.--..+|+||+.||+|...+             ...+.+|.||+
T Consensus        23 ~YG~yCG~g~~g~~--~~~P~D~lD~CC~~HD~Cy~~~-------------~~~~~~c~C~~   69 (117)
T cd04706          23 RYGKYCGPGYSGCP--GERPCDDLDACCMTHDACVQAK-------------KNDYLSLECNE   69 (117)
T ss_pred             ccCcccCCCCCCCC--CCCCcchhhHHHHhCcCcccCC-------------CCCcCCchHHH
Confidence            37899999997532  3335578999999999999754             23467788875


No 7  
>PF08398 Parvo_coat_N:  Parvovirus coat protein VP1;  InterPro: IPR013607 Parvoviruses are some of the smallest viruses containing linear, non-segmented single-stranded DNA genomes, with an average genome size of 5000 nucleotides. Parvoviruses have been described that infect a wide range of invertebrates and vertebrates and are well known for causing enteric disease in mammals. Genomes contains two large ORFs: NS1 and VP1; other ORFs are found in some sub-types and different gene products can arise from splice variants and the use of different start codons [].  This is the N-terminal region of the Parvovirus VP1 coat protein []; its function is not known. ; GO: 0005198 structural molecule activity, 0019028 viral capsid
Probab=96.70  E-value=0.00038  Score=43.10  Aligned_cols=43  Identities=26%  Similarity=0.332  Sum_probs=32.8

Q ss_pred             ecCccccCCCCCCCCCCCCCCCCchhhhcccccCCCCc-ccCCCccC
Q psy15606         17 VPGTKWCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYT-IPGFSWRY   62 (80)
Q Consensus        17 ~pGTkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~C~~~-I~~~~~k~   62 (80)
                      +||++++||||.-.+-..   -.++|..+|+||...+. |..+..-|
T Consensus         1 lPg~~YlGPgn~l~~g~P---v~~~D~aA~~HD~aY~~~lk~G~NPY   44 (64)
T PF08398_consen    1 LPGYKYLGPGNPLDNGEP---VNPVDAAAREHDEAYDELLKHGDNPY   44 (64)
T ss_pred             CCCCCccCCCCCcCCCCC---CCHHHHHHHHHHHHHHHHHHcCCCCc
Confidence            599999999998655544   35899999999988774 65554433


No 8  
>cd00125 PLA2c PLA2c: Phospholipase A2, a family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids (PC or phosphatidylethanolamine), usually in a metal-dependent reaction, to generate lysophospholipid (LysoPL) and a free fatty acid (FA). The resulting products are either dietary or used in synthetic pathways for leukotrienes and prostaglandins. Often, arachidonic acid is released as a free fatty acid and acts as second messenger in signaling networks. Secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis (LysoPL and FA) cannot form bilayers leading to a change in membrane conformation and ultimately to a block in 
Probab=96.60  E-value=0.00085  Score=45.12  Aligned_cols=30  Identities=37%  Similarity=0.812  Sum_probs=22.2

Q ss_pred             cccCCCCCCCCCCCCCCCCchhhhcccccCCCCccc
Q psy15606         21 KWCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYTIP   56 (80)
Q Consensus        21 kWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~C~~~I~   56 (80)
                      -|||.|..-..      -..+|+||+.||.|...+.
T Consensus        25 CyCG~GG~G~P------vD~~DrCC~~HD~CY~~~~   54 (115)
T cd00125          25 CYCGLGGSGTP------VDDTDRCCQVHDCCYDRAE   54 (115)
T ss_pred             CccCCCCCCCC------cccHHHHHHHHHhHHhccc
Confidence            37887764322      2378999999999999765


No 9  
>cd04707 otoconin_90 otoconin_90: Phospholipase A2-like domains present in otoconin-90 and otoconin-95, mammal proteins that are principal matrix proteins of calcitic otoconia. Interactions involving otoconin-90 may trigger or constitute key events in otoconia formation. The PLA2-like domains in otoconins may have lost their metal-binding sites.
Probab=96.03  E-value=0.0013  Score=44.56  Aligned_cols=30  Identities=23%  Similarity=0.556  Sum_probs=21.1

