Query         psy15621
Match_columns 102
No_of_seqs    100 out of 132
Neff          4.6 
Searched_HMMs 46136
Date          Fri Aug 16 17:23:51 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy15621.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/15621hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF10206 WRW:  Mitochondrial F1 100.0 8.1E-66 1.7E-70  358.9   6.8  101    1-101     1-101 (104)
  2 KOG4092|consensus              100.0 4.7E-54   1E-58  298.2   5.8  101    1-101     1-102 (108)
  3 PF10791 F1F0-ATPsyn_F:  Mitoch  97.7 2.4E-05 5.2E-10   54.3   2.4   39   61-99     56-95  (95)
  4 PF06055 ExoD:  Exopolysacchari  57.7      21 0.00045   26.9   4.2   35   38-72     77-113 (187)
  5 COG4745 Predicted membrane-bou  35.4      15 0.00033   32.4   0.5   77    9-92     59-155 (556)
  6 TIGR03116 cas_csf3 CRISPR-asso  35.3      14 0.00029   29.1   0.2   35    1-35     73-109 (214)
  7 PHA02599 dsbA double-stranded   32.0      14 0.00029   25.6  -0.3    8    9-16     10-17  (91)
  8 PF02202 Tachykinin:  Tachykini  30.5     9.1  0.0002   17.0  -0.9    7   19-25      3-9   (11)
  9 PF12616 DUF3775:  Protein of u  30.3      55  0.0012   21.5   2.5   24   41-64     25-48  (75)
 10 KOG3021|consensus               29.4      30 0.00065   28.4   1.2   60   18-98    233-292 (313)
 11 PF09125 COX2-transmemb:  Cytoc  26.4      84  0.0018   18.5   2.5   16   78-93     20-35  (38)
 12 PF10847 DUF2656:  Protein of u  26.3      88  0.0019   23.0   3.1   31   36-66     39-71  (132)
 13 KOG2706|consensus               23.4      42 0.00092   28.6   1.1   23    1-23    274-297 (476)
 14 cd00072 GYF GYF domain: contai  22.6      46   0.001   20.4   1.0    9   12-20     11-19  (57)
 15 PF15171 Spexin:  Neuropeptide   22.1      48   0.001   22.7   1.0   13   42-54      5-17  (90)
 16 PF02677 DUF208:  Uncharacteriz  20.9      40 0.00087   25.6   0.5    6   10-15     30-35  (176)
 17 smart00444 GYF Contains conser  20.5      45 0.00097   20.4   0.6   11   11-21      9-19  (56)
 18 PF09782 NDUF_B6:  NADH:ubiquin  20.2      86  0.0019   23.4   2.1   45   53-97     54-110 (156)
 19 KOG4458|consensus               20.2      46   0.001   22.1   0.6    9   12-20      4-12  (78)

No 1  
>PF10206 WRW:  Mitochondrial F1F0-ATP synthase, subunit f;  InterPro: IPR019344  This entry represents small proteins of approximately 110 amino acids, which are highly conserved from nematodes to humans. Some have been annotated in Swiss-Prot as being the f subunit of mitochondrial F1F0-ATP synthase but this could not be confirmed. The sequence has a well-conserved WRW motif. The exact function of the protein is not known. 
Probab=100.00  E-value=8.1e-66  Score=358.91  Aligned_cols=101  Identities=57%  Similarity=1.067  Sum_probs=100.1

