Diaphorina citri psyllid: psy15613


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MNLGYYLNRSDNISAYLNPDTFDLLTYQITRMKNITAKHYENHVELPPLWLAELWSGITAESCLLETGPKVDLINGSFHLIIIRCQIHLITCLLDSEWLNLPFLCSGETGSCVGGGVEGLTDTFAASFLWIDKLGLAARLGVSVVVRQSLEFGNYSLLDWNTLEPNPDWWLSVLYKRLVDPRVLNISVPLSHRTLRLYVQCSPAHNITVFGINSPSFLY
cccccccccccccEEECccccHHHHHHHHHHHHHHHHHHccccccccccEEcccccccHHHHHcccccccccccccccccHHHHHHHHHHHHHHHccccccccEEEEccccccccccccccHHHHHHHHHHHHHHHHHHcccEEEEEEEccccccccccccccccccHHHHHHHHHHHccccEEEEEcccccccEEEEEEEcccccEEEEEEEcccccc
***GYYLNRSDNISAYLNPDTFDLLTYQITRMKNITAKHYENHVELPPLWLAELWSGITAESCLLETGPKVDLINGSFHLIIIRCQIHLITCLLDSEWLNLPFLCSGETGSCVGGGVEGLTDTFAASFLWIDKLGLAARLGVSVVVRQSLEFGNYSLLDWNTLEPNPDWWLSVLYKRLVDPRVLNISVPLSHRTLRLYVQCSPAHNITVFGINSPS***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLGYYLNRSDNISAYLNPDTFDLLTYQITRMKNITAKHYENHVELPPLWLAELWSGITAESCLLETGPKVDLINGSFHLIIIRCQIHLITCLLDSEWLNLPFLCSGETGSCVGGGVEGLTDTFAASFLWIDKLGLAARLGVSVVVRQSLEFGNYSLLDWNTLEPNPDWWLSVLYKRLVDPRVLNISVPLSHRTLRLYVQCSPAHNITVFGINSPSFLY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Heparanase Endoglycosidase that cleaves heparan sulfate proteoglycans (HSPGs) into heparan sulfate side chains and core proteoglycans. Participates in extracellular matrix (ECM) degradation and remodeling. Highly selective enzyme cleaving HSPGs at specific intrachain sites. It is essentially inactive at neutral pH but becomes active under acidic conditions such as during tumor invasion and in inflammatory processes. Facilitates cell migration associated with metastasis, wound healing and inflammation. Enhances shedding of syndecans, and increases endothelial invasion and angiogenesis in myelomas. Acts as procoagulant by increasing the generation of activation factor X in the presence of tissue factor and activation factor VII. Increases cell adhesion to the extacellular matrix (ECM), independent of its enzymatic activity. Induces AKT1/PKB phosphorylation via lipid rafts increasing cell mobility and invasion. Heparin increases this AKT1/PKB activation. Regulates osteogenesis. Enhances angiogenesis through up-regulation of SRC-mediated activation of VEGF. Implicated in hair follicle inner root sheath differentiation and hair homeostasis.confidentQ6YGZ1
Heparanase Endoglycosidase that cleaves heparan sulfate proteoglycans (HSPGs) into heparan sulfate side chains and core proteoglycans. Participates in extracellular matrix (ECM) degradation and remodeling. Highly selective enzyme cleaving HSPGs at specific intrachain sites. It is essentially inactive at neutral pH but becomes active under acidic conditions such as during tumor invasion and in inflammatory processes. Facilitates cell migration associated with metastasis, wound healing and inflammation. Enhances shedding of syndecans, and increases endothelial invasion and angiogenesis in myelomas. Acts as procoagulant by increasing the generation of activation factor X in the presence of tissue factor and activation factor VII. Increases cell adhesion to the extacellular matrix (ECM), independent of its enzymatic activity. Induces AKT1/PKB phosphorylation via lipid rafts increasing cell mobility and invasion. Heparin increases this AKT1/PKB activation. Regulates osteogenesis. Enhances angiogenesis through up-regulation of SRC-mediated activation of VEGF. Implicated in hair follicle inner root sheath differentiation and hair homeostasis.confidentQ71RP1