Q ss_pred             cccCCCCCCCCCCCCCCCCchhhhcccccCCCCccc
Q psy15606         21 KWCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYTIP   56 (80)
Q Consensus        21 kWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~C~~~I~   56 (80)
                      -|||.|..-..      -.++|+||..||.|...+.
T Consensus        22 CyCG~GG~G~P------vD~~DrCC~~HD~CY~~~~   51 (117)
T cd04707          22 CYCGQEGEGLP------VDELDRCCFQHRCCLEQAS   51 (117)
T ss_pred             CcccCCCCCCC------cccchhHHHHhHHHHhhhh
Confidence            36776654221      1379999999999998653


No 10 
>KOG4087|consensus
Probab=94.76  E-value=0.011  Score=41.67  Aligned_cols=28  Identities=29%  Similarity=0.801  Sum_probs=21.4

Q ss_pred             CCCCCCCCCC----------CchhhhcccccCCCCccc
Q psy15606         29 ATGFTDLGSF----------SSTDLCCRRHDSCQYTIP   56 (80)
Q Consensus        29 A~~y~dLG~~----------~~tD~CCR~HD~C~~~I~   56 (80)
                      |.+|+.+|-+          .++|+||.+||.|.+-..
T Consensus        38 ~l~Y~~YGCyCGlGG~G~P~D~iDwCC~~HDcCY~~le   75 (144)
T KOG4087|consen   38 ALSYNKYGCYCGLGGSGQPKDAIDWCCHAHDCCYDRLE   75 (144)
T ss_pred             cceecCccccccCCCCCCccchHHHHHhcccHHHHHHH
Confidence            5666666544          689999999999987543


No 11 
>PF00068 Phospholip_A2_1:  Phospholipase A2;  InterPro: IPR001211 Phospholipase A2 (3.1.1.4 from EC) (PLA2) is a small lipolytic enzyme that releases fatty acids from the second carbon group of glycerol. It is involved in a number of physiologically important cellular processes, such as the liberation of arachidonic acid from membrane phospholipids []. It plays a pivotal role in the biosynthesis of prostaglandin and other mediators of inflammation. PLA2 has four to seven disulphide bonds and binds a calcium ion that is essential for activity. Within the active enzyme, the alpha amino group is involved in a conserved hydrogen-bonding network linking the N-terminal region to the active site. The side chains of two conserved residues, His and Asp, participate in the catalytic network. Many PLA2's are widely distributed in snakes, lizards, bees and mammals. In mammals there are at least four forms: pancreatic, membrane-associated as well as two less well characterised forms. The venom of most snakes contains multiple forms of PLA2. Some of them are presynaptic neurotoxins which inhibit neuromuscular transmission by blocking acetylcholine release from the nerve termini. Some of the proteins in this family are allergens. Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms. A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans [WHO/IUIS Allergen Nomenclature Subcommittee King T.P., Hoffmann D., Loewenstein H., Marsh D.G., Platts-Mills T.A.E., Thomas W. Bull. World Health Organ. 72:797-806(1994)]. This nomenclature system is defined by a designation that is composed of the first three letters of the genus; a space; the first letter of the species name; a space and an arabic number. In the event that two species names have identical designations, they are discriminated from one another by adding one or more letters (as necessary) to each species designation.  The allergens in this family include allergens with the following designations: Api m 1.; GO: 0004623 phospholipase A2 activity, 0005509 calcium ion binding, 0016042 lipid catabolic process; PDB: 1OQS_F 1S6B_B 1XXW_B 1MH2_B 2RD4_B 1OZ6_A 2OSN_A 2PH4_B 1FDK_A 2BP2_A ....
Probab=91.65  E-value=0.039  Score=36.65  Aligned_cols=30  Identities=33%  Similarity=0.923  Sum_probs=20.9

Q ss_pred             ccCCCCCCCCCCCCCCCCchhhhcccccCCCCcccC
Q psy15606         22 WCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYTIPG   57 (80)
Q Consensus        22 WCG~Gn~A~~y~dLG~~~~tD~CCR~HD~C~~~I~~   57 (80)
                      |||.|....      --.++|+||+.|+.|..-+..
T Consensus        27 yCg~~g~G~------PvD~iD~~C~~h~~Cy~~~~~   56 (116)
T PF00068_consen   27 YCGFGGKGQ------PVDEIDRCCRKHDQCYKCAKE   56 (116)
T ss_dssp             TBSSSSSSS-------SSHHHHHHHHHHHHHHHHTT
T ss_pred             cCCCCCCCC------CcccccchhHHhHHHHHHHhc
Confidence            888765321      134799999999999775543