Q ss_pred             CCCCCCCCccCCCCcCCCCCCccccCCCCCccceeecCcCccccccCCCHHHHHHHHHHHHHhhhcccccccCCCcchHH
Q psy15621          1 MGFGDYPAEYKPQVHGPYDPARYYGKPDTPLGQVKLGELGSWFGRRNYSPRAMTAATSRAFWRWNHKYILPKKSNMAGTL   80 (102)
Q Consensus         1 ~~~g~~p~eyn~~~hgpy~p~r~ygk~d~~l~dvKL~ElPsWl~~r~~sP~~~~~av~Rg~~ry~~KYi~~Kk~gi~pi~   80 (102)
                      |+|||||+||||+|||||||+||||||||||+||||+|||+||+|||+||+++++||||+||||+||||+|||+||+||+
T Consensus         1 m~~G~~p~eyn~~vhGpy~p~ryYGk~Dt~l~dVKLgELpsW~~rRd~sP~~~~~a~sR~~wry~~KYi~~Kr~gia~~~   80 (104)
T PF10206_consen    1 MAFGDYPKEYNPKVHGPYDPARYYGKKDTPLMDVKLGELPSWLSRRDKSPSGIAGAFSRGYWRYQHKYINVKRGGIAPFF   80 (104)
T ss_pred             CCcCCCchhhCccccCCCCchhhcCCCCCchhheecchhHHHHhhccCCHHHHHHHHHHHHHHHHHhhhceecCCcchhH
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhhhhhhccCccccc
Q psy15621         81 HVLFGLSLFFYVINYPRIKLF  101 (102)
Q Consensus        81 ~v~~g~~v~~Y~~sy~hlK~~  101 (102)
                      ||++|+|+|||+|||+||||.
T Consensus        81 ~v~~g~~~~~Y~~~Y~~lkh~  101 (104)
T PF10206_consen   81 QVLAGYMVFSYCINYKHLKHH  101 (104)
T ss_pred             HHHHHHHHHHHHHhhcHhhhc
Confidence            999999999999999999985


No 2  
>KOG4092|consensus
Probab=100.00  E-value=4.7e-54  Score=298.21  Aligned_cols=101  Identities=41%  Similarity=0.733  Sum_probs=98.1

Q ss_pred             CCCCCCCCccCCCCcCCCCCCccccCCCCCccceeecCcCccccccCCCHHHHHHHHHHHHHhhhccccc-ccCCCcchH
Q psy15621          1 MGFGDYPAEYKPQVHGPYDPARYYGKPDTPLGQVKLGELGSWFGRRNYSPRAMTAATSRAFWRWNHKYIL-PKKSNMAGT   79 (102)
Q Consensus         1 ~~~g~~p~eyn~~~hgpy~p~r~ygk~d~~l~dvKL~ElPsWl~~r~~sP~~~~~av~Rg~~ry~~KYi~-~Kk~gi~pi   79 (102)
                      |.+|+||+||||+|||||||||||||+|++|+||||||||+|+.|||+||+++.+||||+||||+|||++ +|+++|+||
T Consensus         1 te~G~f~kr~N~~vhgpycpar~yGk~D~kf~~VKLGelpaW~~rR~ktPsa~~gaf~R~~wR~~nkY~~Pv~~gsi~~i   80 (108)
T KOG4092|consen    1 TEVGLFDKRWNKMVHGPYCPARVYGKKDKKFLEVKLGELPAWILRRDKTPSAIFGAFQRGYWRYYNKYINPVKKGSISGI   80 (108)
T ss_pred             CccccchhhhCcCCCCCCCCccccccccceeeeeeecccHHHHHhccCChHHHHHHHHHHHHHHHhheechhhcCchhHH
Confidence            6899999999999999999999999999999999999999999999999999999999999999999999 566679999


Q ss_pred             HHHHHHHHhhhhhhccCccccc
Q psy15621         80 LHVLFGLSLFFYVINYPRIKLF  101 (102)
Q Consensus        80 ~~v~~g~~v~~Y~~sy~hlK~~  101 (102)
                      +|+++++|+|||++||.||||+
T Consensus        81 f~~~~ay~~f~yl~~y~~lkh~  102 (108)
T KOG4092|consen   81 FMVLAAYVLFSYLFSYKHLKHE  102 (108)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHh
Confidence            9999999999999999999996