Heparanase Endoglycosidase that cleaves heparan sulfate proteoglycans (HSPGs) into heparan sulfate side chains and core proteoglycans. Participates in extracellular matrix (ECM) degradation and remodeling. Highly selective enzyme cleaving HSPGs at specific intrachain sites. Essentially inactive at neutral pH but becomes active under acidic conditions such as during tumor invasion and in inflammatory processes. Facilitates cell migration associated with metastasis, wound healing and inflammation. Enhances shedding of syndecans. Acts as procoagulant by enhancing the generation of activated factor X/F10 in the presence of tissue factor/TF and activated factor VII/F7. Independent of its enzymatic activity, increases cell adhesion to the extracellular matrix (ECM). Enhances AKT1/PKB phosphorylation, possibly via interaction with a lipid raft-resident receptor. Plays a role in the regulation of osteogenesis. Enhances angiogenesis through up-regulation of SRC-mediated activation of VEGF. Implicated in hair follicle inner root sheath differentiation and hair homeostasis.confidentQ9MYY0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007160 [BP]cell-matrix adhesionprobableGO:0031589, GO:0009987, GO:0044763, GO:0007155, GO:0008150, GO:0022610, GO:0044699
GO:0051897 [BP]positive regulation of protein kinase B signaling cascadeprobableGO:0023051, GO:0009966, GO:0010740, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0050789, GO:0065007, GO:0009967, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0010627, GO:0051896, GO:0048522
GO:0051798 [BP]positive regulation of hair follicle developmentprobableGO:0045684, GO:0051094, GO:0050793, GO:0051240, GO:0008150, GO:0065007, GO:2000026, GO:0051239, GO:0048518, GO:0045682, GO:0051797, GO:0050789, GO:0042634
GO:0045545 [MF]syndecan bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0004553 [MF]hydrolase activity, hydrolyzing O-glycosyl compoundsprobableGO:0016787, GO:0003674, GO:0016798, GO:0003824
GO:0030194 [BP]positive regulation of blood coagulationprobableGO:0032101, GO:0050818, GO:0051240, GO:0048583, GO:1900046, GO:0050789, GO:0050820, GO:0061041, GO:0065007, GO:0051239, GO:0048518, GO:0030193, GO:0008150, GO:1900048, GO:0080134
GO:0030200 [BP]heparan sulfate proteoglycan catabolic processprobableGO:0030201, GO:0044248, GO:0044281, GO:0009100, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006516, GO:0009987, GO:0044710, GO:0030167, GO:0008150, GO:0030163, GO:0008152, GO:0043436, GO:0009056, GO:0009057, GO:0044238, GO:0006082, GO:0044273, GO:0019538, GO:1901136, GO:1901135, GO:0044237, GO:0043170, GO:0006029, GO:0006790
GO:0046983 [MF]protein dimerization activityprobableGO:0003674, GO:0005488, GO:0005515
GO:0010575 [BP]positive regulation vascular endothelial growth factor productionprobableGO:0051240, GO:0010574, GO:0001817, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0050789, GO:0001819
GO:0033690 [BP]positive regulation of osteoblast proliferationprobableGO:0008284, GO:0042127, GO:0033688, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0061042 [BP]vascular wound healingprobableGO:0072359, GO:0072358, GO:0009653, GO:0007275, GO:0044699, GO:0001525, GO:0001568, GO:0001944, GO:0009611, GO:0048514, GO:0048646, GO:0032502, GO:0032501, GO:0042060, GO:0044767, GO:0006950, GO:0008150, GO:0060055, GO:0044707, GO:0050896, GO:0048856, GO:0048731
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0045121 [CC]membrane raftprobableGO:0005575, GO:0044425, GO:0016020
GO:0005764 [CC]lysosomeprobableGO:0005737, GO:0000323, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3VNY, chain A
Confidence level:very confident
Coverage over the Query: 11-217
View the alignment between query and template
View the model in PyMOL