BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy15615
(904 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2G03|A Chain A, Structure Of A Putative Cell Filamentation Protein From
Neisseria Meningitidis
Length = 194
Score = 35.0 bits (79), Expect = 0.18, Method: Composition-based stats.
Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 1/67 (1%)
Query: 211 LQANLTKIFNWNVKQLFLYLTAEYITPSNVLN-QVVLWDRIILRGENADLKFKNMNTKYY 269
L+ NL K+ NW LYL A +P N L + +L D + +N ++ FK + YY
Sbjct: 128 LKKNLKKVVNWQNVSKTLYLQAXERSPVNDLELRFLLKDNLTDDVDNREIIFKGIEQSYY 187
Query: 270 FWDDGKG 276
+ KG
Sbjct: 188 YEGYEKG 194
>pdb|3S6A|A Chain A, Fic Protein From Neisseria Meningitidis In Complex With
Amppnp
Length = 188
Score = 34.7 bits (78), Expect = 0.28, Method: Composition-based stats.
Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 1/67 (1%)
Query: 211 LQANLTKIFNWNVKQLFLYLTAEYITPSNVLN-QVVLWDRIILRGENADLKFKNMNTKYY 269
L+ NL K+ NW LYL A +P N L + +L D + +N ++ FK + YY
Sbjct: 122 LKKNLKKVVNWQNVSKTLYLQAMERSPVNDLELRFLLKDNLTDDVDNREIIFKGIEQSYY 181
Query: 270 FWDDGKG 276
+ KG
Sbjct: 182 YEGYEKG 188
>pdb|3SN9|A Chain A, Fic Protein From Neisseria Meningitidis Mutant S182aE186A
IN COMPLEX With Amppnp
pdb|3SN9|B Chain B, Fic Protein From Neisseria Meningitidis Mutant S182aE186A
IN COMPLEX With Amppnp
pdb|3SN9|C Chain C, Fic Protein From Neisseria Meningitidis Mutant S182aE186A
IN COMPLEX With Amppnp
pdb|3SN9|D Chain D, Fic Protein From Neisseria Meningitidis Mutant S182aE186A
IN COMPLEX With Amppnp
pdb|3SN9|E Chain E, Fic Protein From Neisseria Meningitidis Mutant S182aE186A
IN COMPLEX With Amppnp
pdb|3SN9|F Chain F, Fic Protein From Neisseria Meningitidis Mutant S182aE186A
IN COMPLEX With Amppnp
pdb|3SN9|G Chain G, Fic Protein From Neisseria Meningitidis Mutant S182aE186A
IN COMPLEX With Amppnp
pdb|3SN9|H Chain H, Fic Protein From Neisseria Meningitidis Mutant S182aE186A
IN COMPLEX With Amppnp
pdb|3SN9|I Chain I, Fic Protein From Neisseria Meningitidis Mutant S182aE186A
IN COMPLEX With Amppnp
pdb|3SN9|J Chain J, Fic Protein From Neisseria Meningitidis Mutant S182aE186A
IN COMPLEX With Amppnp
pdb|3SN9|K Chain K, Fic Protein From Neisseria Meningitidis Mutant S182aE186A
IN COMPLEX With Amppnp
pdb|3SN9|L Chain L, Fic Protein From Neisseria Meningitidis Mutant S182aE186A
IN COMPLEX With Amppnp
pdb|3SN9|M Chain M, Fic Protein From Neisseria Meningitidis Mutant S182aE186A
IN COMPLEX With Amppnp
pdb|3SN9|N Chain N, Fic Protein From Neisseria Meningitidis Mutant S182aE186A
IN COMPLEX With Amppnp
pdb|3SN9|O Chain O, Fic Protein From Neisseria Meningitidis Mutant S182aE186A
IN COMPLEX With Amppnp
pdb|3SN9|P Chain P, Fic Protein From Neisseria Meningitidis Mutant S182aE186A
IN COMPLEX With Amppnp
Length = 188
Score = 34.3 bits (77), Expect = 0.30, Method: Composition-based stats.
Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 1/67 (1%)
Query: 211 LQANLTKIFNWNVKQLFLYLTAEYITPSNVLN-QVVLWDRIILRGENADLKFKNMNTKYY 269
L+ NL K+ NW LYL A +P N L + +L D + +N ++ FK + YY
Sbjct: 122 LKKNLKKVVNWQNVSKTLYLQAMERSPVNDLELRFLLKDNLTDDVDNREIIFKGIEQAYY 181
Query: 270 FWDDGKG 276
+ KG
Sbjct: 182 YAGYEKG 188
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.319 0.138 0.441
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 17,927,073
Number of Sequences: 62578
Number of extensions: 622075
Number of successful extensions: 1054
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 1054
Number of HSP's gapped (non-prelim): 3
length of query: 904
length of database: 14,973,337
effective HSP length: 108
effective length of query: 796
effective length of database: 8,214,913
effective search space: 6539070748
effective search space used: 6539070748
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 56 (26.2 bits)