No 3  
>PF10791 F1F0-ATPsyn_F:  Mitochondrial F1-F0 ATP synthase subunit F of fungi;  InterPro: IPR019727 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   F-ATPases (also known as F1F0-ATPase, or H(+)-transporting two-sector ATPase) (3.6.3.14 from EC) are composed of two linked complexes: the F1 ATPase complex is the catalytic core and is composed of 5 subunits (alpha, beta, gamma, delta, epsilon), while the F0 ATPase complex is the membrane-embedded proton channel that is composed of at least 3 subunits (A-C), nine in mitochondria (A-G, F6, F8). Both the F1 and F0 complexes are rotary motors that are coupled back-to-back. In the F1 complex, the central gamma subunit forms the rotor inside the cylinder made of the alpha(3)beta(3) subunits, while in the F0 complex, the ring-shaped C subunits forms the rotor. The two rotors rotate in opposite directions, but the F0 rotor is usually stronger, using the force from the proton gradient to push the F1 rotor in reverse in order to drive ATP synthesis []. These ATPases can also work in reverse to hydrolyse ATP to create a proton gradient. This entry represents subunit F found in the F0 complex of F-ATPases from fungal mitochondria. The membrane bound F1-FO-type H+ ATP synthase of mitochondria catalyses the terminal step in oxidative respiration converting the generation of the electrochemical gradient into ATP for cellular biosynthesis. The general structure and the core subunits of the enzyme are highly conserved in both prokaryotic and eukaryotic organisms. 
Probab=97.70  E-value=2.4e-05  Score=54.25  Aligned_cols=39  Identities=31%  Similarity=0.444  Sum_probs=36.5

Q ss_pred             HHhhhcccccccCCCcchHHHHHHHHHhhhhhhccC-ccc
Q psy15621         61 FWRWNHKYILPKKSNMAGTLHVLFGLSLFFYVINYP-RIK   99 (102)
Q Consensus        61 ~~ry~~KYi~~Kk~gi~pi~~v~~g~~v~~Y~~sy~-hlK   99 (102)
                      +=||+.||.+-|+.+.+|+.|++++.+++.|+++|- |||
T Consensus        56 ~grYkakYFdGkNaSgkPllHli~~l~~iGYs~eYyfHLr   95 (95)
T PF10791_consen   56 LGRYKAKYFDGKNASGKPLLHLIGGLFLIGYSIEYYFHLR   95 (95)
T ss_pred             HHHHHHHHcCCCCCccccHHHHHHHHHHHHHHHHhHhhcC
Confidence            568999999999999999999999999999999987 775


No 4  
>PF06055 ExoD:  Exopolysaccharide synthesis, ExoD;  InterPro: IPR010331 Among the bacterial genes required for nodule invasion are the exo genes. These genes are involved in the production of an extracellular polysaccharide. Mutations in the exoD result in altered exopolysaccharide production and defects in nodule invasion [].
Probab=57.72  E-value=21  Score=26.88  Aligned_cols=35  Identities=23%  Similarity=0.369  Sum_probs=29.2

Q ss_pred             CcCccccccCCCHHHHHHHHHHH--HHhhhccccccc
Q psy15621         38 ELGSWFGRRNYSPRAMTAATSRA--FWRWNHKYILPK   72 (102)
Q Consensus        38 ElPsWl~~r~~sP~~~~~av~Rg--~~ry~~KYi~~K   72 (102)
                      =||.|+.+|+.+.+.+..++++.  +-+|-.++..++
T Consensus        77 WLP~~l~~r~i~~~~l~~~~~~~~p~~~~ler~~rpR  113 (187)
T PF06055_consen   77 WLPKFLRRRSISREKLRKAVRRLRPWLRRLERLLRPR  113 (187)
T ss_pred             CCChHHHhCCCCHHHHHHHHHHHHHHHHHHHHHhCCC
Confidence            48999999999999888888765  677888888776


No 5  
>COG4745 Predicted membrane-bound mannosyltransferase [Posttranslational modification, protein turnover, chaperones]
Probab=35.37  E-value=15  Score=32.40  Aligned_cols=77  Identities=23%  Similarity=0.324  Sum_probs=39.4