No 12 
>PF08036 Antimicrobial_6:  Diapausin family of antimicrobial peptide;  InterPro: IPR012525 This family consists of diapausin-related antimicrobial peptides. Diapause during periods of environmental adversity is an essential part of the life cycle of many organisms with the molecular basis being different among animals. Diapause-specific peptides provide anti-fungal activity and act as N-type voltage-gated calcium channel blocker [].; GO: 0050832 defense response to fungus, 0005576 extracellular region; PDB: 2E2F_A.
Probab=62.01  E-value=2.7  Score=23.69  Aligned_cols=13  Identities=38%  Similarity=0.864  Sum_probs=10.0

Q ss_pred             CCchhhhcccccC
Q psy15606         38 FSSTDLCCRRHDS   50 (80)
Q Consensus        38 ~~~tD~CCR~HD~   50 (80)
                      ..+-|.|||+|-+
T Consensus        14 ~~Er~eCCrAhG~   26 (39)
T PF08036_consen   14 VPERDECCRAHGY   26 (39)
T ss_dssp             STTTHHHHHHTT-
T ss_pred             chhHHHHHHHcCc
Confidence            3578999999975


No 13 
>PF06951 PLA2G12:  Group XII secretory phospholipase A2 precursor (PLA2G12);  InterPro: IPR010711 This family consists of several group XII secretory phospholipase A2 precursor (PLA2G12) (3.1.1.4 from EC) proteins. Group XII and group V PLA(2)s are thought to participate in helper T cell immune response through release of immediate second signals and generation of downstream eicosanoids [].; GO: 0004623 phospholipase A2 activity, 0005509 calcium ion binding, 0016042 lipid catabolic process, 0005576 extracellular region
Probab=31.49  E-value=23  Score=25.79  Aligned_cols=41  Identities=24%  Similarity=0.344  Sum_probs=24.7

Q ss_pred             ceeecCccccCCCCCCCCCCCCCCCCchhhhcccccCCCCccc
Q psy15606         14 LMLVPGTKWCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYTIP   56 (80)
Q Consensus        14 ~~~~pGTkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~C~~~I~   56 (80)
                      .+-+|=-+-||+--....++. | ....-.||-+||.|.++=.
T Consensus        73 g~k~p~~NGCGS~~~G~~~d~-~-iP~~t~CCn~HDiCYdTCg  113 (184)
T PF06951_consen   73 GYKPPEPNGCGSYFLGLQIDI-G-IPAMTKCCNQHDICYDTCG  113 (184)
T ss_pred             CCCCCCCCCCCCcccCCcccC-C-CCchhccchhhhhHHHccC
Confidence            345566778887221111222 2 2237899999999998643


No 14 
>PHA03323 nuclear egress membrane protein UL34; Provisional
Probab=23.75  E-value=48  Score=25.65  Aligned_cols=18  Identities=33%  Similarity=0.649  Sum_probs=15.4

Q ss_pred             eeecCccccCCCCCCCCC
Q psy15606         15 MLVPGTKWCGYGNGATGF   32 (80)
Q Consensus        15 ~~~pGTkWCG~Gn~A~~y   32 (80)
                      +|+||++-||.|+.....
T Consensus        20 LvV~g~L~~g~gd~~~~~   37 (272)
T PHA03323         20 LVVPGNLRCGEGDAGLYE   37 (272)
T ss_pred             EEeccCccccCCCCCCCC
Confidence            699999999999986543


No 15 
>PF13899 Thioredoxin_7:  Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A ....
Probab=23.38  E-value=28  Score=20.52  Aligned_cols=24  Identities=21%  Similarity=0.379  Sum_probs=18.0

Q ss_pred             chhhhhhhcccCceeecCccccCC
Q psy15606          2 STLDRLKLGLSNLMLVPGTKWCGY   25 (80)
Q Consensus         2 ~~~~~~~~~~~~~~~~pGTkWCG~   25 (80)
                      ++|+..|++-...+++=|..||+.
T Consensus         8 ~al~~A~~~~kpvlv~f~a~wC~~   31 (82)
T PF13899_consen    8 EALAEAKKEGKPVLVDFGADWCPP   31 (82)
T ss_dssp             HHHHHHHHHTSEEEEEEETTTTHH
T ss_pred             HHHHHHHHcCCCEEEEEECCCCHh
Confidence            356666776667788889999974


Done!