Q ss_pred             ccCCCCcCCCCC------CccccCCCCCc------cceeecCcCccccccCCCHHHHHH-----HH---HHHHHhhhccc
Q psy15621          9 EYKPQVHGPYDP------ARYYGKPDTPL------GQVKLGELGSWFGRRNYSPRAMTA-----AT---SRAFWRWNHKY   68 (102)
Q Consensus         9 eyn~~~hgpy~p------~r~ygk~d~~l------~dvKL~ElPsWl~~r~~sP~~~~~-----av---~Rg~~ry~~KY   68 (102)
                      +|||.+|||+-+      -..-|-.|-..      ..+ |.-|-+||-|+...-.+++.     |+   -=-|-|+.++=
T Consensus        59 ~YrPi~HGPfL~hvn~avF~~lGasDataRlvvAv~G~-llpL~awL~R~rL~d~evlal~~LLA~sPvlVYYSRFmR~D  137 (556)
T COG4745          59 SYRPIYHGPFLYHVNYAVFGLLGASDATARLVVAVTGV-LLPLTAWLYRTRLGDKEVLALATLLAFSPVLVYYSRFMRND  137 (556)
T ss_pred             eecccccCchhhhhhhhhhhhcccchhhhhhhHHHhhh-HHHHHHHHHHHhccchHHHHHHHHHhcChhhhhHHHHHhhh
Confidence            799999999754      34445555321      111 23344676665444333221     11   11234444433


Q ss_pred             ccccCCCcchHHHHHHHHHhhhhh
Q psy15621         69 ILPKKSNMAGTLHVLFGLSLFFYV   92 (102)
Q Consensus        69 i~~Kk~gi~pi~~v~~g~~v~~Y~   92 (102)
                      +.      --.+|+++-++++.|+
T Consensus       138 l~------la~ftl~aVg~~vR~l  155 (556)
T COG4745         138 LL------LAAFTLLAVGFAVRYL  155 (556)
T ss_pred             HH------HHHHHHHHHHHHHHHh
Confidence            32      2566777777777664


No 6  
>TIGR03116 cas_csf3 CRISPR-associated protein, Csf3 family. Members of this family show up near CRISPR repeats in Acidithiobacillus ferrooxidans ATCC 23270, Azoarcus sp. EbN1, and Rhodoferax ferrireducens DSM 15236. In the latter two species, the CRISPR/cas locus is found on a plasmid. This family is one of several characteristic of a type of CRISPR-associated (cas) gene cluster we designate Aferr after A. ferrooxidans, where it is both chromosomal and the only type of cas gene cluster found. The gene is designated csf3 (CRISPR/cas Subtype as in A. ferrooxidans protein 3), as it lies third closest to the repeats.
Probab=35.30  E-value=14  Score=29.09  Aligned_cols=35  Identities=34%  Similarity=0.681  Sum_probs=26.9

Q ss_pred             CCCCCCCCccCCCCcCCC-CCCcccc-CCCCCcccee
Q psy15621          1 MGFGDYPAEYKPQVHGPY-DPARYYG-KPDTPLGQVK   35 (102)
Q Consensus         1 ~~~g~~p~eyn~~~hgpy-~p~r~yg-k~d~~l~dvK   35 (102)
                      .+|++||+.|--+--=|| ||+|+|| +-|+-+.+-|
T Consensus        73 ~~f~~~~~~~~takt~p~~d~~r~i~d~~~~g~~~a~  109 (214)
T TIGR03116        73 LAFLPYPKRYETAKTLPFTDPSRFIGDDLDRGLWQAR  109 (214)
T ss_pred             eecCccceeeeecccCCccchhhhhccchhhhhhhhc
Confidence            378999999988888888 6899998 6665555443


No 7  
>PHA02599 dsbA double-stranded DNA binding protein; Provisional
Probab=32.02  E-value=14  Score=25.62  Aligned_cols=8  Identities=63%  Similarity=1.369  Sum_probs=6.4

Q ss_pred             ccCCCCcC
Q psy15621          9 EYKPQVHG   16 (102)
Q Consensus         9 eyn~~~hg   16 (102)
                      |+||.|||
T Consensus        10 efn~~vhg   17 (91)
T PHA02599         10 EFNPAVHG   17 (91)
T ss_pred             hcCchhhH
Confidence            67888887


No 8  
>PF02202 Tachykinin:  Tachykinin family;  InterPro: IPR002040 This family includes peptides, which belong to the tachykinin family. Tachykinins [, , ] are a group of biologically active peptides which excite neurons, evoke behavioral responses, are potent vasodilatators and contract (directly or indirectly) many smooth muscles. Tachykinins, like most other active peptides, are synthesized as larger protein precursors that are enzymatically converted to their mature forms. Tachykinins are from ten to twelve residues long.; GO: 0007217 tachykinin receptor signaling pathway, 0007268 synaptic transmission; PDB: 1MYU_A 1N6T_A 2GFR_A.
Probab=30.54  E-value=9.1  Score=17.03  Aligned_cols=7  Identities=43%  Similarity=1.369  Sum_probs=5.5

Q ss_pred             CCCcccc
Q psy15621         19 DPARYYG   25 (102)
Q Consensus        19 ~p~r~yg   25 (102)
                      +|.+|||
T Consensus         3 ~pd~F~G    9 (11)
T PF02202_consen    3 KPDQFYG    9 (11)
T ss_dssp             CHHHHCC
T ss_pred             Cccccee
Confidence            5778887


No 9  
>PF12616 DUF3775:  Protein of unknown function (DUF3775);  InterPro: IPR022254  This domain family is found in bacteria, and is approximately 80 amino acids in length. There is a single completely conserved residue G that may be functionally important. 
Probab=30.31  E-value=55  Score=21.50  Aligned_cols=24  Identities=25%  Similarity=0.433  Sum_probs=22.2

Q ss_pred             ccccccCCCHHHHHHHHHHHHHhh
Q psy15621         41 SWFGRRNYSPRAMTAATSRAFWRW   64 (102)
Q Consensus        41 sWl~~r~~sP~~~~~av~Rg~~ry   64 (102)
                      .||+|-|++|...-.|+..+.-++
T Consensus        25 mwiGRGd~~~eew~~a~~~A~~~~   48 (75)
T PF12616_consen   25 MWIGRGDFEAEEWEEAVAEARERA   48 (75)
T ss_pred             HHhcCCCCCHHHHHHHHHHHHHhc
Confidence            499999999999999999998887


No 10 
>KOG3021|consensus
Probab=29.37  E-value=30  Score=28.40  Aligned_cols=60  Identities=27%  Similarity=0.535  Sum_probs=41.2

Q ss_pred             CCCCccccCCCCCccceeecCcCccccccCCCHHHHHHHHHHHHHhhhcccccccCCCcchHHHHHHHHHhhhhhhccCc
Q psy15621         18 YDPARYYGKPDTPLGQVKLGELGSWFGRRNYSPRAMTAATSRAFWRWNHKYILPKKSNMAGTLHVLFGLSLFFYVINYPR   97 (102)
Q Consensus        18 y~p~r~ygk~d~~l~dvKL~ElPsWl~~r~~sP~~~~~av~Rg~~ry~~KYi~~Kk~gi~pi~~v~~g~~v~~Y~~sy~h   97 (102)
                      ||||.|||-+|-.|                 -...+.+.+.+.|..=+||=| +|   .+|+-|=+.-|-++-|+=.+.|
T Consensus       233 fDPasfYgh~Efef-----------------gia~mfGgf~~sF~naY~k~i-pk---a~G~eqR~~LYqLyhyLNHwNh  291 (313)
T KOG3021|consen  233 FDPASFYGHSEFEF-----------------GIAKMFGGFTQSFYNAYHKKI-PK---APGFEQRLLLYQLYHYLNHWNH  291 (313)
T ss_pred             eCchhhcCCcHHHH-----------------HHHHHhCCCcHHHHHHHhhhc-CC---CCcHHHHHHHHHHHHHhhhhhh
Confidence            89999999988543                 334566666666665555433 22   6788888888988888755555


Q ss_pred             c
Q psy15621         98 I   98 (102)
Q Consensus        98 l   98 (102)
                      +
T Consensus       292 F  292 (313)
T KOG3021|consen  292 F  292 (313)
T ss_pred             h
Confidence            4


No 11 
>PF09125 COX2-transmemb:  Cytochrome C oxidase subunit II, transmembrane;  InterPro: IPR015209 This N-terminal domain forms the transmembrane region in subunit II of cytochrome c oxidase from Thermus thermophilus. This domain adopts a tertiary structure consisting of two antiparallel transmembrane helices, in a transmembrane helix hairpin fold []. ; PDB: 1EHK_B 2QPE_B 3S8F_B 4EV3_B 3BVD_B 3S8G_B 3EH3_B 3S3C_B 3S39_B 3QJQ_B ....
Probab=26.37  E-value=84  Score=18.48  Aligned_cols=16  Identities=19%  Similarity=0.272  Sum_probs=13.3

Q ss_pred             hHHHHHHHHHhhhhhh
Q psy15621         78 GTLHVLFGLSLFFYVI   93 (102)
Q Consensus        78 pi~~v~~g~~v~~Y~~   93 (102)
                      +++|+++...+.+|.+
T Consensus        20 ~l~mi~vFi~li~ytl   35 (38)
T PF09125_consen   20 ALAMILVFIALIGYTL   35 (38)
T ss_dssp             HHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            6899999888888865


No 12 
>PF10847 DUF2656:  Protein of unknown function (DUF2656);  InterPro: IPR020325 This entry contains uncharacterised proteins from the cpeY 3'-region. They have no known function, but are found in the phycobilisome.
Probab=26.27  E-value=88  Score=22.97  Aligned_cols=31  Identities=19%  Similarity=0.355  Sum_probs=24.7

Q ss_pred             ecCcCccccc--cCCCHHHHHHHHHHHHHhhhc
Q psy15621         36 LGELGSWFGR--RNYSPRAMTAATSRAFWRWNH   66 (102)
Q Consensus        36 L~ElPsWl~~--r~~sP~~~~~av~Rg~~ry~~   66 (102)
                      +.+=|-|+-.  .++||++|...+.|+|-++-+
T Consensus        39 ~l~hPHW~v~i~s~lsp~~~~~~~v~aw~~~R~   71 (132)
T PF10847_consen   39 ALNHPHWMVEIESDLSPDEMAEELVRAWKQYRN   71 (132)
T ss_pred             cccCCceEEEecccCCHHHHHHHHHHHHHHHHH
Confidence            3344777655  789999999999999988773


No 13 
>KOG2706|consensus
Probab=23.38  E-value=42  Score=28.63  Aligned_cols=23  Identities=43%  Similarity=0.973  Sum_probs=17.8

Q ss_pred             CCCCCCCCccCCCC-cCCCCCCcc
Q psy15621          1 MGFGDYPAEYKPQV-HGPYDPARY   23 (102)
Q Consensus         1 ~~~g~~p~eyn~~~-hgpy~p~r~   23 (102)
                      .|||-||+|=||++ -||=|--.+
T Consensus       274 aGfGaYP~~SdPk~geGPr~~~a~  297 (476)
T KOG2706|consen  274 AGFGAYPAASDPKIGEGPRDLNAF  297 (476)
T ss_pred             hccccccccCCCccCcCchhhhhh
Confidence            37999999999997 588664433


No 14 
>cd00072 GYF GYF domain: contains conserved Gly-Tyr-Phe residues; Proline-binding domain in CD2-binding and other proteins. Involved in signaling lymphocyte activity. Also present in other unrelated proteins (mainly unknown) derived from diverse eukaryotic species.
Probab=22.64  E-value=46  Score=20.39  Aligned_cols=9  Identities=22%  Similarity=0.907  Sum_probs=7.4

Q ss_pred             CCCcCCCCC
Q psy15621         12 PQVHGPYDP   20 (102)
Q Consensus        12 ~~~hgpy~p   20 (102)
                      -+|||||..
T Consensus        11 g~vqGPF~~   19 (57)
T cd00072          11 GEIQGPFSA   19 (57)
T ss_pred             CCCcCCcCH
Confidence            679999975


No 15 
>PF15171 Spexin:  Neuropeptide secretory protein family, NPQ, spexin
Probab=22.07  E-value=48  Score=22.75  Aligned_cols=13  Identities=54%  Similarity=0.994  Sum_probs=10.9

Q ss_pred             cccccCCCHHHHH
Q psy15621         42 WFGRRNYSPRAMT   54 (102)
Q Consensus        42 Wl~~r~~sP~~~~   54 (102)
                      -+.|||+||++|+
T Consensus         5 ~ferRNWTPQAML   17 (90)
T PF15171_consen    5 LFERRNWTPQAML   17 (90)
T ss_pred             hhhhcCCCHHHHH
Confidence            3678999999986


No 16 
>PF02677 DUF208:  Uncharacterized BCR, COG1636;  InterPro: IPR003828 This entry describes proteins of unknown function.
Probab=20.95  E-value=40  Score=25.56  Aligned_cols=6  Identities=50%  Similarity=1.442  Sum_probs=4.6

Q ss_pred             cCCCCc
Q psy15621         10 YKPQVH   15 (102)
Q Consensus        10 yn~~~h   15 (102)
                      |||+||
T Consensus        30 yNPNIh   35 (176)
T PF02677_consen   30 YNPNIH   35 (176)
T ss_pred             eCCCCC
Confidence            677777


No 17 
>smart00444 GYF Contains conserved Gly-Tyr-Phe residues. Proline-binding domain in CD2-binding protein. Contains conserved Gly-Tyr-Phe residues.
Probab=20.51  E-value=45  Score=20.38  Aligned_cols=11  Identities=18%  Similarity=0.776  Sum_probs=8.2

Q ss_pred             CCCCcCCCCCC
Q psy15621         11 KPQVHGPYDPA   21 (102)
Q Consensus        11 n~~~hgpy~p~   21 (102)
                      +-+|||||..+
T Consensus         9 ~~~iqGPf~~~   19 (56)
T smart00444        9 DGEIQGPFTAS   19 (56)
T ss_pred             CCCEeCCcCHH
Confidence            56799999753


No 18 
>PF09782 NDUF_B6:  NADH:ubiquinone oxidoreductase, NDUFB6/B17 subunit;  InterPro: IPR019174  The NADH dehydrogenase [ubiquinone] complex performs the first stage of electron transfer from NADH to the respiratory chain. This entry represents an accessory subunit that is not thought to be involved in catalysis [].
Probab=20.24  E-value=86  Score=23.44  Aligned_cols=45  Identities=16%  Similarity=0.183  Sum_probs=31.6

Q ss_pred             HHHHHHHHHHhhhcc---cc---------cccCCCcchHHHHHHHHHhhhhhhccCc
Q psy15621         53 MTAATSRAFWRWNHK---YI---------LPKKSNMAGTLHVLFGLSLFFYVINYPR   97 (102)
Q Consensus        53 ~~~av~Rg~~ry~~K---Yi---------~~Kk~gi~pi~~v~~g~~v~~Y~~sy~h   97 (102)
                      ..+.|+|.|-+..++   ++         .+=|.+|.-++++++..-++-|.+-|-.
T Consensus        54 ~~nPirrfyr~pl~~l~~~L~p~~g~~~~~~~R~~i~k~~~~li~~w~~~Yy~KYn~  110 (156)
T PF09782_consen   54 RMNPIRRFYRKPLDKLQNYLKPLWGEYYAKAYRHGIFKFTMVLIPAWIIHYYFKYNV  110 (156)
T ss_pred             hcCHHHHHHHHHHHHHHHhccCchhheeeeeeeehHHHHHHHHHHHHHHHHHHhhcc
Confidence            344577777666665   11         2336788889999999999999887754


No 19 
>KOG4458|consensus
Probab=20.16  E-value=46  Score=22.09  Aligned_cols=9  Identities=56%  Similarity=1.084  Sum_probs=6.3

Q ss_pred             CCCcCCCCC
Q psy15621         12 PQVHGPYDP   20 (102)
Q Consensus        12 ~~~hgpy~p   20 (102)
                      .+-|||||-
T Consensus         4 k~k~~pydi   12 (78)
T KOG4458|consen    4 KKKHGPYDI   12 (78)
T ss_pred             ccccCCcce
Confidence            356888874


Done!